The URL can be used to link to this page

Home My WebLink AboutThe Landmark, August 1917=e © a a aia |liams. ©called Williams but because I had noth-I never killed a manEneverdidanyoneanyharm.”:claimed that nad been mis-treated by many-of the werte people.;on Cline ordered the sheriff totakeliamstoRaleighatthefirstMi unity.:iMixms wes placed on trial Wed-:y poping at 10 ‘o'clock,.dD.PF,ayberry and R.T|Weatherman appeared for the de-:nt by assignment of the court.Solicitor Clement apperred for ther,.An hour and 29 minutes wasconsumedinselectingthefollowing.oC:L.H.Yorke,J.L.Reid,R.E.:an,Melvin Brewer from the reg-F jury,and R.Ls shoemaker,C.H.Gant,RT.Campbell,TT.C.-Crouch,-C.Hartness,James|Mitchell,J.G.Morris;and U.8.Yorke from the specin!venire of fif- |ty.Twenty -six names of the specia!|Yenire were exhausted before theJurywescomplete.Most of those:were called had disqualifiedselvestorservicebecausethey E frrmed and expressed the opin-|fon that the defendant was guilty of'eririe as charged,4 The Evidence.|When the jury had been empane!_@d,the State introduced several wit fesses,first of whom was A.Y.Neal,deputy sheriff of Davidsontownship.Officer Neal testified thatonJune30hemetDeputySheriff_Miller in Mooresville and at request |of latter he accompanicd him to the|farm of Mr.James Steele,in Coddle_Creek township,for the purpose of 'serving a warrant on Charlie Wil-The trip was made in Neal's |automobile,which was left at Mr.|BSteele’s house,while the officers_went afoot to where Williams lived,:os distance away.They did not:Williams at home and on inqui- :=theghouse were told by Roxie:ssey tha:Williams had gone to>the woods to kill a young rabbit or |squirrel,At their request Roxie fot no answer.‘The officers had started for their |machine but on looxtng back theysawWilliamsapproachingthehouse|from the woods.They turned andihimbeforehereachedthe;use.Officer Miller told Williams|that he had a warrant for him.Wil-Yiams did not stop and receive serv--ice of the warrant but continued to-|wards the house.Miller called tohimtostonandhearthewarrant.At this Williams turned =around,|dropped a plank he carried in’one|hand,cocked and brought to shoot- ing position a single-barrel shotgun E carried in the other hand,leveled it at Miller,20 feet away,and com-|Manded him not to come near.Mil- —ler’s right hand dropved to his side,he stopped and probably stepped ck ai few steps;Williams fired,|the load taking effeet about Miller's|throat.Miller turned,took a step or two and fell dead.Williams began |manipulating his gun to reload it._At this the witness,who was unarm-ed,left and started for Mr.Steele's :use.When he reached the woodshelookedbackand{ft seemed as ifWilliamswaslookingathim.Wit- |fess went to Mr.Stecle’s,vot help and went back to where Miller hadbeenshot.Williams had gore.HefoundMillerlyingonnisvackwith |arms folded to his side.:On cross -examination Mr.Neal|Stated that he knew of no previoustroublebetweenMillerandWil-_liams,Miller did not draw a_pistol-from his pocket when he was being|attacked by Williams.|.Roxie Massey,colored,at whose home Williams stayed,was the next :ness.She,her little son,Everette;asey,anl Viola McNeely were the'Only ongs vresent at her house whenthekillingtookplace.She told of |the arrival of the officers,of her ef--forts to call Williams for them andoftheirstartingtoreturntotheir machine.She saw them stop whentheysawWilliamscomingfromthe|Woods and saw them start back tomeethim.She was in the housewhensheheardtheofficersaytoWilliams“You are hard of hearing” —and heard Williams say “GetaeSherantothedoor,sawWilliamsdroptheplankanddraw‘.She called to him to not shootBri.and then ran into the house..n Williams came in to the house'ghe asked him what he had done,Hethateverythingwasallright,|and commanded her to get his thingsqy.She told him she could not.|Williams then went to the yard,o her to tell her hushand to :his t to him in the woodsnight.saw Mi haveandbookinhishands testifiedtoprac-same as hismother,ex-ee ottehwere sealant e—JinPhiiacetphia,not received gotice;Espy F.Benfield,Eufola R-1,~reason as-signed; , J tatesville R-6,and Thomas William swink,Harmo-ny,no Cy assigned,—ab-sent without good reason have step-ped into trouble.Of the 45 examined six failed topassthephysicalexamination.TheywereHenryDotsonSummers,Statesville R-2;James Arthur Sher-rill and Eugene Johnston,Moores-ville;Richard Samuel Fraley,Statesville,R-4;Worley Ervin Smith of Statesville. ical ex-Those who passed the phaminationwahwhefiledclaims for Johnexemptionwere:Harry Augustus Alexander,ry,Remengy James Morrison Bus-tle,mas Cicero Barrier,.RandallDeWitteBarnette,Otho AndrewClodfelter,Lonnie Hunsucker,Thom- as Lester Monroe Hobbs,ReubenWashingtonJohnson,David Frank-lin Kestler,Dinney Thornwell Knox, Carl Maston,Clarence Espy -son,Henry.Dalton McLain,RobertFlakeMurdock,Robert Samuel Over-cash,Thomas Alexander Rumple, Witliam Stevenson,John Small,Ver-non Gilbert Saunders,Dan Steven-son,John P.Weatherman,all on thegxroundofhavingdependentwivesandchildren;Frank surette Freeze,James Walter Sipe,Walter Lindsay Woodward,because of dependentparents;James Reid,because of de-pendent orphan brother under 16years. Those who had filed no claims for exemption yesterday were James Lloyd Clontz,Horace Campbell,At-lee Davis,Charles Franklin Foster,John Thomas Gillespie,James Ab-ner Guy,dames Coleman Galliher, lames Lackey,Thomas ArthurMillis,Henry Smith,Samuel Cope- land ‘Troutman,Bruce AustinWaugh,They have seven days from the date of receiving their notice to file claims fer exemption.Of the 50 summoned yesterday 45appearedforexaminatton.Of these13failedtopasstheexamination-—Thomas Harlee Andersen,Lonnie Pinkney Payne,Stamey ThompsonMorrow,Fred.Jasper Murdock,John Cee Sherrill,John Elisha Smith,Meade Compton,John R.Mor- wan,Silas Smith,Henry Knox,Thos. Carter Goforth,Barnett Clyde Camp- bell and James Burley Wilcox.Those who passed the physical ex-amination yesterday were:MelvinFeimster,Arthur Torrence,Frank- lin Burette Wilson,Avery Hender-son Cozart,Clyde Erasmus Gaither,Preston Stewart,|Archie Richard Stroud,Gaston Turner Henderson, James Houston Gibbs,John Bell Glover,Jr,Elmer Clyde Ervin, James Baxter Minish,Samuel JepthaWestmoreland,Ralph DeWitt Green, Glenn Alexander Lazenby,William Reed Combs,Otho Eugene Sigmon,Amos Vecue Brown,Ernest Howard Graham,Ellis Munday,Eley MeeterRenevar,James Abraham —Brother- ton,Frank B.Alexander,John PearlRhinehardt,Fletcher Thompson,Jay Flake Howard,Herbert ParkerClampitt,Mack Brown Broom,Hen- ry Ross Bunch,Avery Beuford Har-well,Roy Tays Troutman,Smith James Hallman.Those who failed to appear yes-ter’ay were:Henry Franklin Moore, Statesville;Dorman Stewart Smith- son,Bufola,R-1;William Blackwel- der,Mooresville;William P.Black- welder,Dunlap;Jehn Crishaw,col-ored,Mooresville;‘rroy 9 Garland Shoemaker,Eufola,R-1. A number of those passed yester- lay will file claims for exemptionbutjusthowmanyisnotyetknown. The exemption board began yester- day the consideration of claims for exemption. Of the 50 who appeared yesterday for examination James Burley Wil- cox,New Hope,“took the cake.”He stood 79 1-4 inches flat-footed and i entitled to exemption on the grounds of excessive height,the government net accepting men in excess of 6 feet and 6 inches unress they are otherwise exceptional.A local wagremarkedthatifWilcoxwereacceptedtheywouldhavetodighimawell to stand in instead of the ordinary army trench.He weighs 145 pounds. POLICEMAN SHOOTS THREE. James W.Reynolds,for six yearssuperintendentoftheNewOrleans ice department,was shot and al-most instantly killed while sitting in his office in that city yesterday morning by Terrence J.Mullen,a patrolman.Captain of Police Gar-ry ©.Mullen,who was in the super-intendent’s office at the time,wasshottwiceinthechest,and George Vandervoort,secretary of the super-intendent,who sought to'’enter theroomwhentheshootingn,re-ceived a bullet wound in head. The om have been dis-posedof since report:Roland Chambers,petitpleadguiltyjudgmentsuspended on“om cost and good behaviour.falter Mayberry and Gusassaultwithdeadlyweapon;aruilty of le assault;is$30 and half costs;Mayberry fined$75 and half costs, C,M.Shouse,loud swearing onpublichighway;dismissed onthatmagistratehasjurisdiction.Otis Goble,assault on female;guilty;prayer for judgment contto[enone —©)payment of costs;when costs paid to be paroled to CWestmoreland.—Leonard Nixon,larceny;pleadty;on account of his deformedanduponrecommendation of thegrandjury,judgment was suspendedonpaymentofcosts.race N.Hefner,carrying con-cealed weapon;plead guilty;fined-$51 and costs. C.M.Shouse,carrying concealedwuapen;polity:fined $30 and helf costs..Jd.Shouse,carrying con-cealed weapon;guilty;fined $30 andhalfcosts.W.J.Shouse,assault with deadly weapon;not guilty.Robey Smith,assault with deadlyweapon;continued. Frank West,assault with deadlyweapon;fined $100 and costs.In an-other case in which he was chwithanaffraywithR.W.and M.F.Orr judgment was suspended on payment of costs.The Orrs weretaxedwithpartofcosts.Jim Byers,housebreaking;guilty;8 months at County Home.Casco Douglass,abandonment;en-tered plea of nolo contendere;judg-ment suspended on payment of costs,Jim Alexander and mma Alex-ander,larceny and receiving;12monthseachatCountyHome.By unanimous consent of the barandwiththeapprovalofthejudge, the civil decket for next week wascontinued. Grand Jury's Report.When the grand jury finished its work Wednesday afternoon andbroughtinitsreportJudgeClinecommendedthepublicspiritofthe county that had provided a CountHomeinwhichthepeoplehadsuejustcausetofeelapride.Ht meant a step forward,he said,and not a dol-lar had’been wasted.He called atten-tion to the jail and said the cells andbarsmustbemadesatisfactoryand secure,otherwise he would have some- thing more to say about it when he came back for next term of court.The grand jury reported that it hadvisitedtheCountyHomeandfound ored females,5 white males and 1% white females.The races are kept separate and all are required to keep clean ‘and buildings are in sanitarycondition.Each room is supplied with running water and lavatory.They are growing on the land 40 acres in corn, 15 acres in red clover,two acres in alfalfa,seven acres in garden,severalxeresinpeasandaniceyoungorch-ard.The farm and domestic work is done by inmates and five convicts. estimated there will be 300 bushels of wheat and 50 of oats.There are 331 hogs,22 head of cattle and three work horses and mules.Five hundred can: of fruit have been canned and thereare2,000 empty cans to be filled,wit! plenty of fruit to fill them. Two white and three colored pris-oners were found at the jail.It was ecommended thet bars which had been sawed out be replaced securely Vive white and eight colored convict: condition. Visited offices in the court house hauled or replaced. Long Drawn Out Case. A case that attracted some interest | was that of C.M.and W.J.Shous:of Winston-Salem.They were =in dicted for carrying concealed weapon and W.J.Shouse was indicted for arassaultwithadeadlyweapon.Th« trinl was begun Monday and was not|concluded nti!late Tuesday after.|noon.The defendants were convicted of carrying concealed weapons were fined 880 each. cember Deputy Collector R.P.A}liso:Constable C.L.Gilbert,Policema: Chas.Fulp,Fireman Barette WalkerofStatesvilleandMr.Will Baity wore on the road near home in Eagle Millstownship,watch 38 inmates—9 colored males,10 col-| Wheat and oats not threshed but it is | |Farmers’Institutes in were found at the chain gang,we!!!z .:fed and things kept in fairly sanitary |45 Mr.J.E.Moses,State pig club Found them badly soiled and smoked |°'@h;and Miss Annie Lee Heating plant not in good shape an-||domesticitisrecommendedthatitbeover-|Mecklenburg. and| Mr.Baity’:| AFTER DR.ALEXANDER.|SHE ENTENTE OFFENSIVE. Docket|President State Farmers’Union Allegedto Have Counseled ResistancetoDraft. The Department of Justice,says a!Washington dispatch to the Greens-|boro News,“has taken ial no-tice”of a speech delivered in Row-an county last week by Dr.H.Q.Alexander of rg county,president of the te Farmers’Un-jon.Agents of department,thenewsdispatchcontinues,will be sent to the State to find out what Pr.Alexander actually said.The dis-petch continues: “According to redepartment,Dr.Alexander’s remarksbordercloselytotheEmmaGoldmanclassandthedepartmer:wants toknowjustwhathedidsay.“Dr.Alexander’s friends in Wash-ington say there must be some mis-take and do not believe he made thestatementswhichareattributedtohim.Some of those who come toWashingtonsaytheMecklenburgcountymanurgedtheyoungmentoresistthedraftbecauseitisuncon-stitutional and told to refusetoleavethiscountryforserviceonaforeignsoil,‘ “The department expressed greatsurpriseandconcernoverthere-norts because of prominence of Dr.Alexander,and the in-fluence which he has among the peo-people of the State,especially those living in rural districts.Should theinvestigationstartedprovetrue,the government is certain to take most drastic action.”The only report The has seen of the speech made by Dr.Alexander in Rowan was the follow- ing,sent from Salisbury to the Char-lotte Observer under date of July 28:“Dr.H.Q.Alexayider of Mecklen- burg.president of the State Farm-ers’Union,in a speech which featur-.ed the second day’s programme of the meeting of the Rowan county Un- ion at Liberty tod:y,made some sturtling statements. “According to Dr.stexander,the government and about all it does,ishad,very bad.Its financial system is all wrong.The farmer up to the time of the present war got no helpfromthegovernment,which was and is busy helping big corporations.TheFederalreservebankingsystemisiniquitous.The speas:er took a falloutoftheStateBoardofAgricul-ture,adversely criticised Congressandseverelyarraignedtheselectivetraft,which he declared to be un- wise,unjust and unconstitutionalwhenitdraftsmentotakethemout of the country.The war had been brought on by a bought press,work- ing in the interest of bie moneyedinterests,and the gist of Dr.Alexan- der’s advice,althouch not quoting his exact words.was that the commonpeopleshouldhavenothingtodowithit.” Landmark Capt.Henry F.Mever,musteringoffieer,Lieut.G.W.Choate,medical officer,and Sergeant H.M.Inhulsen, urrived —in Statesville yesterdayandLieutChoxtewasbusyyester-day making a physical examniation of the members of Company E.The examination will be completed todayindallwhopass‘will be musteredintotheFederalservicebyCapt.Meyer.Just how many will be~re- jected for physical defects is notknown,but some have already beenrejected,Lieut,Choate is from Salisbury. The other officers are members oftheNationalGuardofGeorgia. Iredell. Farmers’Institutes were held Wednesday at Linwood and Shawneechoolhouses.There were talks by Dr.G.A.Reberts,State veterina Newman of Ral- Rankin, science demonstrator of Mr.Moses gave a pigjudgingdemonstration.Good crowdswereinattendanceatboth—insti- tutes.Institutes will he held at ny next Tuesday and at the Jemonstrator;Dr.©.1.and Mrs.Cunningham,all Harmo- StatejFarmnextThursday. RUSSIA'S DEFAULT OUR BURDEN. “Looking from the broadest aspect t the events of the past fortnight Russia,”said Major GeneraltrederiekB.Maurice,chief directorloferations,British war of-On the night of toe Stet of last Ine.|military operations itish war o fice,“it will necessarily mean a prolongationofthewar.We cannot longer count on any great materialassistancefromRussia.This meansagreaterburdenontheotherEntenteallies,and for the United States it means that she must come into theingforanautomobileloadedwith|ticld as soon ax possible and with theliquer.Mr.Nissen ofWinston-Salem |createst possible force.”came along and was stopped and he save them permission to search hi«car,but no liquor was found.About that time the Shouse balongandwerehalted. to the searching of their car,demand the testimony,reached for their weap-ons.Mr.Allison told them he was a ing with him as possemen, hem he was sheriff.This Mr.Gil he told them he thers cam:|ation y objected| ed a search warrant and,according te —Notwithstanding the |va deputy collector and didn't have to|have made goodhaveasearchwarrant,the others be.)tnt The de.|"we c :fendants testified that Mr.Gilbert told their way further into the Teutonic STRENUOUS WORK ON FRONT. Ge is battling with a desper- bly unparaleiied in the war to hold her lines in FlandersagainstthecombinedAnglo-Frenchheavywhichthebadweatherhasonthem,the Entente forcestheirmostimpor-and apperentiy are onlyclearingconditionstoblast front,me.NICHOLSON STRICK EN. correspondent writes e Land-New Hope:Mr.Jo.Nich-stricken with paralysis and is unable toCass,who was re-the auto wreck nearwhowarunder“Binvaaey"onal|v STATESVILLE,N.©.,FRIDAY,AUGUST3,1917. ‘ |‘ rts reaching the aa B | Strikesat Submarine Hase—BigForwardMovement ByBritishandFrench. Thegreat assaultofthe Entente allies,for which the big guns had been preparing for three weeks in along a front offromthe north of Boesinghe andbetweenthattownand Warneton—the end of the day’s fighting foundthatalltheEntenteplanshadbeencarriedout.Freholdingtwolinesofcaptured Ger-men trenches and the foreseen onslaught,battle broke threw vothgunsintothefray,the British andFrenchcarriedouttheirwithdashanddetermination.Atsomepointssodetermineweretheattackingforcesthatfrequentlytheypassedtheobjectiveswhichhadbeenassignedfortheircaptureandpressedonandtookterrainthatnotbeenfiguredonforattainment.Amajorityofthepositionstakenbytheallieshadbeeninthepossessioninvaded and French armies q@ere relatislight,considering the intensitythefightingonvarioussectors,whiletheGermansinadditiontotheirmenmadeprisoner,suffered heavily inkilledorwow‘The French attack which resultedinthecaptureofSteenstraete,waspushedonbeyendthattownandaaaetewe«of nea two amiles.The Britishdeepestwedgedepthoftwo 7troopsontheAisne,it is stated,putdownstrongattacksbythecrownprinceandadvancedtheirines.Wed a heavy rainfall,whichconvertedintoquag- i e s=e i | Field Marshal|wood i &A Oi h mires,almost halted the British and oteFrenchoffensive,wut theanessaystheyconsolidatedthewonTuesdayandcounter-Germanattacksputdown.Meanwhile,saysthereport,om guns of the belliger-ents continue to roar all along theentirefrontinreciprocalbombard-ments,preparatory to the re -mencement of the infantry hawhenthecloudsliftandtherainfallceases.The losses of the Teutons in thefightingthusfarhavebeenextreme-ly heavy,ground at various points being covered with their dead -some of the killed mere schoolboys and seemingly unfitted physically forthearduoustrjalsofthesoldierinthepresentwar.The British alone have taken more than 5,000 prison-ers—4,000 of them on the Ypres sa- lient * German Report. The fighting in Flanders,says theBerlinreport,began in a way thatpromisedsuccesstotheGermanar-my.“The Entente attack,”the re-port asserts,“was intended as an an-nihilating blow at the German sub- marines.The German counter -at-tack either drove the attacking forces out of the fighting zone or back to the foremost crater field.” lities The Germans are right in saying that the opposing forces are after their submarines. Complete success for the alties, sweeping the German line back from the sea along the entire Belgian coast,would be an immediate answertotheU-boat)warfare.The main;North sea bases of U-boat qperations would be stamped out.Possibilitiesofthenewoffensivearethatifthe allied front could be extended to the Dutch frontier,The -Netherlands government might join the allies. Reeent reports from neutral sourves have indicated that the Germans fear some such action by their little neighbors.The Russians. Although the Austro -Germans, continue to press the Russians in Ga licia and Bukowina,having taken further positions from them,theRussianssoutheastofTarnopol,inthevicinityofTrenbowla,have tak-en the offensive in an endeavor topreventthenorthernendoftheirlineinGaliciafrombeingpushedback power of attorney,to >Wallace 286 acres of land intownshipfor$7,162.50. -—Old man Alvis Myers,who ismentallyunbalanced,was in townthisweekandattractedsomeatten-tion by harangueing crowds on the street,__ AVIATORS IN THE MAKING. Twenty-one young men passedthfoughStatesvilleyesterday ing en route from Charlotte toThomas,Ky.,where they will enter training.ey are recent :at a a Jnited States army. whose homes are in Charlotte andsurroundingtowns,traveled on aspecialcar,which was attached to No.11 here. NOT COMMISSIONED, Mr.John Lewis has returned fromFort—,Ga.te"has been in the rs’train campsinceMay..Mr.Lewis Mr.Frank Love of Statesville toreceiveacommission.All otherStatesvillemenintrainingtherewillprobablyreceivecommissions. Mr.P P.Dulin will be with the quartermaster's . GOES TO THE NAVY. Mr.Frank Starrette left this week farther toward the Russian frontier. The Russians have been successful in capturing one enemy vantage| point.On the northwestern frontier of.Rumania the combined Russo -Ru-!manian forees are keeping up their|advantage against the Austrians andGermans.In their smash at the en-emy line between the Putna and Cas-in valleys they have penetrated ittoadepthoffrom10to12milesand| captured 98 guns and in the neigh-horhoed of 4,500 prisoners.| FIRE TRUCK FOR MOORESVILLE A anessee a. 0villethroughtheCarolinaCo.,was on exhibition for Norfolk,Va.,to forwihteValeGateenewhiehherecentlyenlisted,Mr.Star- ville Prin ine yy ‘te spentvillePrintingy. a weck at Mooresville,a odhome,before leaving for N FARMERS’: At the Farmers’Union picnietheStateFarntnpeaknthe ¢. ofTurnerwill to Dr.ClarenceodiveroftheProgressiveFarmer,willspeak inthe forenoon. PICNIO noon on thethe DISTRICT BOARD MEETS.the district60miles frost _in ae Reymond Hamilton of Clin- dames Wilson Gailey,members of the Field ice in France, Saturday.They had been gervice less than a month. casualties in all theaters operations,published in during the month of 1,832 cers and men. killed,wounded or miss- )2,508,while the men num- Country.Colville from 3 ii 9 2 % * , 7 nt ) Gen.Michael Yassukovich,chief of Ss military commission,said in San Francisco a few days ago that if America will senda 100,000 soldiers to Russia it would be tne nucteus for a Russian army of a million men that would prove fata!to Germany. A delegation of nerroes from New York carried to Washinton a peti tion bearing 15,000)sieratures to ——to President Wilson protest ng against discrimination against their race and lynchings,and asking that the latter be mace a Federal of fence. To simulate interest in the nation- wide canning campairn the Nation- al Emergency Food Garden Commis- sion announces that it will give $5,- 000 in prizes for the best eanned vegetables shown at town exhibits and at county and State fairs in Sep- tember and October. Negro men,women and children, estimated to number 10,000,marched down Fifth avenue,few York city. in a “silent protest”parade agains! the race riots in East St.Louis and other sections.Except for a fife and muffled rum verps the march- ers had no music,but carried hun- dreds of banners inscribed with va- rious legends of protest. Beginning August 15 the govern- ment war risk insurance bureau will inerease from 5 to 6 1-2.per cent The insurance rates for vessels and cargoes sailing from American ports for Eur and for African ports o' thee Mediterranean,and from these ports to Americe.The increase is made necessary,it is stated,because of the war. Lieutenart James R.Dickinson o the personal guard of Jefferson Du vis,president of the Confederacy, died Tuesday at Lee Camp Soldiers’ Home.Richmond,Va.,aged 80 years.He wars a n-itve o°Virginia Mr.Dickinson accompnnied Presi- dent Davis when he left)Richmond at the time of the evacvrtion hy the troops of the Confederacy. Seven years at hard laber in the United States disciplinary harracks at Fort Leavenworth is the sentence Private Otto Ludwiy,Thir!Aero Squadron,must serve for making di respectful rema ks Presid Wilson and the American flag,snd for threatening to desert to the German if sent to France.Ludwig vieted by a court mariicl ai Houston,Texas. D.G.Srofield,former president of the Standard Oil Company of Cal ifernia,and more recently chairmar of the boar!of directors,shot and killed himself at his home at Onk Jand,Cal.Despondency due to grief for the death of his wife five years ago is believed fo have been respon sible.He was 74 years old.Scofield was one of the founders of the Stand ard Oi]corporation. The main questions in dispute ty tween 40.000 emploves of Southea-' ern railways and the roads have been settled bt:Secreta) Labor Wilson,who vave ai decision accepted by both sides The ment affects hours of labor end way e4 of inspectors,revairers,train vir brake =repairers,afets maintainers,oilers ard packers and other employe:in the ments. ¢ about ‘as con Fort San of }settle applians 2a Cost of Food in Germany. A report reaching Washingtor relative to the cost of foed in Germa ny shows that many ejibles,parti: ularly those contafming fats,ar selling at almost prohibitive price Fat for fryine is bringing more tha $4 a pound.Goose fat is sold at %536apound.Fowl:cererally ary high.Fresh fowls ermg S101 a pound;larded goos,freast 2.08; salted goose lems,{4 cent country laving her well-fed gee $11 The egg retion at one week wos one eyy son.Horses are in for food and horse —flesh from 53 to 86 cents @»pound.Rabbits are $2 each.¢hevse iedat46to82centsapound young :each; o S19 each Hamburg for for each per demand sells at rreat old at from quot Distoval Georgians. the draft, meeting at Bold +jee red Opponents of selective attend'ng a mass Springs,Franklin court (in leyal citivens who)@ouvht te warn them oyainst unpatyrotic acts.The meectine wax one of a serie:of dem- onstrations in Georgia avainst the law.The presence cf ai UnitedStatescommissionerwithasquadof deputies,probably prevented vio lence.A fund of £17,200 being rais ed to test the constitutionality of the law will be sent to Thomas FE.Wat- son of Thomeon,it was said.The ma jority of chose attending the meet- ing were men beyond the ages af fected by the craft law. Air Raid Fatalities in Lendon. Since the of hostilities 866 na have been ‘killed and 1,O92 injured by air raids in the Lor don metropolitan area,according to statement by Sir George Cave,theHomeSecretary,in the of Commons.During theperio?.the Secretary noted,2, were killed and 7,268 in in ordinary street acidents in same . Stomach and Liver Troubles and actual suffering ix of the etamach and fiver, beginning iby the ase of Chambers!intemee jahthematrialTheyonly Alexander, Carolina Farmers’Union:“Have received y of Farmers’! ‘Union council resolution and argu-' ment.Am confident you never read| ithe bill,No one in h Carolina who cultivates the soil for a living would vote for the Senate excess) profits tax,A farmer worth than $15,000 a year at present rices | would pay $2,071 taxes,while the United States Steel corvoration of a billion and a half capital,making $271,000,000 profits,as it did last year,would not pay @ penny of tax-| es,either income or exces:profits | taxes,under Senate amendment.The farmers in North Carolina will pay| more excess profits tax than all its| cotton mills.Under Senate amend-| ments the farmers in Halifax and Edeecombe counties alone would pay $1,000,000 excess profits tax.In the three pré-war years Mme sarmers of North Carolina made ne profits,cer tainly less thon 6 per cent.This year they will make,wn present prices,1,000 per eent.more thar during the three pre-war years J know a farmer werth not more than $20,000 who will make $12,000 profit this vear,He made “o profits dur-j wy the pre-war years.Su tuined a Under the amerdments which vou ark us to vote for he will pay $4,000 taxes,as will other Sarmers tt like cases,while hundred f corpora tions,especially those in New Eng land and)Pernsylvania,with hun of millior of capital,who made large profits dur the pre war vears and equally as large now, will pay nething.Other nat ind this nation undee present excess law exempt farm:‘rom profit tax.Why shouki vou and cour wnien insist that we should now ut this heavy tax on them’ “The amendment which ve vote for will privet with same capital and eeme busine dvantarwe over at tel of taxetion oss lreda ton exce io corporation, moe individ he matt rived m ean from 2 to FO per cent.on ne ‘ ned)“CLAUDE KUTCHIN SAEee To Prevent Blindness. Staré Health (Siv has mply Th Board ,of completed arrangements with the law passe hy eral Assemib!y rs snd midwive: lution tea be used tes phylactic «7 the eve This)preparatv compulsory last babes, law,1 ow clans and midwives, servarce in the his Stu case of North 4 ered,mas feet ¢ \ semtt ni patou n poachag ihe Ive pile One ingg enough of the op two ove Wrapped ay of the sobutior ampite conta ophy!rT -or tw packagre er a stamped card,beartyg the re address oof the St o Boars Health,aa of }*nana Board of H mmpules,whieh the needs of '*}thi Wt fan 1 .urtns 3 }.i uw with anks fay the alver nitrate ere the offices of the Stat <upply of 40)OM Meiert to meeteal additry altho oa Chance The 17 oO me {' for Those Who Fail. he officers’ training camps emm ther tras camps, the NX by Va. my foobe orevranyzed training:siren Phe furl !frory thevrlourhs period to ew ll'co. training Seuteobher | New York Negroes Demand. that the &A demand resentptior m the board of od eity,was negroes have rep at \ me en New <olutions dele churche ind it Yort made oom ore adopted at aA Mass Meeting of from negro cl fraternil orgar of New York Phe meeting,which was held under the auspices of the Unit ed Civie League,asked that a squad oof firemen and ai squad pehce be appointed in New York and that a bath house pro vided for th eX ne rroes John M. United ©is at the meeti: of politic a! dustrial utive for erates and ubs, zations CIC: al anegrn of negr be lusive use of Royal,president of Leayue,who presided declares that denial istice and repressed in made it imper- to take action des manding that their rights be respect- ed,He said that recent acta against the regro,such as lynechingr in the South and East St.Louis,woeuld cease if the newroes banded tovether and demanded their rights. Seeeaee oportunitie erTroes Summer (Complaint. During tt hes?a menths same mente alent every family ie Wkely to be troubled wit ao unnatere of the how ened it of the erent.trested promptly, the medicine ix f 'ummer lonmeqrenn owt importance the tw whieh ean only be dene «hen howt_at hand ™bh.PF.Beet,SeottertileN.¥.,states,‘1 weed =Chamberlain's Colle and Dierrhwen Remedy ae mach ae Aveyew:ae,A thet time hed &severe at-tock of sOmmer complaint andl was eulfieping Chae doce reliewed me Wer wembers of my family howe weed it with blithe rewwlte,‘ ine iof it when the Henderson man the + for”tag on his car,At while being questioned . a dead faint on the floor and not until he was treated by bulance surgeon that he Prive claimed that he haded$100 to Hight to =repairmachineandthathetoo to pay him back the money, derson officers novtiied hat Price was wantee*there waa taken to Henderson for trial, el Bold Crime in Ratherford, The Forest City (ene coun- y)Free Press tells that thedaugh-er of Mr.and Mrs.C.S.Bunean, who live three milos east of Forest City,was criminally assaulted a few eva avo by an unknown white man,The story is that Me:Duncan,who «a school teacher and hi es- teemed,went to 2 stream about 300 from her home,about iown,to watch the rising waters,Avards } ' i sun-. stranver came by in a Ford ear,ae-| ‘costed her,jumped from wits car and itlacked her,gagging her with a handkerchief.The girl was serious-injured.Ags soon as she recovered she wave the alarm €carch was made but no trace of the man has fyi A reword of $200)has MWTfored ond cdeteettves are at teork ap the case. eensesem Use Drugs to Secure Exemption that young men were }ine to evade conse ription by the use of a heart stimulant which would‘nuse their rejection hy medical ex- iminer heon Inid before United State District Attyrnev Caffey in New Yor!An immedinte —investi- ration was ordered Dr.Karl Osterhaus,of the bureaufonferm>for medienl examin- ?eid ii vould be an easy matter presence of the u red ty would be applic d il heart :‘unt vat art ac been Evidenceiat has y COLerm) a Many Would Be Officers. For the 16,000 plac in the second hic ‘traiuipe eamnms to open Auv- n have anphed and7,T2.0E4 mitDepartment meiderins:E morethoud nded,Pre- en the ap-cians indi- aatic- of apr- timesthepomber thre to fivetror Doeturs Answer Call. |'we,foul Give the Chickens a Chance {Rex' see tha! let queeze th n your fence. are rine,he carrots ard ot chickens Yi G i chance to fee ’Do unto him we him do unto : eeoeee ro BES CALLED IN SEPTEMBER Secretary of War Bater report tat lerge per cent,of the mt truction o°arms n the ere e ready the Na moni mo heen TX Sentember ul me to tom toes 5,LEMONS MAKE SKINWHITE,SOPT,Ci! Vhis Beauty Lotion Mor Cents and See Vor Yours vivl or woman | ”m qujee to en to w out and the =hit emo juce alone i Hn rtaunp,and orchard white this way hoowrh a fine eloth the ju h lemons into a hott nhont chree ounces ¢ .then shake we'l anu whole quarter pint of emplexion Jotion at about uotally pays for a “inary cold)cream the lemon =juice into the bottle,then |remain pure end months,When apvited 7 »neck,arma and hard help to bleach,clear, beautify:the ckin.Any druggist wil up eos of orchard wh'te at h cost and the grocer ha Mal Winnt lemishesstobringshives hould train mootie NOTICE TO NON-RESIDENTS NORTH CAROLINA,IREDELL Cot> In the Superior Con Beto G.B.French,adminis the will annexed of P.B ndividually,vs.Henry S.French.J.Rt Deingerfield.Henry J na,Mrs,George CC.denkthechildrenofWm.T.Key.PJohnMeGillnaKo8.Mef Of the named defendants K Hingenter B KL Fren ! Mra.Virw Dewingertteid,H Cieorme CC.donking,Mrs.Ge ipe and the chiidcen ree netics thatCOMMerncecounty{th tain gent the rein pay lewacies will of the Inte Philip BF.Key.and thedefendantswillfurthertakewoticethat are required to Appenr si the offier of elerk of the Superior Court of rere auntyLatbisofficeinStaterville,N.C.on the othidayofAqwant,191",an?anewer or den the complaint in enid action or the 5willapplytothecourtforthereliefder ‘ ed ln said complaint 3.A.HARTNESS R.B.Metaughlin,Atty.Clerk Senerior Comdaly2,1915 ah an ret hewn mt im th making «ale of ce for aenete te |Statesville Mint Cola ey the | “Nothing Slow About This Fire!”ai g' “The kettle’s boiling already—breakfast will be done in a jiffy The New Perfection cooks fast or slow as you like. The flame is always visible,always It's the Long Blue Chimney insuring perfect combustion thatsteady. does it. For hot weather comfort,cook on a New Perfection. Ask your dealer to show you thé re- versille glass reservoir a new and exclusive feature. ALADDIN SECURITY OIL a superior kerosene,always clean and clear-burning,is most gativfactory. STANDARD OIL COMPANY Washington,D.¢ ‘ Richt AkWoRD FoR wae yk ps :ades >sick- and walt&Bo CHEERWINE at FounArealDris’:, tains and in fotiles, Doors,Windows,Mantels, Locks,Bb .Sach \\t ‘i Cords,Sash }b i 1, Pad-Loehs aod Ehast tC,WALKING,A.4 a Pinne Jredell,”it ht from an Iredell WE MONEY IN TRE- have just paid the Sher- ancther ®50 to renew sell musical instrue for hi»iP 'of should ' firm.hike DELETE!W iff of fp et]our license to ments LEONARDS PIANO STORE, To repair that Casing you cut on ,your lat trip and took chances ;with a blew out patch to get :on.We put it ino meconditiona:it was the day it put on car THE IREDELL VULCANIZING&SUPPLY COMPANY. Phone 201 Court Street.i We sell Miller Tire and Tubes! COCOLADE IN BOTTLES, It’s good.Nuf Sed. ‘Se. Bottled te hae Company.siniacn Ona OE cites *Twenty-four Bottles one Dollar. DR.J.M.HOLLAND. DENTIST.OFFICE MILLSSUILDING. ,BUILDING?T C.WATKINS. om . ae ee ~TO tling "Norko.k, none Va. (New Jemey) BALTIMORE MD @ Charlette,N.C. Charleston,W.Va Chaslestoa,5,CCTION it Good and ‘heap Lands in Bladen ‘ounty Soil that crows cdrn,cotton,tebaceo,wheat, oats,and all kinds of clover and grasses,with 9 good climate.The health and water are as sood as in North Carolina,This land ts very oductive,and easily cultivated.The County i:building am excellent system of sand clay OMe. Writemefor a list of my farm and timber lands.i J.C.HENLEY,=:Real Estate &Tasurance. Elizabetitown,N.C. !rato SR ORL a CITA ah Th”ORT A RTT EIN AE OSyJO Are you ainon:those who have unswercd tienewide appeal to save?The ne- of saving bevond our actual need: to the thongntful ones and we that need will yrow mere appar Pee suiidipg and lean as ceciaiion he best,castest,systiomatic at way to save. THE SAVERS the n: Must cave with our 62d)Series which STURDAY,AUGUST 4.The Prat it off the less you will have ve firsi Building &Loan Association. H.V.FURCHES,-Secretary. You take comfort,satisfaction and pride in the bed room that is pfoperly equipped. It is no more expensive to furnish such a room attrac- tively and right than it is to muss it up with a let of misegiianeous furniture,The important thing is to SEE THE ‘LES AND THEIR FITNESS BEFORE YOU BUY!e offer this advantage! es e a e e e s e s2 4 2 = 1 “4 Begin takingCarduitoday.be the verymedicineyouneed. Goods. Red Raspberries. Peeled Apricots. Cling Peaches. Sliced Pineapple. Graded Pineapple. White Cherries, This is the best line of ‘Canned ods put up.|Miler-MeLainSuppiyCo “WE WANT YOU" YOU”| To try our White WinepicklingVinegarandpureAppleCiderVine- gar.We have a full line ofroundandwholeSpices,sxtracts,Preserving Powders,Jar Rubbers,ete. Phone your orders. .Phone 89, Eagle&Milholland. HarmonyHighSchool.| A Farm Life School For Girls and Boys. —SPECIAL COURSES IN~ Home Economics,Agriculture andtheManualArtes. Prepares for Collere and Universi- ty entrance. Kall term opens TUESDAY,Sep- tember (1,1917. Enyage board new at Dormitories, Vor further information and new Waustrated announcement write to R.H.LANKFORD,Principal, Crepe De Chine manyphysicians.In use over 40 anNMmay NC-1m9 and Georgette Crepe. Shirt Waists i Flesh and White, Newest Fall Models. Some Embroidered, some Beaded and others Lace Trimmed. In the lot there are fifteen or more styles to select Harmony,N.C. Builders Hardware, ing Material, mber,Paint. C.WATKINS,‘phone No.43 .WANTED! SCRAP BRASS—Heavy Brass74c.per ponnd,Ligh,Brass 5e.perpourdaFORSALE: New end second hand machineryforsaleandallkindsofboilerroomsuppiies. G.H.TURNER.Iredell ‘Phone No.14,Beli Ne.1. Battery Trouble Righied.{ Batt trouble,#)ue es pate oe 4 et locate { i u the trouble.All work done by an expert! STATESVILLE MOTOR CO.. bNOTICE! Have left *accounts at Stim-F)son's Drug Store.Those indebt-fedtomecanseeastatementofi}a,omen o make settlement i GoiteL.Sherrill,M.D. hatly in the }|st|Koecial Correspondence of TheLandmark. —the latter Mr,J.N.rk of Moores‘ville.Funeral services were conductedfromtheresidenceMondayafter. FF jnoon by Rey.L.U,Weston of theThreeStanlycountyfarmersmet|!st Baptist church,pastor of theonSunday,discussed the war,Gecensed.wereedand“fout.”‘The AM _Auto Wreck.'|county court,who arbitrated _A Mr.Forest and his brother,|case,advised them to fight Germans.“"°Were traveling in a Ford fromSeinpGheCumber’lution gp.|Statesville to Chester,8.C.,Wed-questing the Teeutech te om nesduy,had @ wreck near Shep- with the allies for an ayvreement}allow drafting of their alien nation-als in this country has been adopted‘hy the Senate. |William.Tyron,a younr facmer,killed his wife and then committedjsuicideathishomenearNashville,|Tenn.,after he had received a sum-‘mons from the local exemption=appear for the military draft.‘had been married only a short time,|Some falling off in the loss of Brit-)ish merehentmen by submarines isnotedintheofficial“summary.lljteenBritishvesselsofmoren 1,600 tons were sunk by submarinesiSmineslastweek.Three vessels un-der 1,600 tons were’sunk,while no||fishing vessels were lost. Willis R.Taylor,who recently en-j listed in the army at Fort Oxlethorpe,}Ga.,has been taken to Newport Newsjunderarrest,charged with desertion|from the navy.Taylor claims that he|feared the naval ship to which he hasHheenassignedwouldnotwetintorealaction,so he deserted and joined thearmy. Emperor William has issued aproclamationtotheGermanpeople'in which he said they might rest as-sured that German atood and Ger-/Man zeal were not being gambledwithforanemptyshadowofambi-tion or for schemes af conquest but |in defence of a strong free empire |in whieh their children miyht live invecurity. AT ESCM A Hot Spell. TWe heat of the past wéek is known of all folks herenbouts.The officialweatherrecordkeptbySupt.D.Matt.Thompson,shows that Monday‘and Tuesday were the hottest daysoftheseries-the mercury clim)ingto97eachday.Sunday it was 94,!Wednesday 96, Ih ome outdoor work onbuildingsinStatesvillewassuspend-don account of the heat,and in one vy more cases men were overcome ruse ‘“y the heat,but without serious re-its. The heat wave extended over afargescopeofthecountry,the,mer-ury passing the 160 degree mark inmanyplacesandvoingashighas105and106insome.Deaths andProstrationswerenumerous,especi-cities of the West and He { herd's,when the car turned over at®turn in the road,,fhey managedtorightthecarandcameontoMooresville,where Dr,Chester wassummonedtoattendtheinjuriesofMr.Forest,whe had bad cuts on hisKneeandhandandalsobruises.Hewasabletoproceedafterhavinghis wounds dressed, Entertain Soldiers.Citizens of the town will entertainthemembersofthePiedmontbatteryatamelonfeastthiseveningoothePharrlawn,near the First|Presbyterian chureh.There will be ;4 prowramme by the MeDowell Musitclubandotherentertainment.Canning Demonstration.Miss Celeste Henkel will give apubliccanningdemonstrationAu-|wust 7th from 2 te 5 o'clock,at thehomeofMrs.8.W.Stevenson.Miss|Henkel wili demonstrate the 4-Hmethodofcanningsoupmixtures, fancy peas,beans,peaches and baby beets.Any pbrson wanting canningdeneorhavingfruitorvegetablesto‘Il is requested to call Mrs.Steven- ron,president of the canning club, ju No.14,and)make arrangements jhefore coming.Items. The Camp Fire Girls,with Miss ¢ farey Wilson,who have been at Camp Latta,near Charlotte,for thepastfewdays,expect to retarn Friday. Dr.Orr of Charlotte passed through here Tuesday en route to themountainsforashertvacationbe- fore beginning a meeting at Kannap- olis on the 12th of this meath,Mrs. A.White arrived Tuesday from the Sanatorium at Salisbury and isimprovingslowlyafteradifficultoperation. Rev.J.T.Ratledge is holding a protracted meeting at Triplettcharch,with serviees twice each dayat9a.m.and &p.m.The meeting wil continue through Sunday. Mixes Minnie Ketehie of “Spencerspending:several days with Miss\ivbeile Cloaninger.Mr.and Mes.1k.Sherrill left this morning —forWinston-Salem to visit their daughter,Mrs.Clay Williams.Miss CoralfeotespentWednesdaynightwithfriendshere.She was en route toMt.Ulla to visit Miss Lena Miller.tie G.We.Taylor is spending aweek's Vacation in the mountains VERNIE GOODMAN, DQ CR O RO O RS es |Mooresville,August 2—~Mes.WattHager,aged 46 years,died of can-|leer Sunday afternoon at home.w near No.2 mill,after a long ilnens..She is survived by her husband,twodaughters,one son.and a of OC : PO O R OR O OC H O , WHITESHOE a li dln On account of other business that will takeourtimewehavedecidedtoeloseoutourbusinesswhichmustbedoneinthenextthirtydays.Remember the time is short“and you will have to hurry to get your shareofthemanybargainsweareoffering, We have a big line of Suits,that will bejustwhatyouwillwantnextseasonandthenforthehotweather.We have a biglineofCoolSuits.See the best Shirt for$1.00 you ever put your peepers on,BiglineofStrawHatsatyourownprices,Many extra good things in cool Underwear,You will have to hurry as the time is short. SLOAN CLOTHIN CO OCHOFOOCD On ielaiel® " oi e AP ag i t ao Are good ones and if you have 'apples they are worth more thanNorth.Up to Wednesday evening it as allan ee neeee ees eauwae©timated that near 300 per 1ONS and for years it wa wil te te incurable.they cost to save the fruit.Applehaddiedin’various places,in three Dorturs pres ited k es and by con gotlays,from the effects of the heat,‘tantly Gaiting to cure HO:Jeet oleenlinent |oe NS Nas :ak adirectlyarindirectly.New York rol pramuneedincuie”uracrt 1 aia Cider will not take the place of theportedthelargestnumberofdeathscondition,ond thea fet I ituti ::in one day —115.Giochi Mel,Gackt G ‘Quart’but to those who have not:-~vy Fd.Cheney @ Co,Toledn,©Member (o,E.in Jail.ate re ray ates *takcn to the water wagon entirely,Ruleich News and Observer,fucen of the Systems.Ge Hundnd Poila ...Governor itiekett fas granted ex.(IMgrdi stored for any ence that Hall's Cn cider will be a good substitute,tradition papers for J.R.Tate.mem-and textimen {ber of Co.EK,Statesville,North Cat axa Fo J.CHENEY &CO,Toledo,Obie :vlina National Guard,wha is wanted Sel by Dp BRR ee 4 Sete ws =e ,'n South Carolina for grand Jarceny,ec te Ret eomntinction,ae ae Fruit Canners,preserving Kettles,and whe is pow in jail at Albemarle,orgy .rats tCant.W.M.Westmoreland.com MARKET REPORTS.Apple and Peach Parers and othermandingTate's company,did net Statesville Produce Market,imakeprotestagainsttheremovalof,The following prices were paid yeuterdny a seasonable goods,the man to Sout Carolina.In fact eee oF she iat eee:from his communication to the Go Hens,erner it would seem tie riddanee wn Kae.ae.py r eeies :onvladlyreceived.He announces —tha Couinen |cos We stris eto please,:.7 *Roosters,je.per tb,discharve of the men Nad been ap Rutter,tied for According to the cherge Boos wa ee,ty er thTatestale4pistolandmoneytothGreenHides,tse.per tb value of $40,—_ancy,™.:Se New Bed Hone er thTheCottonCrop.nd foe ofan weather was unfavorably affeeted by and other conditions durit July,but an improvement to the oe: Old AnIrish to Radber Csine,de.posh atistere '‘ Grain,The following prices were paid yesterday Lazenby-Montgomery Hardware Co. DRESSING |UT OF BUSINESS 4 tent of more than 300,000 bales wo:lfjsrale on the lecul market OS eS eee a atndientedinthemouthlyrepoCorn,$1 eeee re litheDepartmentofAgriculturCats,te de oie Fl Oe aa kt?amr meemD my ecg weer out TaN eawhichfive:wis a production of 11 ve Statesville 6 Hon Market,we 1 ilnO ae,cme Ne iA.a ‘hi,949.000 equivalent 500 pound dal pe yas Piha foe bent grade ela “from a vield of 166.9)pounds per Market firm.ierThecropaverayesaboueeataee4 ¢é |from.oaks later over practiacl;the «FOR SALE—Ford car Nee (ANE ALLEN )[0tirecottenbelt,geri at MI 5 j H \u fAnnouncementofcondition./ieStatesshowsNorthCarolina6oenoltwochorefarminnes*MOCKSVILLE PICNIC.CRITZ,Alien We are headquarters for your motorAneventofnextweekistheanLANDWANTEDtT.Wd with ans one oy car.You want itat all times to be fit.''having reat «‘’*Sizes 36 to 44.nual Masonic pienic at Mock turn into quirs and swayger an)we are splendidlyforthebenetitoftheOxferdernhuthebeetcysten:ois -}}.b —ence d ;dwe.Lieut.Gov.(earner —is t)handtine os 3 provided with the est iric¢anpenker,“Musie by ao Patrol ee and *tested”’accessories.o s Temple A.A.O.N.M8 Vie Pleabe te t :*-:re’Charlotte,”whatever that is.Thurs.Zara"2°Safeguard against delays’and annoy-day,th,is the date we Pak Ce apt ances,bv having your car at all timesPriced,$3.50,$4.00,$5.00}company OF NEGRO TROOPS,298%Brembo SO q ready for any service you demand ofOnerestofnemretroops,MORTGAGE SALE OF LAND,se it,by keeping the accessory detailsdernerrooffieers,wi ”encampe:|é Se?ss Ps .with the white troops trom Ns,Under and {efficient.We have everythin:hereEnglandatComp——,CRarlotte,deedsan tlh j that comfortable motoring 15 heir to,vys the Observer.iv negro com eed executed by JA OM ';£he ,icespanyisattachedtoawhiteregim:Maiden,to Cha >at ibe .most moderate pric es.Ourand$6.00 from Lowell,Mass,comdedin Book tt :/Service is prompt.painstakin,and de-xf a..oa {';>‘>:BRITISH CRUISER SUNK.inom TC ;pendable,The British cruiser Ariadne ha lula Maiden.wy},)..,.|beon torpedoed and sunk,neeordin:maak"N ®'A ((i,~~)R ‘>=te an official statement by the Brit ragpdiog asunba E :=_:ish admiralty.Thirty-eight men awyn to Ouaker Tires,Greases,bers of the Ariadne’s crew were \il }heen made in the jaon :‘0s .ed by the explosion,A!the uther ml imigren thers Maaslield Casing Metal Polish,were st ved,oe bh wert Vvacke veis——|moun Ne i and 7.:hes,Spark 8,-=.°°.:MONDAY.SEI Th ane «-¢ ~.*FRIENDS OF THE LANDMARK .an ——rae 3 Horns,Jacks,Chamois ms,,,-*in Mooresvifte and South Tre Iredell county,und desc cited sind.set Patches,Pumps,Carbon Removers.*dell will confer a faver by gis Y fotlows:Right sere md “4 x **ing news ‘or thes paper to ae fe we 4 Ce F me duane oe a a Cements,Bumpers,and everything else*Mics Vernie Goedman,‘phone sak Mad darts by Cha C Pack ::*8235,Mooresville,who is The cast,cothginion va vn more ‘,4 Body Polish,for a Car.*Landmark's regular corres.*—econd Tract to Bayle Mi a>tell commty,and described and defined **pondent.She will pe giad to rani WAGs Gis Of bah ok hs a W R M°pret the news ane The Land-«nd ef our dinen cackates ‘ms (,7 ’a .°ills Motor Company.i .?nm tar vel wa .“rt ‘ ‘ce eT ate Cipten C Timene wn th Statesville,N.C.Phone 512.|*courtesies chown her.=one went,and ou ‘OVERLAND d HUPMOBILE CARS.;ie *******«arn,:.ES C.THARPE.Morteawes 4 an aADVERTISERSwilt.please bring CHARLES ©.THARER,Ancien eam.Ne change of W.A.Bivintel,Atty Now tut icop:earty. @errow 12 welock =tw- ° 2 «G.WATKINS.THe LANDMARKSse sce se aADVERTISERSARE U 7. but the privilegecivilcasesitisbecausethepartiestheareeonallycerned.Generally theinterest,In criminal Saha : an interest,-4s ed,in the enforcement of the inal law It has become very cummon J defendants charged wiih ve in- fractions of the erimiral &to es- erent.The public has vitally a serious punishment by bar- gaining ~~by agreeing to pay a fine and ane hend for good behaviour for a term of years.That is very well in some ¢nses—avhere ¢he of- fencé is not so serious gs to warrant more severe punishmert,and espec!- ally in cases where the defendant is arraigned for the first time.But in euch cases it e¢hould be the voluntary action of the judge,not solely a bar- gain between the defendant and the .prosecution.While the erosecuter In criminal cases represents the public, teo often he desires to be ovreeable to the opposing counsel and their clients:and sometime.he desires to eseape the tebor that may be neces- sary to prosecute the case In this wey grave injustice very often done and offenders who deserve se- vere punishment escape with little or no punishment.A finei:not serous pun-shment to the man whe has the means to pay it,and giving bend mall matter to a man pho can casily get bendemen,The fines and the honds,therefore,are often a dis- rmination in favor of those able to meet these requiremcats,while those unable to mect them must suffer im- pricanment,even if their offences are not so aperravated.The judges vho follew the lines of least resist ance,by ratifying baryrains made Letween the prosecution and the de- fence,fail in their duty if they do atisfy themselves that such ar- anvements fully meet the ends of justice.Yhose vemerks are prompted —by }ecent settlement of cases in the Sederal court im Raleirh which at- tracted State-wide =interest.For ears,aecording to all rerorts,vio- Inviens of the liquer law in Raleigh and defi-nave een notorious,open int.Tt js said that conditiens in Relciech “were no worse than in some other town,but that was ro excuse, if it were tree.The local courts failet te enforee the law,or at least foiled to byeal up the contitions that bad beeome »disgrace only to the capital city but to the State.The Federal court took a hand and a number of j;rominene ciilzens were indicted.By a bareain with the prosecution)all got Gif vy paying fines and ceiving end to show good behaviour,under a suspended prison not fentence.The settlement mey be entirely proper,but it did not give general satisfaction and there is a feeling that the Inw failed in this ease,ag it so often does.Whenever en offender,and especially one who defiantty Gisregards the law,gets off with light punishment,it is an in- viiation to him and others to repeat the offence.Naturally he thinks the danger ivn't so great.And while the varticular offender may keep in- violate the conditions of his contract, it has little effect on deterring oth- ers,which is one of the main reasons for punishment. The mode of settlement in the Raleigh case is not new.It is com- mon in our’Superior Courts.Very often notoriovs offenders escape in this way,to the great disgust of the people who have suffered by their vi- olations of the law,diresnect for the law is encouraged and other violators of the Jaw are encouraged to contin- ue in their evil ways.Lox enforce- ment of the law in North Carolina go.common that it has practically become a disgrace,in seme cases al- most a scandal.It is hirh time that those charged with law enforcement realize the true situation;and to be- grin with,they should realize that thecustomofallowingalaw-breaker to come into court and name the condi- tions on which he will submit is _necielly tending to aggravate a con- dition that is already grave. ee is es. The Landmark will wait)for a statement from Dr.Alexander before accepting the report that he,in a public oad’in Rowan county, said in substanee fhat the comme: people should have nothing to do with the war and practically advis- ed resistance to the draft.This’pa- per’s understanding of Dr.Alexan- der's pesition while tue draft act was pending was that he opposed the ,measure if it |Was meant to send Americans to foreign soil to fight; that if should apply only in case we were attacked and that’only volun- “teers should be sent abread,TheLandmarlhasheardnothingofhis attitude since the enactment of —the draft law until the repert of his Rowan county speech was published. lt hopes the report is an error,This maper does not want to believe that W.Alexandtr would take the posi- tion reporte).The chare is a grave one.LA EO The latter pari of June We were all assured that che coal miners had entered into an agreement to reduce their extortionate price to a more motlerate bx We were told that a price of $8 2 ton at the mineswastheminimum‘presumably that rice—-wee to be the ayure and that ‘1 dealers would be ellowed notexceeding25centspertonprofit. Well,all of ue who were so simple as to accept that assurance,firured on a conviderable reduction in the ibeoal bill,Have we got it?Not sofarasLandmarkeanfindoutyouthinkcoalpriceshavebeen .te buy coal.And worseifyouwaittoorcer,ine pricehigherascoldweathertnearer,or the raftroads mayrovernmentbusinessonsaatcoumcoal,to sup- PGA cr t —|OnLittle'sycélebrationthewords:“First and Lact Warning.this year.Others Takd Warning.Vigilantes. ue g = he——.Few care to act as informer when .means serious trouble for somebody.The duty is unpleasant,But it must be remem- hered that for —man excused from military some other, must take his place.Therefore,when one escapes service who is not entitled to exemption,that service is imposed on another,and the default is doubly serious. It is not improper to seck exemp- tion if one thinks he is entitled to it. If the reasons for the request are in|accordance with the rules prescribed by the vernment,one is entircly within his rights if he asks for re-| lease.In causes of rer]dependents,| peaple who would be left destitute or! on the charity of the public,or for similar reasons,it is a duty to ask for release.But it the possible misrepresentation of facts that give concern,and the exemption boards should have all the ficts to do equal and exact justice.Prejudice and mal- ice —the disposition to see somebody forced into service,should of course have no part in the matter.But facts that should be known .o (he exemption boards te enable them to pass on all cuses intelligently aid justly,we are sure will be weleomed by the bonrds It is not just to the boards to keep facts concealed from them cond then criticise them if they make a mistake eeeUENLIRLIEseesweGENER is made their reporverableactionprobabl willthough extended debate JsintheSenateowingtoSenateamendmentswhichhaveprovidedforwarthree-member food control board, Wyoming,a Republican,intovotewiththeDemocrats to strike out the war expenditures committee amendment,‘wretrgeg &objectiona- ble to the President. enced by a tacittheSenaterules committee will re- port favorably nieasure a resolution to provi a joint congressional the conduct of by Senator setts. ed they had emerged from confer- ence victorious.The result resem-A nice shi ment of pienic bled a draw.The Senate conferees e S suerificed their war expenditures Hams,Bloe k Cream committee and three-member food Cheese,French Sardi hs, control board amendments,while 4he hoped to see it } Enae't time next week wnt aaa House { ;i be tal Fr *nate #ollow early next Oe TODAY,TOMORROW.AND MONDAY. White Satin Hats,$2.50,$2.75,$3.00,and $3.25. Colored Felt Hats,$1.50,$2.00,$2.50 and $3.00.. Also Dress Hats in Hemp and other Fancy Braids,beautifully Trimmed at less than 1-2 price for this special price sale. Yours truly,=<SMILLS &POSTON. 2 SPECIALS--FOR |PICNIC PARTIES!) e ws (congressionalexpenditurescommitteeand The week's deadlock in conferencewasbrokenbySenatorWarrenof nator War- ren is understood to have been influ- understanding that and as ecigbimanen ”for committee on the war,introduced Weeks,of Massachu Administration leaders wil wage a bitter fight against it.Conferees from each house declar- Potted Ham,Vienna Sau-saye,Potted Hash.Chip- accepted rreatly fixiag and eontrolHouseconferees restricted price errr SOUGE.provisions,«$2 minimum for wheat :’i M esas -pte mace he 1 and less drastic prohibition seetion,ed Beef,Veal Loaf,d ; ;ia op eaipt —Oe ene tig (Under the Jatter the manufacture of iekled Pies Feet,Pork ‘In our $5,000 dealers’gasoline econ- ere ase 1s an »utes ce j or i a lie yore we hd he r hit ited fe e pat on in North Carctina,It MM Sind the President civen power wo [ind Beans,Breakfast omy contest in May,1917,1082 Max. Se aa a IS Timit the manufacture of light wines |Sausage,Cooked Brains,wells averaged 27.15 miles onone gallon Seow ky the ucirevod Ried,cuecete tee necessary,and to Cucumber,Sweet and each. official publication of the insurance ae :nes :icc ae re :: ‘}ones ist :public purposes suc h distilled liquors Mixed }if kles,all kindsrmmanfes“ingurance Held says ter aut ont he may voem ad |Of Cake received daily aoe et ee eere}’’Bs é Je ‘ show decreased loss ratios for the Vise ble.ee Phone me your order,1817,2040 Maxwells averaged 29.04 on year 1916 as compared with the pre- vious year.”A table in the issue ofthepublicationmentioned—shows that the ratio of less in North Caro-lina in 1916 was 47.5 per cent.com- LaFollette and Gronna Pacifists onegalloneach.Prompt deliveries.Quick Senator Robert M.LaFollette of service Wisconsin and Senator A.J.Gronna |>y °And ev carused was an owners of North Dakota have formally _ J R.Poston’s Grocery.car in everyday service. aliened themselves with the paeifist ured with 59.0)per cent.in 1915,el in 1914,44.9 in 1918,57.3)in movement,according to telegrams Phone 134. 1912.The 5-year average was 55.3 from them riven out in’New York ;Thisgreat mileageshowingprovesone 012,‘b.3.0"a a sl :om In only one year in the 5-year pe-by the People s Council,whieh is f : riod——-1913—-was the loss less than conducting a nation-wide propagan-act absolutely. last year.With the exception of ©®,.1918,the loss last year was about 10 Senator LaFollette was quoted as having wire!the councib “net to bepercent.less than the lowest in any one of the four years previous and 21.7 per ceni.lower than the highest of the four years. These facts show — the record furnished ance people that the increase in rates is not warranted.It is simply a hold-up for higher rates,because the insurance people think they can put it over. and they are by the insur- Hardship Not a Reason. Every precaution shonld be taken by district exemption boards,the ap- peal bodies,to prevent discharge of men from the draft on sole grounds of material hardship to them individ- ually or to their employers,,says a circular on the duty of district ex- emption boards,issued by Provost Marshal General Crowder. “It is the interest of the nation solely that must be subserved,”said General Crowder,adding that conse- quently industrial exemptions should be granted only to men absolutely essential to the prosecution of the war.District boards have original jurisdiction in all cases of industrial exemptions. All eases of discharge boards on grounds of dependency are to be appealed automatically tothedistrictboard,General Crowder said,and each case should be scan- ned carefully,though not necessari- ly re-opened for hearing.For each local board an official will be appoint-| ed to act as a government challengeragainstmenwhomhebelievesdis- charged without adequate cause.Firemen,policemen and students in technical schools are not to be dis-charged under industrial exemption regulations. Official Report of Attack. Detuils of the attacks by’German submarines upon the first expedition of American troops sent to France ihe report ofhecameknownwhen Gleaves,commanding by local Rear Admiral the naval convoy,was made public by secretary Daniels.Ss ia The first attack was made on Ad miral Gleaves’flagship and at least two submarines were indicated to be engarred The admiral tated =the belief that the UU boats had knowl edge of the coming of the troop ships, The second group of —transports also was attacked by two subma- rines,one of whieh apparently was sent to the bottom by a bomb drop ved)from an American destroyer. There ix disagreemeat among offi cera of .the chird group as to wheth er they were attacked Secretary Daniels made the report public,with certain military infor mation deleted,after he had sent an uncensored copy in confidence to the Senate naval committer,members of! which recently inquired as to the}truth of charzes in the Senate that!the official acount of the attack pub-| lished on July 3 was greatly exag-|werated . An Agitator Hanged. A dispatch from Butte,Mont..saysthatFrankLittle,member of the ex ecutive board of the [ndustrial Work ers of the World and a leading agita-| tor,was taken from a lodring house | early Wednesday by masked men and| hanged to a railroad trestle on the | outskirts of the city.The hedy wa: cut down at 8 a.m.by Chief of Police | Murphy who identified him Little in a recent speech referred toAmericansoldiersas“Uncle Sam's scabs in uniform.”Since ‘is arrival in Butte recently from Globe,Ariv.,Little had made a nuinbey of speeches to strikers in which he had attacked the government and urged the men toshutdownthemine.body was a card bearing of war trad- werce to work members who threat: rinwout intimidated by ers,”but be f Lo t Lion ot or the ele stand for the ‘repeal of |obnoxious laws.”| Senator Gronna,the couneil an- nounced,had wired that the “eonsti-tution hed not been repealed ner wspended.”| “It is the citizens’duty to obey f the jay:until it is repealed or de-y ‘ured unconstitutional.”said the i i LaFollette message ars piven out by |% the council ‘But he has the ina-by lienable right to fight what he deems «A SATISFIED CUSTOMER Is g is an oeb.exious law or wrongful’PHE BEST ADVERTISEMENT!| public policy in the covrts and at the ,(4 ballot box.This caries with it the We have the satisred customers,A right of free,open —dircussior Let us furnich you.with a list of through the press an!from th:them.‘ LEONARD PIANO STORE. NEW SEED BUSINESS.| Turnip Seed in packages and in bulk.Also a variety of other garden and Field Seed. All New. T.N.BROWN. platform.” “Second”Hand Pianos|’ ¥ Touring Car $665 Roadster $660;Town Car $918; Sedan $985.All pricesf.o b.Detroit We have a lot of second- hand Pianos that willhesoldcheap.-Price $85.00 to $225.Callandinspectthem. Andrews Music Store. Everything Musical. { }Ed.G.White Moior Co. 105 East Broad Street.| Phone 304..———————-——_WEATHERBOARDING,©cad __. Those Who Know Better Framing,Composition,™~XO)eT Than C.WATKINS say Lumber aera in one,two and)::\b> won't be cheaper for many years -,ree ply.|e ne or no ae SO BUILD Now!C.WATKINS.|Ye fi Come see Qur (KEI anENESN SERRE EERE »|7 Elegant |~’DEERING MOWERS.~Cut Glass o :a% SANS“Sa:am.OAr Are you equipped with a cut glass punch bowl andglassessothatyoucan,in an elegant way,serve your friendswitharefreshingbeveragewhenthevdropinunexpectedly? If not come in and see haw handsomely we can equipyouwiththenecessarycutglassandsilverware. We say “necessary,”because,to get the greatest possible joy out of life,it is NECESSARY to live in luxury. And then our cut glass is always appropriate for a present. R.F.HENRY,Jeweler. FOUNDED 1838 CHARTERED IN 1659TRINITLLEGEaoSDURILAMN:C. We are sole agents here for Deering Mowers andRakes.Do you know a ine is something likeahuman-it needs proper care and attention.henputawayallwearingpartsshouldbegreasedwithheavygreasethenwhenyougetreadytouseitagainitwillbeingoodshape.No machine will givegoodservicewithoutcare.Ourwillgivesatisfacticn,last a long time,notcostmuchforrepairs. Om mam==~ p=August | yA exemption board is in session.Alexander's quota is 80first160draw:will ve calledexaminationwithininenextfewdays.If the required number is not‘ound in that list more will be call-ed.The board will be in séssionTuesday,Wednesday andofnext.Miss Cora Keever,daughter of Mr.Morgan Keever,of Sulphur Springscommunity,and Mr.Chal.Barnes,son of Mr.James Barnes of the coun-ty,were married at the residence oftheofficiatingmagistrate,Mr.W.F.Patterson,in the eastern part oftown,Sunday morning.Miss Beulah Patterson of FortMill,S.C.,who visited her grand-father,Mr.W.F.Patterson,has re-turned home.Mrs.R.L.Branson anddaughterofFlorence,8.C.,are guests of Dr.and Mrs.C,R.Ziek-ler at their pretty country home.Mr.Philip Hedrick,who has 2 position inWashingtonCity,is visiting his pa- rents,Mr.and Mrs.W.P.Hedrick. Mr.E.C.York has moved his fam-ily from Albemarle beck to Taylors-ville.They are occupying the resi- dence on the corner,by the ScoutPublishingCo.’s office. Mr.Rowe Campbell has gene toRaleightotakeacourseinpharma-ey.Mr.L.©.Coone and family movedyesterdaytotheirnewresidenceonHighland.‘ ro.and Mrs.John Barnes an‘! children of Pittsburg,Kans.,who have been visiting Mr.Barnes’moth-er,Mrs.R.EF.Barnes,went to Da- vidson yesterday to visit Mr.Barnes’sister,Mrs.B.C.Deal.MissNenti®Deal,who spent weeks here with relatives,accompa- nied them home.Mr.Barnes family made the trip from Pittsburghereinanautomobilein16Thisistheirfirst)visit here in 13 véars.Mrs.Brown was Miss ElmaMayes,daughter of the late Jo.Ma of this county rs.H.TT.KellyandMissHelenAilen areMrs.Kelly's mether,Mrs.Woodruff,in Mocksville.Mr.Paul Campbell hat . Mr.Rowe Campbell as clerk at Me-Kesso:&Munday’s drug store.Mr.W.EE.Wilson,manager oftheAlexanderLumberCompany,has returned from a few days’stayinWstaugaonbusiness.Mr.Reu- ben Watts,who spent several days here,has reiurned to Patterson. Mr.R.C.Deal,who served three years in the regular army,some years ago,has enlisted and is on theprisonguardatFortOglethorpe. The singing class of 14°orphans from the Oxford orphanage gave an entertaining concert to a highly ap- yreciative audience at the court yuse Wednesday evening. The Tax Levy. Revision of the war tax bill so as to increase its total from $1,670,000,- 000 to about $2,000,006,500 mainly by additional levies on intoxicants andonpersonalandcorporateincomes has becn definitely decided on by the Senate finance committee.The de- tailed schedules and tne exact totalremaintobedetermined,but com-mittee members said they expectedthebilltoaggregateatleast$1,908,-000,000 and not more than $2,008,-000,000,They plan to have the measure ready to report by the end of the week.New levies decided on are:Corpor- ation incomes,$162,000,000;incomesofindividualsof$15,000 and more— $27,600,000;distiliea spirits, $96,- 000,000;malt and ferme-ed liquors, $25,000,000 =Thesq aggregate $304,- 600,000Increased taxes on brandy for for-tifying wines is expected to yield $10,000,000,increased tax on wines$2,000,000 Other exes considered are excise taxes on sugar,coffee andtea,with a few new taxes,possiblyongasolineandfirearms To secure $162,000,000 more from incomes of corporations,joint stockcompaniesandassociations,includ-ing life insurance companies,thecommitteedecidedtoincreasethenormalrateonsuchincomesby2per cent,trebling their present rate anddoublingtheraf®provided in thebill.The new surtax rates on indi-vidual incomes of $15,000 and aboveremaintobedefinitelyfixed,The committee decided to add ataxof$1 per gallon more on distilledspiritsand50centsmoreperbarrelonmaltandfermentedliquors.Thiswouldmean$2.10 per gallon on dis- tilled spirits,which now pays $1.10, and of $1.75 per barrel on beer,nowpaying$1.50 WITH PIEDMONT BATTERY. Mr.L.E.Dimmette has joined the Piedmont Battery at Mooresville.He left this week for Mooresville to join the company.Mr.Dimmette,whose home is in Ronda,has been with the loenl office of the Metropolitan LifeInsuranceCompanyforayear. and children, visitingWw.T Thursday | ‘ef Mount 1! 1 .jyeuwillcomeagain.J.duly 320°.ee emaem‘SALE OF LAND. NORTH CABOLINA,Under and by virtueofthevierCourtof|the special proceedinglerman,administrator,va,comved,ve.Raymond dosey,” * commbeloner will,on af When the call came|teers most all the youns menButfinallytheconscriptioncame andtheoldermen~that had families,1 Pe- member very vividly that September{lost wodlittle damit |When my father left for Richmond,ka Mrs.Plott &sad time.J.¥. spending three weeks in Lineol si.Mrs.W.L.Hill of Gainesville,Fla,ie spend-ing some time at Connetiy Springs.Mins Manetta Crowell has gone to HighPointtovisitMrs.W.Freese and Mra. E.G.Kearns,Mr.C.A,Dimette of Ronda was here thisweektovisithissen,Mr.L.EB.Dimette,Mrs.EB.RR.Rankin and tittle son,Bdear,will leave today for a two weeks’stay inAsheville.Mr.Rankin will join them later.Mr.and Mrs.A.P.Steele and little boy willgotoBrevardtodayforashertstay.Theirlittledaughter,Lila,who has been with friends in Brevard,will return heme with| them, mornineblown.EE eae ; pply ot BRADFORD KNITTING Mit.|sane,8%ee-|LO8T—Blectric Iron,Return tosonnetgpWitleson,|BELK CO.Aus. |LOBT—Umbreita,initials “L.D.HL”on|handle.Finder picase return to MRS,C.¥.HENKEL.Aus.3-26. WANTED-—Tenant for small d-horse farm. "Good steck and tools furnished,Near geodk.aches!and churches.Address “S"\cnge The Landmars.Aug,@«it. FOR SALE—One «vod driving fram bugs?and hartiess,one colt and one mith.dvese BOX 78,Statesville,N.C,or “phone S71 Black.Aug.3-10.* FOR RENT—Eicht-room heuse,modern venlences,barn,with four seres of tad,amemileenstofsquageAddressBOXStatesville,N.C.,S71)Black.Aug.3-10.*phoneandMre.T.G.Faweette and childrenAiaryarrivedyesterdaytospendsomedayswithMr.and Mrs N.B.Mills.Mise Elizabeth Cunningham,softer atiend-|fiz a house party in Tarboro,visited friendsinGreensboro,returning heme this weekShewasaccompaniedbomebyMissMiriam DeBerry of Tarboro,Mre.Poul J.Rhodes and Miss Cecil Rhodes Phone 416 Black.duly 41,ais sivnetaGieseenntianecia-oer«\sents siesccetnscaercecealiomersecrapenalnntliiiai> |POR SALE—Pive passenger Cadillac car,goodcondition.Chenp,for cash or oa time,d. C.HENLEY,606 cast Broad street.duly 31 at. keeping. p «(lime 78.and FoR RENT—Three reoms fer light howse-to MONDAY,SEPTEMBER 3%,1917,at 12 o'clock,af the —hemtane om of ae dell county,cell at publie auction to weeatbidderforensh,the following traet of land,te-wit;Lying and being ip PalistewntownshipoftheaforesaidSiateandcounty,sd beginning at a stake or «mall woodinKestler'é line,and evener oftheneenorthDSdegreesenst182 poles to astakeintheeldtine;thence with said old linenerth7)degrees west 31 poles t #stake or pine knot,corner of lot No,6;thence south18dewwest18%peles to a pine knot orKestler’s lime;thence south 77 de-eost 3)poles to the beginning,contain-a6 nerves more or less,sod being lot No.4 as allotted in the division of the Mike Joary landsSecond Tract Lying and being in PalistowntownshipoftheefovesnidStateandcounty,awijeoining the fleet traet above desertbed.and bevinning at a small dawweed or pine knot,corner of lat Neo.4,and yanning meorth 18 ‘de- vrees cast 182 poles to «stake im the old thenee north 77 degrees weet 30 pollen w «pine knet,eormer of lot No.6:thence woulh 1S degrees weet P82 poles to a stake or knot in Kestler’s line;thence south 77deycast30polestothebevinning,eon-sining 25 acres more ar less;and being lotN»s allotted in the division of the Mike ‘take in wre pitie Traet Lying and being in Falletown p of the aforesaid State and county, toe grins mane take on the old tine, hown ¢the line;thence south 9%lexrees wert 72 poles te a stake on the old line.thence eaat with the oid line 15 1-2 poles »steke on said tine;thence north 9 derrees'poles to a stake on the Parker ling. ve with said Hine 15 1-2 poles to the be- ny,containing 7 acres more or lesa.R.T.WEATHERMAN,wit 40.Cmmissioner.~-~-olip-ceentpentanmewneimentet at a@ Parker eet ther vinn ss several |" and ten are day#.vei huve returned to Hendersonville after a visittoMr.and Mrs.T.L.Steete here.Miss Hattie Ward ieft yesterday for Lau-rinbura,where she will vieit friends,;Ran.Stimson of Asheville and Mrs.W.G.‘Iimpieton of Kentucny are in Stateaville to spead the menth of August with their#father,Mr.8.W.StimeanMrs.J.H.White and exughter,Miss Kath- evine White,of Greensboro,who have been at Lake Junaluska for the post two weeks,arrived Lere today to spend a week with rela- tives.Rev,and Mre.J.Clyde Turner and MissMaryTurnerofGreensboroandMiesEulalia Turner of Thomasville will return te their respective humes today after a visit to rela- tives here.Miss Fllizabeth Hartness lenves today forMiriontovisithercousin,Miss Barr Morgan. Misa Magraret Kirk of Chariotte is visiting in the home of Dr.P.8.WasleyDy.and Mra.Walter Walsh of Sherman,Torus,are visiting friends in Statesville andBariumMiesLillianKetchieofKinstoningberbrother,Me.J.M.Getehic ‘Lillian Houston,nurse at Long'satorium,and Miss Myrtle Houston of ¢lott she he initing Miss MBrady.left Black Moun Miss P'leme te »who was Miex Bou wuest,returned to Chariotte yosterday ”und Me A.1.Sanith have returned‘ou trip to Washington,Baltimore is visit- San- e MorrixwitingMreFred of Litale Rack,Ark., yesterday after Shane le for reJM.Wagon an! ovte of Mr ( irainin Steele left vou wilh vi Mix Ruse Stephany isinWaynerville Mian Wise,tovium,Rave smending a few days at Long's Sana- to «pend whe is a nurs gone te Bridgewater ne ‘went ion Mrs.D.G.Holeomb,who he .returned been visitinetoherhome «Emme MelIntosh C..are guesta of Mrs. will and ~Carmicha:! arrive tadmy te peta heMrs¢.W Mr.J.W.VanHoy,+ernment service,withownUbix week,2MaynardofNorthWilkesboro, Stony Point, weekvillleaveteday for a f Cordetia,Ga, family,with Mr 1 street ho is now in the gov. headquariers at Ma-ton)owas inMesROHwhepending a few weeks at was a Statesville vistte>thisMissArnieMoore visit in Hiwh Point Notices of New Advertisements wanted fo andma vk Rivht-ragmy house |black small farm 3 care fox rent Box 7% ruv and harness for sale Th Mba flows for sale .Mearesvill: and Sey olie lines &Ce Mortgage «Tharpe thewMaawellcarBa a mntion a ( Templeton,Wit wale of tember ChastyWhiteMoterCo Theatre,and wthSpec Clreeery ale for plenie lunches P|R.P Geod furniture money in the ban) rewferd-Huneh furniture Co New autumn blouses.Ramses Timen (4. Motor troubles Special prices on new Stvledom's modes Wiite Shee Co Gold handledHenkelR.T Wentherman, land September Sd.Two hiwh-class farms for sale Lawerhlir Atty Sate of land for taxes. sherifMan wanted toKnittingMillKBlectrieironlost How los Mor Statenvibte hats for Mot Co Miits &Posten autumn.Sherrill. Nr C2 Yumbrellalost «ellcommissioner,wil rR.B M.P learn =dyeing Jobneten-Belk Co Cattle Barn Burned—Personal. ‘orreapondence of The lanernart York Tnatitute,Aug.1 Mr.Nichadthemisfortunetowethieeatth burned Inst nivht,One cow wardeathandanotherbadlyburned ih is not known just how the fire started They had finished threshing abowt 2 o'clock and later pot mei ostraw in the barn and chaff gn theThefirewnsdiscoveredoffer10 o'clock by Mr.Dewey Lackey,who wae pane ing.He gave the alarm and the prompt ar rival of neighbors prevented what micht haveteenatrawedy,as the straw atacks,theotherbarnanddwellingwerealinearand the family were all asleep Mr.Lioy¢Sharpe ond littl daughter from Indiana nre visiting relatives svound here Mr.Sharpe left here seven years ago and thiishisfirstvisitback,He married in Indiana hin ve ife dying there last winterMeeseGlennSharpeandMaynard Lackey left lust wee for the enetern part of State,M T HO Laekey has returnedCharfatte,Mra.Annie Deal and litite rs Karl and Fred,ere visiting in)Mooresville Mr.H.N.Sharpe took in the District Con ference at Troutman last week M Drum and sister,Mise Mary,came home yes terday from a visit to their tem? Statesville Social Items. A number of young people chaye Mr.and Mre A Amaker ahd Hire barn burned to the from Cleorge wister oned by Mr GonStevensmeteredtoSulphurSprings,Mididenite,Wednesday afternoon for supper \rveoungtheyoungpeoplewereMissesJulietPMietol,Bertha Cooper,Marie Stevens,Beatrice Cun-ningham,Charlye Tomlin,Catherine AmakerwadBlancheAmaker:;Messrs,Ren Cooper,Jaek ere,Mauri@e Dunavant and @erryGuy,and Misses Gladys StevenAmaker. Mre.W.EB.Anderson was in Charlotte ta and 2 and Bettie FOR SALE—Ford delivery bedy.See CARL ALEXANDER at M.P.Alexander @ Bro’» store.Jaly 27. POPLAR WOOD-—We are paying highent cashpricesforYellowPoplarBiecksandLoge.Write or call STATESVILLE VENEER CO. duly 17. DR.R.A.BASS At your service cay or night. Reasonalle charges.Day ‘phone oO,night "phone 453 Red.Roller Flour Mill For Sale.|_!\»“Ave ® offer forthebewt140-barrel mill. in one of the best towns im the State.CorrespondencesolicitedTEMPLETON,WIL-LIAMS &COL,Mooresville,N.C. Aux.3 4t, ES if You Use a; Your building will lock well. The Paint will wear well. The Paint cost will be nee,you will have FEWER GALLONS to buy. What stroncer arguments do you Two of tie firm sale heving died,we privately.one of .>‘\J kK I ()l \Ss 4 4 ae Two hiwh-elu healthful communtic wsary outbuildings x lentiy adapted markets >mutes highway of nearly a mile ith sidks ;about 160 aeres eludiny pasture,romaine -roem tenant hitene Other abo an rome| cultivation:wired for pasture;good mipadow eres fertile,dredged creck bottoms ihee promurties are especially suitable to occupancy,by owners Ne foreed sale and neevifice,but en*weiy fie and ren-nable.If nterested.under these condition».©oor addres k.B.McLAUGHLIN, Auy.3 Attorney. RUILDING?C.WATKINS farms of 200 aeres each,inwoodresidencesandal) fine Moatoaltcrops;aecexsible to One hax wraded top-soi! vith ownership oncultivestion,in-woodland;nev and barn nheee hade trees, daily in lowent, Lop-seit about balf in °,j vrbees FOR SALE BY Lazenby-Montgomery Hardware Co. Stateaville,N.C. oY —_ You don’t have to be told that motor trouble is the one ‘‘fly in the ointment’of the autoist’s happiness.After you have given usa trial youwon't have to be told that this is the place whereyoucanridyourselfofsuchtrouble. If motor trouble is not positively inherent in the engine itself we can cure it.Anyway we cen tell you what is the difficulty and you will save time,worry and money by coming here first. ss)rr },Perey,MOTOR CAR .gelta Styledom’s Latest Modes _—_—-FOR FALLS »ee Aen 4 An extraordinary display of Woolens in full length drapes ~By -——— THE GLOBE TAILORING COMPANY OF CINCINNATI. Orders taken for immediate or future delivery. SHERRILL-WHITESHOE CO. AUGUST 6TH AND 7TH. Globe Man,Mr.J.P.ALLEN. | ! lot No.33) The man who stands still long enough,will have something come along and hit him.He will run into something if he travels too fast.' |The safe,sane way for a man to live is to work hard and always save a PART of what he earns from his work or his business and BANK that part. Nothing can stop the SUCCESS of that sort of a man.Are YOU that kind?, Make OUR bank YOUR bank We pay 4 per cent interest on time deposits. THE FIRST NATIONAL BANK, Statesville,N.C. }| | ret <2w ‘The Thoughtful Hasband Supplics His Wife With|Modern Kitchen Helpers.vaNomanwantshiswifetoworkherfingerstothe'He wants her to have everything that will make her‘easier—-save her time —give her leisure~for this makeshomelifebrighter,happier,sweeter..No wife can do herself and her family justice,whensheisallfaggedoutbyneedlesswork.Every woman who does not know the value of the|McDougall Auto-Front should visit this store without‘delay and learn how it cuts kitchen work in two, Williams Furniture House. a Served at the Fountain of Quality Exclusively For 10 Cents. CHOCOLATE NUT FUDGE MAPLE FUDGE CHOCOLATE FUDGE BUTTERSCOTCH FUDGE. Statesville Drug Comp’y —The Rexall Store.— FOR SALE 80-acre farm in Harmony State High School district,onpubliesand-clay road,50 acres in cultivation,balance in woodland,new 7-room dwelling,large steck barn and out-buildings,good orchard,desirable location.. 260 acres,three miles from Harmony,75 acres in dulti- vation,30 of which is bottom land,150 acres in fine oak,poplar and pine timber,two tenant houses,large stockbarnandout-buildings.For further information call on or write: ERNEST G.GAITHER.Insurance,Stocks and Real eee eeee Wehner eeeee selling of ice cream at aoeOecbeeveeeesaf6likethisismoreor Se game by the ladies.When @ pretty woman,and a Civie Leaguer at that,asks you to come across with the coin,it’s a bit hard to turn her down,even if you don’t want what she is selling.Let's leave off refreshment at the band concerts,please.. And one thing more.What's— come of Statesville’s Red Fund?Some of us who made con- tributions have received no receipts and have seen no pubtisnec ac- knowledgment of our contributions. We do not question the honesty of the solicitors,and we know the mon- is in good hands,out we would fike to know who gave and how much.*SDDLER. No Special Exemption. North Carolina officers and em- ployes of the State Departments are not to ask exemptions different from those of ordinary civil‘ans,if the res- elution of the Council of State,unani- mously passed,sets the pace.The resolution reads: “It is the sense of this meeting that no State officer or employe in any ex- ecutive department of the State gov- ernment should claim exemption from military service under the selective draft law by reason of the fact that he is a State offer or employe.This resolution is not intended to apply tc claims for exemption by such officers or eny es who may have valid ‘or exemption other than thy that they are in the service of the State,but it is simply intended to place officers or ~~loyes in the executive department of the State government on the same footing as citizens engaged in private business.” TTT :Killing at Hickory. Hickory Record. Henry Barber,edlored,came in on 85 Tuesday night from Coatsville, Pa.,went to his home in East Hick- ory and shaved and then struck outtolookforhiswife,who was not at.He found her at the home of Vietor Knox,another negro,and be- ‘ore Barber came to pofice station be tween 12 and 1 o'clock end surrender ied,he had traced a razor three times scross the neck and face of Knox,and n Night Officer Triplett,ChiefntzandDr.T.©..Blackburn reach-ed the scene Knox was dead in a pool of blood.Barber's wife receiv- ed a cut in her back os she hurriedly her exit from the house,but her condition is not serious. .Revenue Collections. During July Collector Watts of this district collected $2,262,941.71,inter- wal revenue taxes,as follows:pane $2,266.927 91 rrencydneometaves Daquor HeenseNarcoticlicense OleomarvarinePines,penalties,ete MaaThisisanincreaseoverJuly1916 of $903,654.95 or 66 2-5 per cent. NOTICE TO CREDITORS. Having qualified as administrater of the estate of S.J.Josey,decensed,thin in to notify all persons having claims against said estate to present them te me on or before daly 6,1918,or this notice will be pleaded inbaroftheirrecovery.All persons indebtedtovaidestatearerequiredtomakeimmediate settlement R.T.WEATHERMAN,duly 6,Administrator RE-SALE OF LAND. By virtue of an order of the Superior Court 1917.° made in the case of JR neon,executorofTobithaTrivett,ve.Jonathan Trivett,theundersignedcommissionerwillre-sell thelandsherafterdescribedaipublicouterytothehighestbidder,at the court house Btatenvilile,MONDAY,AUGUST 2),141 at 12 oelockh,m,bidding to commence at$825,the following hands,to-wit a A tract of land situated in Union Groyetownship,Iredell!county,North Carolina,ad joining the lands of Nathan Trivett:and ott ers,and bounded as follows,to-wit Beyinning at a red oak on Tutterow's landthencesouth37degreesemat21poles @take;:thence south 47)poten to no stake inWilliamMullisline;thence weet with Mulfis’line 76 poles te a stone in said Mullis tine;thence north with stephen Mullix’line90polestoastone;thence with 1STutterowsline68polestothebeginning containigy 32 1-4 acres.more or lees Terme of sate Cash JR.JOHNSON,.D.Turner,Atty Comminctonerduly25,1917 [TAKE NO CHANCES. The expert sent to Atlanta,Ga, to examine inte the causes of the thoor in lo a great fire there May 21 found that “the Atlanta disaster was essentially a ‘shingfe-roof’ con- flagration of the familiar type.” A word to the wise is sufficient. See us for a tin roof. STATESVILLE TIN CO.‘Phone 66,114 B.Broad Street. _C.H.LESTER, Benton,Mrs.C.E.,77 nerves|Comba,Felix,6 aeres ;;Heupe.J.FP.and Mrs.C.L.,186 servesHoupe,J.F.H.,26 acres : Houpe,J.B.,#2 acres|Hayes,Mes.Pf.A,176 aeresHartness,J.F.,5 acresHampton,Mrs.A.,Bat.,|Moore,W.A.,#9 neres : Moore,J.W.,48 1-2 acres ..|Nicholkon,Miss R.B.,06 1-4 seres |Nicholson,C 14)1-8 acres |Pressly,D.J.4,26 acresSeott,L.F..68 aeres Sowers,Jno,341 acresSowers,Miss Jane,192 acresColored.|Allison,Jno,5 acres . ,2 heres|Bailey,Vietoria,15 acresBrocher,Ellen,5 acresColvert,Wiley,1 1-4 acreCowan,Julius,1 acre .Chipley,Anderson,|acreDavin,Violet,110 acresDalton,Robert,2 2-4 acres Davidson,Will,46 acresLyneh,Deck,18 1-2 acres|Summers,BE.EB,28 acressunvs,Amos,4 3-4 acresSmith,Austin,78 1-2 acres Wellman,Jao.W.,38 acresChambersburg.Rass,C.S.,82 1-2 aeres Bailey,W.F.,283 1-2 acresBeard,A .17 aerenBrown,N.E.,242 acres Chester,W _and WON 63 1-2 acres Crowsen,Bud,Farm,Red Crest,1,100 acresMoore,F.L.,243 acresMcCoy,J.W.,118 acres MeCoy,T.F.,108 acresOvereash,Mre.D.W,,83 1-2 acres |Page,G.S.,70 1-2 acresPoteet,W.8..100 aeres .hepherd,C.F.,88 aeresSomers,W.N.,229 acresTucker,E.E.,4 aeresWebb,J.W.,160 1-2 aeresArthurs,Mrs.J.8.,32 1-2 acres Christy,M.A.,104 aeres Giteon,A.A.,32 acresMaddin,Miss M.J.,23 1-2 acresjenis,J.Y¥.,24 acresMills&Moose,219 acresMiteheil,J.W..136 acresMurdock,Austin,82 1-2 acresMcLain,J.A.,111 acresPhifer,B.FP.80 1-2 aeres,Phifer,J.PL,1-2 acreSimons,Mrs.Mo L.,103 acresSmith,WoL.¥7 aerenWhiting,Mrs.Annie,60 acres Summers 21 aeres j Allison,Abner,57 aeres Avery,HMordy,4 1-2 acresChambers,Arthur,1-2 acre Chambers,Mack,1-4 acreGtover,Dora,1-4 acreGlover,Thos.,1-4 aereHaynes,Laura,2 1-2 meresKnox,KJ,13 1-4 aeres Patterson,Foyett,|sereVatterson,Herman,1 Pearson,Armpn, Pearson,Rickard,|acRobertson,B.D,7 1-2 acres Smith,A.C.,10 acresStevenson,Jule,7 1-2 acres‘Tucker,Patsy,A aeresWaddell,Alex.,2 acresWestmoreland,H.D.,4 acresWhite,A.P..40 acresChambers,David,2 acres Chambers,Sophia,4 1-2 acresGray,Jno,and Guas,22 1-2 acresHall,Lissie,2 acresMcHenry,Lina,1 acreWhiteDelinquents.crown Heira,105 acres Ayers,J W.,35 acres Goodman,J.L.,97 1-2 acresPiyler,Mra.8.R.,150 acresGeay,dno.,22 1-2 acres Lentz,Mes.Jerry,36 acreSmith,Mre.BR.M..50 acres$Miss Annie,&acresP.,guardian |acreW.RR,801 aeres Coddle Creek. Arthurs,Ko W.,1 lot Baker,Mrs,Wo OA,2)acresBarwerBros.204 neresBass,1..2 lots Renson,JF.1 lot Brown,Wo dD.1 fot Brown,Wo A.,72 acres,Brown,James W.,Carpenter,WOOP, Colson,AO W.6 Cook,WoL hots Cranford,No PP,1 lot Cranford,A.L.,1 tot Craven,F.M.,239 1-2 meres Cres yell,DL M.admr.,66 acres,1 lotDeaton,Zeb.1 lat Deaton,Mire J.W..6 letsDeaton,To J.1 lot FPairchilds,J.FF 2 lots Fleming,ROB,1 lot Follett,J.©.1 bot Follett,Mre ao ,lote CGeodman,Pood 23 acres,1 dot %hots 1?Vote lote lots foudwer,Mrs A]W.,109 @eres,1 botfaudver,A.W 1 fot Hambright,Tom,fotHart.DF.1 botHobbs,Ko M..65 werex 1}Jot Wanter,Bod 1 hots fredell Farmers Warehouse.2 lote Jackson,JH letJohnson,JW,les ueree Kennerly,X PLL fot Kennerly,Jo.61 1 meres Kerr,Katie,|lot Kerr,BO OW letslevan,JON.1 totLinder,Mr WoW,ft odot Melehor,WW.oS totsMiller,S DD.1 tot McLetland,J.R.heirs 1 lot Overensh,J.[peres Overeash,3 Lee,70 acres,|lot Vatterwon,KR.L,150 Pope.J.C.1 lotMeid,TA,1 dotRoberteon,Tom,1 lot Sherrill,J ¢1 bet Shue,Mre Ellen.1 lot Sloop,MA.1 lot Smith,dno.C,lots Stollings,WP.1 totTeeter,W.T,50 acre:Wallace,F H.1 lot Warren,J.1 het acres Wood,WOH lots Young,J.A.36 aeres,1 lot Brown,Mos.Prank,145 acresCarpenter,FA.1 lot Cashion,M F..1°lotChristy,F.Gi.extate, Davis @ Wiley BankPearman,Frank BFerrell,Mo ©.o1 tetFerret,C.V1 ket Matheson,Jumen A.1 fotPerry,dno Mt lot Senith,Mis.Laura,27 acres Templeton,Grover,14 aeresVanderberth..Mrs.1 let‘Wagoner,I 1...2%lotsWileox,A.W.1 botBrown,J.W.,38 acresFortner,J.L.,192 nervesHudson,Lee,1 botColored.Krown,Stokes,1 lotarr,dow,1 betCamphell,Mattie,|lotee—o K.,1 bot rae for ene Teors,8-ef,Jno,1 ;‘oeBnetl,Jim,1 bot|Brett,Joe,1 bet 114 acres 194 acren 1 bet Paulkner,Fo —.t het i 1 lotmkt £06.98 |Cathy,A.M. aunt 36.22|Sills,Mrs.FR.and O,G,,35 acres Mouse,J.O.,22 acres .,en 5.40)Dayvault,Mre.Alice,188 acres.4%Cool 2.23)Beard,R.C.,6s acres92]Cloer,J.1,112 eres M1}Carter,W.W.,189 aeres 4.43)Carter,W.G..30 acres . 4.1)Holland,Mrs.Bettie,165 acres 10.10)Horton,W.F.,34 aeres 3.56 |Moore,Wo L.,178 aeves §.63 |Montyomery,BE.N82 acces 9.64)Morrison,J.H,46 acres624]Smith,Wo L.,47 aeres 1.28)Smith,Mrs.Jane,240 acres 1.40)Wilson,R ,TS werves10.43|Webb,J.W.,45 were:j Colored.| 18.98 |Roseboro,Enos,4 acres 40.39 |Stevensan,Jim,40 acres i Turner,Burge,36 acres 23.63 frevideon. |Brown,HJ,265 acres 10.5%)Bank,Davis &Wiley,208 acre 1.99)Caldwell,Jo Bo 2)12 acres 104 meres 99-05 |Carpenter,W.P.,30)aeren 21.18 |¢ornetius,W.W.,60 acces ¥47 |Cornelius,C.ML,280 aeres 5.55)Douglas,Will,48 acres 10.12 |Qouglas,J.A.10 aeres 9.28)Fisher,J.8.176 weres17.46|Kennedy,A.L..110 acres31.80)Mitehell,J.M.,1 acre4.69)Mills,ROW.47 1-2)acres28.63 |Morrixon,R.B.,65 aeres 2.61)Morrison,Mrs.Emma,110 acres S10)|Mayes,FO OR,1t2 acres341)Mot,WB,82 neres 1.74)Mayhew,Wo A.163 1-2 acres 22.52 |MeDowell,J.B..27)acres 20.13)MeKnight &Freeze,135 were 18.17}Rozelle,Mra.L.L.. 12.46 |Southern Power Co.,43.00)Porrence,J.W.5nq}fempleton,COP29)Washam,Jot, 230)weres 30)acres aeres $-4 meres 10.50)Woods,KE.1-4 acres=6%Colored.10.38]Raity,Connie,3 acresDavidson,Q.Ho and sister,15 acres5.45)tuvidson,Lemuel,2 acres1.55)Graham,Walter,25 acres4.00)Hobbs,Cenith,acres‘5")tames,Perry,2 aeres968)Long,Henderson,estates 13 acres 4'14 sherritl,Andy,Yi acres12)Williams,Jo W..1-2 nere439!Young,Alexander,665 acie 3.641 Honeyeutt,Mrs.G.©.15 aeres 4.82 |White Delinquents.9)Ballard,J.1,28 acres 516)@rown,J W..50 acres 91 Cornetius,J.B., 331 Davidson,Bob,86)Gabriel,Mas.Ams sda estate,S68 acres S aeres u 156 were 1.43]Kennedy,D.EB.88 eres832)Kelly,Mre Etta,45 aces491Mills,J.A.extate,103 neres3241)Mooney,BR.D.,36 aeresLSS)Ppeetor,Wo C..38 acres!a Thompson,Miss Carrie,Z5acres 2.46) 1004 Raggarly,T.A.26 aeresSeeCeanfl,Arthur,10°acreseuter,Mes.MoJo,if weren116)Deneman,FOB,193 acres S681 vertdee,J.Wo 10 acres20tHnyeW.L..1 acre Knivht,SW.2 ON)Marder Shee make Bl2)ipann,KOOP.Rid Trivett,LW.8 es)freett,Wook, ow acres acres ‘s aeres B16)Wooten,F.OL,8%)meresColored. S29)carson,Matioda,100 aerem .... 44>|teele,Lonate,10 aeres : Rad White Delinquents. »49)ils &Crouch,73 acresSO)Haves,J.B.148)neren600)fuyner,JOS.45 acres25a2|Steelman,Hardin,70 aeres100-29)Smith,Jo HM,50)acres136|y 46.08)Summers,Peter,22 neres ans |Campbell,Emma,65 acres46wn. re |Brown,M E49 acres99761Brown,W.Lee,25 aeser .. 46 ‘4 Clark,©)b.,G4 weres,2 lots «65 |Cornelius,Cc.H,1 bot+es Gilleland,©.N,30 1-2 neresrozo|(etlletand,H.OS.3 lotshe,|Hlubbs,Mix.N.A.24 aeresraya|Hartline,CA,41 aeren,1 lot 28 Harthoe,©.A.,agent,23 acresiea|Hartwell,W.M1 bot 19.4 fusey,Stella,27 acres t (a |losey,Sallie,64 weren -Jowey,Mra &J.,66 acres o cnty |Demery Miss M.C.,18 acresue|teow Island Milla,35 acresgu|Ltpoard.J.Marion,61 acres ia Plot,B.C.0 bet 10 to Vlott,4:ME,1 lot gug |fore &H.,21)acres .Pope,MOG,3 1-2 aeres|Page,Ho M.,50 acres%.KR.evtate,1 bot estate,B4 acres |Robinsen, Robb,J.W Robb,Iva,63 acres tie |Bine,William L,58 aeves»,|Troutman,J.Claud,51 acres|Troutman,F.A.,1 bot|Troutman,Ho N.60 acres‘Troutman,R.L.110 acresWauvh,Mrs.S.BE,17 acres20G6|»|Hawn,J.©,1 botny|dobneon,J.O.,52 ,4=|Mavidkon,harles,10 acreswe i)|Houston.Lewis,|lot.”Remsowe,J.7 eeren Vanderburg,Peter,114_acresNewRope. Dishman,Mrs.Naney,74 acres 5 «i,|Millsaps,W.P.,20 aeres x1)MeDaniels,Henry,8 acres yo7 ,Milleage,.&2 acres 561)Privett,Mo F..343 aeres11.9)Rash,Miss Ruth,50 seres19.38 |Rupard,J.N.,213 acres 6.94 |Shaver,J.F.,07 beresvna|Sprinkle,J.EB.60 aeren13.66 |Speaks,RK.D.,170 weres iv 4g |Speaks,J.W.,9 neres462)Shoemaker,MoH,2600 acres v.99 |Williams,Bob,16 acres 26 acres’|Hiams,D.F.,:}7.29 iMiams,S.L.,67 aeres .116 White Delinquents.6.41)Shaver,Mra.dno.P.,98 aeres8.66 |Olin.116)Bowles,Mre Amanda,estate,4 acres46|Frazier,Mrs.M.C.,161 nerves6.92|Petmeter,A.L.,96 acres serene sere rene ene eheereeeee aeeeeeenee ereee +e t e ti i Branden, Graham,dobneon,J »RK.Pulbright, Guy,Myre oman, Stewart,Mthee|Berw16.16|Sherrill, Lend fete Mary,56 seres bo.ag |Clark trank,2 aeres ... 4.87 |Sibert i4 aeres 7.0%itgeville (inside). 28.96 |Alben.Walker,1 lot ..... 4.88)Atlbon,Wo Mt let...(89)Anderson,Frank,2 lots. Seavariy:,TV.A.8 Mle wicca.1.107)Bas,KR A,|lot Sis Ta9.96 }Berco,Mex C.K,1 lot...6.03|Brawicy,Ko V.,admr.,2 lotstHrawiey,RO OV.admr.,40.06?Bulicn,Wet,1 bet23.06)Carter,JQ.1 tot 2.8613.30 |Cashion 2.90|Clap:11.20 |28.48 |Cray11.89 |Collec 10. 3.31 16.12 Carter Bres.,4 botsMrs.F.A.,1 lotRE,|lotCline,RF,1 bot Sum Ho 1 latMrs.B.L.,1 lot 7Corsetius,WoL.and W.HE,1 botDanicis,€Bl oe <0.04)Tein J ob,1 let .)bet 25|Durhan,J.C.1 im 5.66|Bideon A:¢.-\etBlinn,WAL 4 botsBilict.Mes FO,1 bot.Evan.Wo A.1 botErvin,O BR,1 bot $21)Peiedman,Mrs,Lule 1 lot 9.60;Fry.J oS.estate,1 bot26.97)Pry EA,1 lot 3.42|Giboon,J.Ff ,estate,1 bot12.98|Gilbert.WoL,1 lot4.38 |Goterth,Floyd.1 bot6.79 Bartin,WOOL,2 lots3.91)Harbin,Jno FP.2 lots Harbin,Rood.1 deta]Harris AW.1 tot1.07 |Hurtness,Mrs Nora and Regina,|lot 34;Maree!t C.1 lot ant dachs,Mo L..1 bot Keulnaugh &Chattam,5 lote Beetle,|B.D dothjKimball,D.J.1 let v6)Levan,Elihue,1 lot zy|Links.WoW,1lotYiard,J.1,Sr.1 let4sMiuM.M.and S ©,|lotKus,Mise Lina,|lot ny heson,Wo J.,1 bet is 3 .WwW.W.,2 lot5)Mayberry,C.W..1 lotv4Minish,J.d.,1 lotaoMiller,W.W.,1 loteoMiller,W.F,1 lot18Miller,B.A.1 lotgqMills,Mrs.B.C,1 botx|Mills,W.P.,1 lotoyMorgam,Will,1 lotyyMoore,V.B.,1 letMoore,W.A.1 lot63Muose,Joe M.,1 lot ga Mott,Dro do J.5 botsowMott,Mrs,Ora M.,1 lot «»Morrison,J.C.,1 lotwyMurdock,Ro K.,7 lot»qo Murphy,2 V.,1 lotryMyers,Geo.He,ft bot “4Ty 5 oe at Piatt,J 1 tetKawhin,1 letKary,J.F lotsRows,Alex.,1 let aSalmons,Miss Magwie,1 lotsells,Jno,2 lotsSeasoma,J.M.,1 lot Shuping,Geo.Fo.1 let Somers,Mrs.Berhta,1 lot semers,W.Vi.estate,1 lot Sowers,dno,|lot Sowers,G.H.,1 lotSowers,Ro 1...and Bros.,2 Stradley,J.Floss,1 lot Starnes,J.B,2 steele,T.L.,1 lot lota Spann,Luther,1 letVharpe,L.E.,2 lotsThompson,P.H.,|lot Varner,Marvin,|lotTurner,Chas HL,3 lets Vurmer,Mre.Lula,1 letturner,GB.1 lotWasedn,J.C.1 lotWebb;W.E..2 lots White,G.G.,1 letWilkerson,J.W,1 botWood,Mrs.Harold,|lot~White Delinquents. Headford Knitting Mill,1 lotCompressPad&Saddle Co.,1 lotImperialPurnitureMf™Co,1 betStatesvilleGasLight&Fuet Co,1 bot |Colored.Adama,Henry,|lot Allivon,Ceamar,1 lotAllison,Emma,|lotMalley,Walter,1 lotHailey,Annie and Alfred,|lot Barnhart,Andy,1 lotBennett,G.W.,1 letCowan,Lela,1 lotCowan,Wesley,1 hotalten,Andy,|let.Nannie,1 lot eeles,Krider,|lot Falls,Lila,1 letFeimater,Melvin.|let Gray,dre.HL.1 botireen,Margaret,1 letHampton,James,|lotHolmes,Perey,1 lotHoward,Brama.1 lotHoward,Houston,|lot |, fohneon,dames,1 lot Kerr,Henrietta,1 lotKimbrough,Will,1 lot Pearson,Jennie,1 lotSherrill,dno.A.,4 lots Thomas,Ed,1 bot ; White,Joseph,|lot : +188 cere een eenee -r ER A S S S E S U e E Pe e r SP P . Pe . Sk e < : =S s 5 Se S e s e s i s e s r e s e oa r ee e eH eS pe o 18.44 aera ..... 6.05 A.3 Se.26 M.E.,7 aeren . 14.89 L.,60 meres ....: Troutman,H.B.and A.F.,200 acresTeuimas,Geo,12 1-2 aeres Watts,T.LL,1 bot ......Warren,W.O.,34 acercaWee,©.Ui,UDR ois cece cons.White,J.W.,extate,140 aeres . White,W.A.,1 lotWilliams,D.8,1 lot .......|Williams,Carrie,1-2 acre .Woodward,Roy W.,1 lot...York,LC,2 neresWhite ri j Alexander,M.C.,3 3-4 aeres .17.8y|Bowles,Annie,16 aeres .... 16 15|Boat.Mrs.D.R.,99 aeres«19 |Brawley,RB.V.,150 aeves.8.61 Brown,Jesse and Amnie,|lot14g|Brown,A.K,1lot .......24.42 |Brown,M.K.,30 acres-Brown,W.B..1 lot19a|Bradley,W.A.1 hotBrandon,L.6.1 bot~|Brandon,G.H., Lag Ca@bion,R L.,1 lot v2.46 |Cashion,Miss Louise,1 bot 4.27,Cash.J.M.,5 acresO71|Clarke,J.3.1 lot1.14 |Cook,EF.1 lot17.09)Cais,8.HE,1 lotdoy|Dobson,BE.D1 tot 34.71 |Bliasen,W.A.11 neres4.06 |Fortune,7 Gt hevoagFortune,T J.1 tetFrasier,T.N.,heirs,3 acres !Freeze,D.L.1 letGilbert,A.Lb.1 let Goodin,BE.D..i letGowiman,Mo,38 acres Grant,R.H.,»neres Warris,A.W.,1 lotMeath,A.E.1 lot|Mil,Mre.Bell,6 acres |Horton,Miss Bertha,1 lotHuey,J.EB.1 let |dohmsen,Lattie,1 letJohnson,Mo W.,1 lot Kirkpatrick.Geo,1 letKiutz,C.W.,1 bot Lackey,Mra.S.J..1 lotLawenby,Lillie,1 lotLyerly,A.O..1 lotLyerly,M.J.,1 botMills,J.BR,1 botMoone,W.A.,1 lot MeLain,W.EB.1 lot>|Pool,Lena,1 Pine Lumber Co.,2 acrea+|Shoemaker,T.W.,1 lot|Smith,Chas.3 acres»,Smith,Wo M,3 weresSummers,J.CL,2 weresTeagve,E 4 aeres,|Thomas,J acres ,Thomas,J.W.,1 bet Wayner,Mrs.L.E..33 accesStatesvillePlaster&Cement CoTomlin,No D..22 aeresByers,H.J.,2 lots Drumright,FOG.1 lotDrumright,Sallie,1 lot |Gant,W.B.,1 lotKennerly,BD.K.,1 botRows,Charlie,1 lot Sharpe,D.A.,2 lots Webb,W.B.1 lot‘Weston,E.L.,1 lot1.67 Weston,8.E.,1 lot 1 lot Alexander,D.S.,5 acres Allison,Solomon,1-2 |Allison,Nannie,1 let aw Allison,Henry,1 let Allison,Sallie,1 lot Allison,W.ML,1 lot rf Bennett,Mary,{i acres,Bennett,Wo Bd hotBrandon,Walter,14 acres Burton,Mary,1 lotKyers,Matte,1 lot:Caldwell,Thomas,1 lot|yz |Colbert,Wiley,1 lot Cowan,M.L.,1 bot |Walton,Andy,1 lotDickerson,W.D.,estat,Beeles,AL HL.1 lotFrmons,G.E.,1 lot Gaither,Alex.,3 acre Gibbs,Morgan,1)lot sua Grant,Guga,1 bot|Gray,Jim,21-2 acresHall,dno,10 acres Hampton,Lorenmaa,1 ojot ,Mart,T.LL.1 dotHart,Fronie,1-2 acreHart,Hattie,1 totHouser,C,WL,1 betHoward,W.A,2Houpe,DeliaHow acre « ss /acres ngs 155.84 Berens we tom W.A,1 botHunsucker,Hell,1 jot0bHugwina,dno.1 lot,Hagwins,Mantius,1 jotJohnson,Mandy,1 lotDeller,1 lotKilpatriek,Gee.1 lot'Kinw,Mary,1 lot|King,V.A.2 nerves>|Laekby.Lee,1 lot|Lackey,C..P,1 lot*.|Littl,Jno.Angus,to jotdno,1 lotVietor,2 a e ez-* Sr a n a r acres Bx 2 Se e s ae =x Fi a2 - " x 2= 3 we e r Sr e e er ee s ee g e r e e e s : i 5 -~ sa e r R se e r s . Ss e t e aS s z s = 25 ee e 22 oe Lee etOPeeRee Le tthe heee eens Peer eee) RAE tee PRP eee eee eee eennenee SeteReemenone oh Ek k k e k h e s _ Se n e r me me oe es t e -- 2.46et| d 3.06 vw d 66 One562.48ge|Tomlin,Hattle,|lot ..........4.0637a77.68 1.281.48 #16 3.64S11)1.229.98 1.686.94 aeT)1.886.69|Allison,Tom,tlot 6...eee 3.224.be|Bennett,HB,Lilet 2...eee .1.83 26.14 .1.2861|Howard,W.A.,1 lot 618 2.72)King,Bell,1 lot .ee euiivienecre 20 4.27 Turnerabarg.12g|Butler Heirs,2 1-2 neres 2.62 o sq)Bennett,W.A.,4 1-2 aeres 2.18 Cartner P.L.,2 aeres 9.162.04 Douxhit,M.L.,60 aeres 4.240 |Dillon,J.C.2 acre 12.681431|Danner,J.A.,1 neve 19.6929.99|Poster,Mrs.Katie,22 1-5 acres 1.98‘gg |Fowler,8.A.S11 °.4.04 11.7g|Green Bisters,65 1 3.884.77|Gaither,Ro OF.167 1-2 aeres 31.60 47),|Gaither,J.A.28 acres ..,..12.6619.48|Gaither,RB.5 aeres 11.397.94 Gaither,W.L.,69 aeres 12.40‘el reen,C.W.,38 acres 15.88"|Galliher,J.A.,78 eres wal96Granfield,A.F.,1-2 acre thia!Hayes,Hal.,,63“go|Holmes,dc,46.06 ”Hanes,‘T.V.."63¢i Harpe,Wo M.,358 acres 60.864bKeller,O.A.,100 acres 11.42aeMason,Roy,|acre 43gis?Mason,Mre.Btta,462 acres 60.292ya!Niehols,Rebevca,estate,211 acres ivan1.68 Pool,C.E.,#1 acres we110Strowd,N.B.,64 acres 14.24+Shaw,B.A.,23 1-2 acres 1.8661|Summers,J.W..57 acres 4.82379West,C.J.,46 acres 13.31478|Webb,J.W.,ly i acres 1.84 vat Campbell,Solomon,11 1-2 aeres 1.64 Lag Campbell,Jim,10 1-2 neres 3.92 a8 Foote,Orng,7 acres 4.58336Gaither,Laura,55 acres .869 6 dobnaon,Frank,31 acres 7.332Nichols,Diek,6 1-4 acres 2.87 i “Stimpson,.3 acres 8.62 él Turner,¢acres ,4.121a8TurnerB..16 acres 8.16=<‘Turner,.$2 acres 6.46 3.08 Turner,Stokes,15 seres TaaptsTurner,Sandy,5 1-2 neres 25seqburner.4.Frank,16 acres 1.92.Geny,Rachel,5 acres es 61)Dalton,Axburn,20 neres 174611)Dalton,Can,1 aere 783)Current,KR.S.,27 acres 8.83 pe a nion Grove.W214 Rennett,H.C.123 ae 14.89 6.49 Campbell WB,>6.085-48)Cam,1.MS 12 4.85 hind Fraley Heros.@ Holmes,1 acre 4.1122)Goodin,Mra.Catherine,7 1-2 acres 06 13.46)Hemrick,Mee.Sarah,20 actes 1.94YTHolmes,J.C),15 acres 5.0 61 Jurney,Mo J.164 1-2 acres 20.74 eed Morgan,Will,2 1-2 acres 2616.67)Multia,J Wo 88 acres 8.14602mulls.KON.74 eres 11.052440Privett,Mrs.Permetia,15 seres 6.162440Redmond,Rubert,64 acres 4.471.66 Robertson,J J,66 acces 4.96427|Snow,Wo ob #neren 16.73+56 Summers,No T..119 acres 13.409200Templeten,Mre.Mollie,71 acres 4.86O11)Pompleton,James M..10 acres 93.0%‘Templeton,J...81 acres 3.7661t,Nathan,119 acres 16.9661Trivett.Levi,38 4ai3 Frivett,8.AL,34 me 4.16 481)Yutterow,KO i..fh 145 Wolker,J.2,G0 aeres Ve 3.05 Williams,A.,heirs,54 1-2 acres 4.814.34 Wooten Heirs,98 neres 6.416 2.44 Vouk,Alfred,9 aeres i34York,Aaron,#0 aeres 2.64 RE-SALE OF LAND. NORTH CAROLINA IREDELL COUNTY.UNDER and by virtue of the order of theSupertorCourtofIredellcountyinthespe-cial proceeding therein pending entitled,‘J. P.)Williams,et ats.vs.Rufus Cass and Mrs.Nora Case,the undersigned comminsioner will on MONDAY,AUGUST 6,1917,at 12 o'clock,at the court house door ofIredellcounty,sell at public auction to thehighestbidderforeash,the following de-eerited tract of land:Lying and being inNewHopetownshipoftheaforesaidState and county,and bevinning at a pine stump, L..J.Williams’corner,thenee south 12)de- grees west 125 poles to a white onk,Fox'scorner;thenee south 2h degrees eat 14polestoastone,Fox's corner;thenee south661-2 devrees east 204 potes to a gam,Fox's and Shoemaker's corner,thenee north 13 1-2degrees40polestoachestnutoak,J.P.Williams corner:thence north 69 1-2 de-grees weet 62 poles to a hiekory,J.P.WH-Hams’corner;thence north 16 poles tostone,J.P.Williams’corner;thence south#S degrees east 72 poles @ a atonein Shoe-|maker's line;thence north 36 poles to a stonethencenorth86degreeswest124poplarstump,L.J Williams’cornernorth50degreeswest100polesto vinning,containing 141 seres,‘This will be a resale of theandraidre-cale was ordered py the courtthereasonthatanincreasedbid1.07|filet for anid lands.The bidding willp.F.MAYBERRY,3)at 27h.2 -}Commiasioner.44 atic 20.27-Aug.3 _ -NOTICE TO CREDITORS.| "aving §@ ifled ae administrator"Gt |catute of J.A.Maiden,Br..decenead,lateIredellcounty,North Carolina,is notify all persons havingestateofthesaiddeceased to ex|the undersigned at the home ofsignedonorbefor12o'clock, 191%,oF thie notice will betheirreeowery.All persons e2 e s e s e e =>nx 8 -2 2 P . s- o e —c a e me s s =2 BP P re a r g2 s 2 n s 2 2 2 * fustitutes inwre|whieh heran at Linweod andoolhousesWednesday,Au-oe ist,and will be conti at Harmony on the Tth and at the Ere- oom dell ‘Test Farm,ith Statesville,on a |.Beenuse of the seriousness of the the State. jham counisYouneofiyOfthatcounty to es 4.P. Mn alone,was found cead »She Countyconan “ t nameieidevitlereermter Mie—deceased,} Robt.Bame,aged 5,whoTuesday|morning im her’home in Spenedr.| was i Monday nieht ond wasattondedbyafriend.:Capt.W.B.Milner and aout Licuotenant Wi Richesscen,ofNetions!Guard company of ny ontle,failed to pass the merlieal ex. stion and were turned down. Vederal officers laoked into aPjfoodsituationthroughouttheeear-sat cag pomttryendtheavorld,food preduction chow .that =wanes oe re iamd conservation will he conphasined ae 'ah wand wel com aml four i ™int alt of the fnstitutess Most of the "ti =0 |rhewred in shape teArenottiedfromcarryingoutyourex-Glecmrstone will bear direct MM aie a inn of baume, pectations and desires when you have ment,live <iock,ete.At the Wo While clonning a =ie sonnes “money men's Ineiiiutes,which will be eam.{am tell of f ollett eve le,aweicidentwiththeFa.mers’Institutes.Inky,Tees ved.injuries that causedINTHEBANKthematteroffoodconservationwill|ath.He was in the well when°ahte ecme in for first eons "broke =<tub _=he while hovtehold economies,irawn from the well fe natYourBankAccountdependsonwhatldawvenionces,health and sities aie ‘.f vitel interes tt to mothers and Polk MeGhee,of the lawyousave,-:home-makers will not be newheeted.at the State University,ha i »Mr.T.B.Parker,director of in ho-en te succeed dadge Them .tt is not a matter -.is aca a record 4 loert on the a a a *breakite attendance at the tinetitute d with the codifying of North OF GOOD I OR-TUNE.e this vyeor,“Never hrs so much }cobra laws Mr Calvert was doing ::.pemiod upen the An-.cean farmer as \k under the direction of theAcquirethesavinghabitwhileyourin-dors today,”save,Be.Plier Isive code commission when he .i :¢i 4 .“Noi only the Uviied States gov appointed Superior Court judye.come is small and it will be easier 2s ernment but almost tne excite eWwil-"ri.Edececombe County Medical your income ncreascs to rand var Vs looking ‘tn farmers has vdopted a plan by whichYkAfofthis«untry for =7 _the doctors who stay at bein:— 80.io re aquired to wim tre gree er ial ec of the patients of the pay:,Increase Your Bank Account.eles gut tae cae Finkecareof the patient of the phy: .:thoursnas of helpless peeple from ice,turning ever to the dependNowistheopportunetimetoopenanteevation.It is not only the priv rat aks Geant A aeAccountwithus.lere Lut the duty of the farmers in ent,of all medical tecs ane! the counti which wri nave insti .of all surgical or ho t hic year to attend them,hear,Hected ror h paPeople’s Hean and Savings Bank.f 00 se ge She apid development of al!teenie bripche fo amreuiture Nort x,,,ical Congress —Dr.“MONEY MAKES THE WAY EASY.”Fee rine!pat tye na oo.’been d uta lurve measute,’to . GEO.HH.BROWN =President,&(I t ,*frostitute in 1968 34 thern Seetolevient!lonO.L.TURNER :Cashier.fis vere!h Id with am athena!his week a Rise Mul ‘t sundret rmers,dur “Mountain,tthe nad ! c gine fe p three or four years OO Gderegates tn the ab -oe ee ..mor than '“)institutes have been ch of Arkansas,th :*hyetet hb:trends nee of 70,000 o:lied te cracs by Dean Se anne ne nee —_=aaah anecaen ~—=~se omure farm and farm women,Havler Uaiverrit We 66 zl 99 },”who had a yy alive E EK Btomes the Enemy.acct iw.Kesler is re Dr.George Michaelis.the Germ eeenen uum areca ane atTa A I ™peril chaneellon on Saturday oe ote:i >.a 5 ;L Hills Drug Store,to cvery man one es ee noe _oi fdeatcrithe Jha on ot:’to whom +dec ared?'}Simole |I'he ah David Lev omasville, sanitary [f Geardc,Brith premier,at yd ai|liern's |at t ond tae recent mp Sharpe Hi debit he }ti ye o of Cas:oe meet ;Safety Razor.-jf mever aarain have Reds arse °’.+?al cle i wat Great ritgi'!he tdeal Army Razor.iis yes oy coneeae Sea EE ereG ‘The Fceonomical Home Razor.a teed et ae ee nes Wy He oehaa£6;clusion of the war ch means t ea ya :thPhe100percentEfficencyRazor.cechiumest of COuniny to ees Oe ce ae OncePheStrictlyGuaranteedRazor.bitrnry vietance|of our enemies.um — Come and get yours,uecie Kin,contention aad wan.1)©Tete.Pevetion,Stk 1 9q.’T >clude Clean Little Liver and saw- HALL S D R U G S OREK,The enemy press endeavors ‘a els!Phone No.20.fo ce upon me,inauirural spree Wh Cyclon ace thi “frit Prsaliv.interpretation that Po oonty cons:nite thes al the ne «-ieee ae re =Pn —to th Ma poriey resolution yee ah —-Be nh a ,ne iscamuaiasuaacauaiecsiiondoneeen =picetasoces ae oe mene amen j}-concealcd teservation of Ge mAs 4 14 aimpt 4 Gal na |.EN Seen:enema,ro conque 7!vm ab-te :‘ie —d i .fiaiedtodenytheimputationostohveaaae| .|object of which th ove ean be ne vi -hl a 1 en mt %boone Besides,the resolution ine We \'‘weItlsNotWhatYouMakeThatCountsaicttersitseeni::|enemy mast rise rencunce any ideas CF Ee are t tevin ot a #100}:;a s ne |Dr.Michaelis added that it wag S¥stea tut hey :bimanifert that Germanys enemieg,OMe en’or clarrheci.|’ e boeere not in the —lenst ot rlering a.;«:::mn 2 ' whoorenueeiation,and thet the.ren eS as Mrench meeting held on sceret was Mh Ns yy f ti tid i w h preef that’her enemies were ~'f othe constipated wa our recponsible for the prolenmation of File aod ood yt nt.|he war and were Saetuated by lust of MM you have a \New depositors,as well as our old ones,lof conquest.”plrswfiat chad agi re OME at this na ae eaaaearealwaysW.ie LC OME at this bank.Marriage Net Valid Bixcure,28,8¢r oni If you can’t start a BIG account,then _atlasty mipriages teat:doty jaystartalittheone,some of our laryest Cem fe ee eeaccount’,started ina very small way.inn Uhrowsh henry of p betths ar 4 pot t wh get wit!i ‘which bh:‘If you are not already a depositor in mye Hae eice anlers th >childees.'pe 'the }y yoy Isomebank,me in and let us tell you Vr.ile fehet.Prwabted 1 o a HsaboutourSAVINGSDEPARTMENT.Me from mpiuny ertie cof marrisce the genaine.nic Cre eo .ence bvredn hres ged by oy ’t Woo Corrpat fe 1 3 ot gtWepay|per cent interest on Savingy,ted the frat eet.Prowrt blnwith cemten’*.ar ha LOO E owder rifen fandcompounditfourtimesavear,“merriayre net of —itsel !Teen aso eee svround fo making clan for od DR.Vv ANE E HAST3 !harve.”DENTAL SURGEON Sernnilene a metter of fact,Rewerme 6-5-0 wd Kho { +.’not of jaw.Generrt ¢raw fer !FIRST NATION Ab.HA:;HUD HN t Merchants and Farmers Bank.ve E ‘im ‘os iy 1 ¥,PELEPHONE t S640)MENTS 'de venden ha)!eg r nt '"Phon ’mS ;n <support,”he rated,“may clain SrECIAt ATTENTION rm)CVU REOfStatesville,N.C.mmpsion on that ground.Ont rodemptionbeardseandeterm’Cisnensttesrstnarpnsineinocoserne stentsactostsunianntnpeneestonets “The Bank For Your Savings.”ach,Whine dey wee SS a ee wy cireum tance mow fon i hastily consummated sinee I } Every good citizen at this time should do his share toward strengthening the Federal Reserve Banking System whichourGovernmenthascreatedwithitsbilliondollarsofresourcestostandbackofitsmemberbanksandalltheirde-positors. You can contribute directly to thestrengthofthissystem,and at the sametimesecureits»eae by yous withus,since part everydollaryousitwithusgoesdirectlyintothenewsystem,where it is alwaysreadyforyouwhenwanted.This is a suggestionforpromptaction. Member Federal ReserveSystem. COMMERCIAL NATIONAL BANK. STATESVILLE,N.C. Send for Booklet,“How Does it Benefit Me?” PATRIOTISM *BUSINESS ioman whose number is hitheavailableIhthepetual loss of vast amounts of 9 perivhable fruits and vegetables,espe inl;24 States that have asked ¢ imental assistance and inf:a ononthesubjectof“How housewive may immediately start canning, serving,pickling,dvying and «tor: erTn- work ing. he advance organization has all been completed by a specia States in distress,will be conduct-od during the next three week- |The Southern Railway Company{hae offered a reward of $500 for the} ae vile,—con"le ard the de- icomittee working nationally anderthedirectionofretaryof\.gl culture Houston,and the most inte: sive campairn,especially in the 24) REWARD FOR TRAIN WRECKERS| sion ofa party or partic “|Doors,Windooeeswtthe8o——ne er Fioring Sting,“hosing "The Brady Prin ling Co Ss ; ependenc:’must he closely {5 'ized.Motcover,”Gen.Coowdet |Has taken over from lared,“woren bye marr '\: me eh ce a ae to “a ‘t ir Alli on the are linhble te prosecution under if age ney for Val Jot .|a’t act.”onhaateee|Magazines and Book | esice é *emen.ore Oe |Publicationsand wants |A memorable appenl from Pre nt |2 ; Wilsen to the women ef the 1 i}your orders for sul-whether living in city,tewn «'ee ee .try,has heen issued ‘through Si re-'{Scriptions “to Magsa-Se |zinesof all kinds.WillofThewomenareurgedto‘iimediatestepstoavoidathrea!cne|order any book wanted, 'All Magazines on coufn- |ter soon as out.{ ' *we came homer eeee Dr.S.W."ea Osteopathic Physician. Office hours 9 a.m.to 12.30 p,m.2.30 to 6 p,m.and by ap-‘|Pointmert.A won Bidg.,113W.BroadSt.Office ‘phone 324.i Eudiee>‘Ghene $0-orere, a et PO E ES WATKINS for ee ee ee .Hic KORY.N ‘'J recossful cehouls under oeinch management;rated by Bata oo ecperts omen the ten A-grade colleges of North Carolina, It uitiM for you te decile on a college before you have investi- uted (he velvet uffered hy Lenolr bes PY opesaretage of Keucation secures complete recognition for its Grad: tis Vee ie Boord of Mdueation.Vides Memorod Seionee Buildine offers superior Laboratory facil. tye roth dy af Chonnetry,Physies and Uivlovy, /t to tera Edueation,Business,Mnsie,Art,Expression,“a HW fre:Amar & tim within reach of al!the peeple. i ¢alorry th R.FRITZ,D.D.,Betaiisenkietal Hie—N.G en e INGERSOI DOWE,AR WATCH d War price sb 5.See me if you are in need 4 of any iid ofa Watch,[can supply that aneedzetocl,Hamilton,South Bend,4qWalthaNivin,New York Standard,a Pelnncc."H.Bb.WOOUWARD Jeweler,4eee——— THE ST ATESVILLE “NextPlanters’Wh,Statesville. 5 SOL ELIEme ¥ .ie OREEE P-aeouee arefed po Ae lbng Bapeandfreeoftrach;becausethey do nut clogor tract;because they mix well with other food relished by the cattle.And yet they cost y« Me per ton.Why cot cave the difference and get better roughage? Tosecure the hestresults andto developthe a eetwelvehoursbeforefeeding.Ntisan ©oeponnes<s Banmgll pees fle forthenext feedingthiscannotbedone,wet dove 0 anoe minutes.feed the hullsdry,use only Tlfos qoarhby balkonofold Book of Mixed Feeds Free Gives the right formu!»for everYcombination offeeds used in thehowinmuchtofeedformaintenance,for milk,for fattening,for work,Buckeye Hulls and gives directions for wing User properly.Send for your copy to neurest all.ber.k The Buckeye Cotton Oil Co.peo.x Milante Auguste Birmingham Cheriotic Greommoed feckoom Little Rock Macon Memphis Seine nga gn= 5 mpm rane?OE)a Any dfy you never know WHEN;4 tut youknow WHERE you can get prompt and E sure relief from the ills that summer brings.Fs Our PRESCRIPTION DEPARTMENT affords you exclusive attention and eminently efficiont rervice at ail times Leave your troubles “ON THE SQUARE"! POL K GRAY DRUG COQ, ORE “uy OHIO SOWIE OE ORI IE EE aSeemeeeenmowe8 2 rr eer meson ii f AN HAVE CONFORT AS WELL AS STYLE ed a a 6 |A a Hfere isa smart Corset that ap- peals to most women.[Tt gives a ovraceful contour line.he test is in the:wearing.Don’t take our word about tais,but CL slip into one of these charming Aedou.rn pr:we and see for yourself,je ine dividually fitted.[t's well worth the extra time necessary. £1.00 to $7.50, MRS.MARY ‘The Cash Store. Price SIMS. F (Co-Edueational * eae LENOIR COL LEGE REALTY &INVESTMENT COMPANY ae ciates the very liberal patronage of itsfriendsandpolicyholders,both NEW and OLD. Our office is an open one,and we invite all our customers and those who will become customerstousethesamewhentheysodesire,Asin thepast,we will strive to give the same HIGH GRADE SERVICKHthathaswonforthisCompanythegoodwill andconfidenceofoverseventeenhundredpatrons.“WE INSURE ANYTHING INSURABLE”and PAY ALLHONESTLOSSESINCASHWITHOUTDISCOUNT. We will be wlad to have you call’at our office—for any information,or telephone No,54 if our”service in needed. We do NOTARYPULICworkalso,J.F.CARLTON, a were pany,a8 2B wer arene that had been unfair When Titans was woes ,*to him in a difference with Mr.LC.cowrt house fn pockets as soon a8 7 W ithe The threats against Mil-after the funy Soa "Me :»in February of this year,dict,.crowe had et to .od |ty to see search was made leos than He er heard of any attempt of movvee ws anteot y to Wi Hams to carry out threats.’ 5Os fll or oe‘ane "=J.A.@vereash,J.P.Horton,Pink Williams is 68 years old,Very puilie Gilbert to appear in Siaterville Mert.C.L.©and L.€.Wilhelm ‘le of his history developed ts to answer a cha of enreying ‘ae all testified to having heard Williams ©evidence,He had lived in the Ay cealed weapons,They gave a bend ©make serious threats against Mil-section several years.He age, ’ ,’‘loy and other white people generally e of the witnesses that he had$25 each,Later they came to Sister °c.section.Among other things et a man in South Carolina we New Discovery!Dodson’s Liver Tone Acts Like Calomel But Doesn't=os °=was temportrily yy Overcash testified that Williams “mall eyes with snapping lide 8 vy the pase brothers agree jod said that he had been arrested his hair ia well down on his ian 9SeetsBecenlincatinnotteeacy.ited said cheat he had bege nevested Nef |ivate or Make You Sick—Don’t Lose a Day'sWork—Harmiess ons ywhich had been taken in cha 4;that in any further attempt to Williams was arrested,it will be by Officer Gilbert,this agreement be-arrest him he would cither kill the recaied,Sunday,July 1,the day af-Medicine for M Women Children—Read:ing reached in the office af Mr L.©.Gm@eer or be kitled by him.Williams ter the murder.He was lecated in a en,’! Caldwell,then mayor,who told th d the reputation of earrying his.piece of woods near Mooresville and Bhouses that he would report the fat in whenever and wherever he trav.ome of the posse hunting him shot be the solieiter for his action.Lat ed,for what purpose no one knew,i™with small shot.The wound &Shouse brothers started a sui 3 Wilhelm had had trouble with Wil oon healed For fear of mob vie-ee c 1 el k 'SY ‘ble!P ! ‘orsyth Superior Court aati:‘aure the latter would not tence he was not ullowed to remain rn aiomel makes you sick.I iorrible!|right up and feel fine igorous stable Gilbert for damages for false ouchey com when he want him to.n Iredell jail,but was taken to Wine 27]a ies of the ieseows chs ng tonight and wank ll to ke he oe :a : arrest,Thi i dive.T ~hed a fieht over it.Williams ston-Salem,where he rr mained until srow ¥O eee y &-§and — Shouses have alco pee div his gun along at the time put he was brought to Statesville Tues-you may lose a day’:work,.‘money.De xison's Liver Tone is destroyi the fore United States commu r held while the fight was in ‘toy morning for trial mivm i mereury or quicksilver which causes|sale of calomel because it is real liver medicine; rie Salis sn Williams |later claim ;UND NOT ARRANGED.!f ihe bones,Calomel,when it comes in-|entirely vegetable.therefore it can not.salivate or by Deputy Co wi not Miller taken his wun away 1h ee tact with sour bile crashes into tt,breakin —you sick, ae ;.;moat Fort Smith,Ark.,j Vhis is wheu vou fee \fal ‘ywaarmithatth;vn fit Ih resenter ,ek ’‘The —ts WReu vou i iit nau vufrantee that one spoonful of Dodson's Liver Rog bed 9 sun ae le 0 \;and cad ping.Ir you a lugpish a a tea will put your sluggish liver to work and they damped just |e they we 'put,you ‘ry eh VOWS clean your bowels of that sour bile and constipated Dated by Dep 'lor You have te !aut aste which is clogging your system and making bo hi arty the ser thre r iW 7 .a _is ba Lor s!Poor,|ir you feel miserable,1 guarantee that a bottle of has heen tried.Ti ers itt m of Rarmibess [hw Het Chu!witht.|Dodson’s Liver Tone will keep your entire family contested and th :nm —(io te any drup store |fecling fine for months.Give it to your children, ed throurgheut.Wh \‘en he iW im y a SO cem bore of Dod :iver Tone.|it is harmless;doesn’t gri y like i aoe had kill lich bel *8al :.:Roms biver Tone,is Lara loesn't gripe and they like its pleas- quilt on the conceal a)ay ee a “Ob!But |Feel Good,”«spoonful and af it duesn't straighten you |ant taste ?é _aaa inimed they agreed (0 tit he had taken Miller’pistol w.Savs Miss Anna Rau, standing that that -«i tle at bh iM :Ptied him.becatse he wa “Since |Beg:t ~~°°aBe,wie tie ma cep use ironed”Buying Good Furniture Is LeKe Putting Seu In Thee Bank Mr.8.J.Bennett 0 fons eee rat aw-Paw.=— a fem appea ith \H P f ;‘t the de reise nts and Mr.'Vhs {i otere LIFE WAS A MISERY. well assisted Solicit emi i ’cane,aie es |es Prosecution,:a ne pant|rood i tas ce ‘en WwW pa year The Soldiers to Be Guests.Lomi tre oS ‘tronized Plans sare maturings for yp 1}::ye sie we \ota Rew,re- local military comprny an ey Teen SA uy tt)Se 1 !enue, of hearty enterta rent Ss be ::i iu ,'elie had the The affair will be +-:eee :‘Ant :and sleep- Plaee—-the lown in the rear «i.‘,HOC renen -Post 1 owith nervous court house.The wie 'a hea he »pleasure to-do county is urged to lronized diers ard their k,to my er,sister or sw nd the ;i rornings eal band will he served reshmert ;ys “part ft recovered my a regular pieni S :t ‘¥.}night cream and lemo i ''i “di will vive a con {r weekly ce ;:'ya \nervous hb nC !lizzy cert being chan;dny Ca 7”A en ‘tomach night to Saturda’nigh ‘$FOR »4 Presalts 1 ‘it pny.dis- Walter Morphy oof Sihsbury a hates at a breeze fort whateces convinced Cameron Mi isen of {}{Jie ’’ve ear t t romzed }v4 }wer been invited to be present and and they are expected. The eentral committee it of the entertainment 3-composed f Mavor |..B.Bristol,Mess:ce MeFlwee,A.D W ‘ Gilmer,M H.P Po Leng.and M Gil ner i ch y entertainment f held in the He saa ae if the weuther *The follow ne named are KEM n ¢ic rs !.wil aN ”'T'1 ..j .,.. ay tl Misses Elizaneth and Mar:foany kind.Ther i ee an ae Theift is a splendid virtue,but the young coup!e who start housekeeping with Good garet Brawley.Mre Henry.Lewis,1 00 tens |owen Ot ol ee har tt onixe Furniture hice something as important as a savings bank account. v Cs im elle Sar nprer y*es .e a Ne Phe rivh dof furniture will pay you big divide ‘nds all your life-time —con- a Marion Moore,Virirtr SI ;7 n ie i |t tderrre we ::probe tie keep 'ontment,co!fort.rest and pridlean your home—the k ind of dividends that are vital aed Maree Slobn, Rbsaheth |ee cy aE ee te nae ca to your health,success and happiness,a meres See a ee rovc-Paw,pries 81.Weare show yy acmactive line of Bedroom Suits in Ivory,Mahogany and Sherrill,Aileon Terry tetany edler trials in .Amoriean Wabrit i Katherine Amu American Vai erine Pres-ly,New ‘Yor! Kather':KotBim ee Re aa ried Flooring,Crawford-Bunch Furniture Co. and Melissa Warlich yoM ‘‘a oye ° Union Services —News of the ie (ening,Base,Case and ‘the Store That Always Welcomes You.” Churches,8 ee As 1,Union serice oF the fier sul er He ety eek in Youlding, *side chorebellinPreset:Men !!:C.WATKINS. Reformed ‘day evering at *0"!oe Barium Springs Water.es eee Send:morning \;:i Tuesday’Lande sot :Vv e whe drug f 1S }SP the ch ::a ee ’mt Wikism,hic "Prone W POLK GE6. Wh vS In Bottles %¢. Has stéod the test «f time. ES TL CS A a Sc ‘ry Inspection Free rip THIS AS SPALTESVILLE MOTOR CO AAONE Oe A A PLUMBING.- js your plumbing vierht?Are 3 Ving that bat! Isso Invigoritu 7 Ci i not see me. aie ¢4 . Btater n noe tt Some Pumps on hand. ory > opened Ts !||W.E.MUNDAY.ier =OO ee a Nees"Ky rescen t T h ca tr eothe:'a wee give STATESVILLE,N.C.|CHEERWINE i new |In Bottles and at Foun,|-===TWO DAYSfegurvived|hy childrer Mew,Fyby,Mr.D.8.Hen ,Mike Candace Wer wkel of Mickor ©¥.Menkel of St.’ Rtntecville peopl ’“al were Mr |]We | ||ate .Mr.©.V.Bente!a My fs \| i “! x Keen es]tla,Se.Thos.H.Ince’s Million Dollar Spectacle Civilization must he vered PINE SHINGLES! 4 Genie.Mr.Wi oh ,Ge -ce ey Rep CED a eae =Wednesday and Thussday,August 8th and 9th. i My tT!Q Ye ‘»>Oa?|wr eo Nails,Ridge Roll;Valley Tin,Brown mention ¢Independent “Phone 406,Ret |i Green Shingle Strain ..i ji .damare ‘Phone 9302 WATKINS,Shingle King of Ive-“;of toentinued rains tell County..a > oe of the way.examination beforetheexemptionboardthisweekisfor375-50 yesterday,50 today,75 to- morrow,100 Thursday and 100 Friday.This makes a total of 525 calledvawhichtogetlIredell’s quota of for Of the 50 summuned for yester-day 40 appeared,ten of whom failed to pass physical examination —Eu-gene Turner,Will Blackwelder, dames Leroy Fortner,Arthur Mor-rison Steele,Hiram Walters Sher-rill,Melvin Lawrence Tucker,Lem-uel Cowan Hoover,Augustus Me-Lelland Neil,John Stevenson and.Witiiam Dumas.who passed the physicalexaminationwereDeWitteSimon-ton,Frank Lone,Coot Little,Wil-liam Pinkney Harris,James RowanaEspyCaldwellMaleom, William Hudspeth,ReeceMorrisMavherry,Wade Mitchell Shu,J.Victor Woodward,ClydeWalterSharpe,Alonzo Lee Poole,Lieyd Bowles Rimmer,John Dooley Baggarley,Osear Samuel Gunnel!, Robert Lee Yorke,Raymond LittleMaiden,Hil¥ard Iandora Byers,Walter Martin,Arch Weaver,James lambert,Luther Lipnard, Hersche!Harrison Rash,PavilNathanElmore,Ralph Reece MeNeeIv,Lonnie P.Myers,Latta ClaudCombs,David Camppeil CowanDanielLemuelWarren,Rufus Frank-lin Byers,Eli Wileox,Henry Teve- paurh, ‘The following named failed to ap- pear vesterday:Mason Wiley John- son,Melvin Roscoe Sherrill,John Maston Brown,Herman Moore Pat terson,Fayette Ramsey,James A Honeyeutt,Ford E.Beaver,Alan R Anderson,Fergus G.Stevenson andRalphG.Gaither.The last four named will take examination else- where. Of the 50 men called for examina-tion Friday under the selective draft 42 appeared,six of whom failed to pass Wilson Henry _Isenhour,John Washington Shaw,Little Ar-thur Anderson,Wi'liam P. Black-welder,Robert Tate Setzer and Lon- nie Gwynn Johnson.The 36 who pnssed are:Sanford Baity,James Franklin Hunt,Vester McDowell,Elmer Wendell Dean, Vanee Hasty,Edward Grier Wauch, Joseph Butler Woodsides,Troy Lee Sherrill,Moses Arthur Beaver,Jona Harris.Georre Norman Sloan,Wil- liam Alexander Claywell,William Price,Carey Olian Caldwell,TrovGarlandShoemaker,Joseph Felix Goodman,William Humphrey John son,Lloyd LaFayette Deaton,Doctor Isaiah Rosebro,Benjamin FranklinWellman,Sandy Palton,John Ben-nett Patterson,Raymond Thomas, John Robert Malone,Fred.Albert Lazenby,Charles Anderson Morri- son,Thomas Batson Austin,JunieLeeYoung,Fred.Hyams Deaton, Dave Gregory,Rockwell Ingram,John Reid Winecoff,Henry LesterMoore,William James Morean,Ear-ly.Grady Mason.Fielding Chambers Those who failed to appear Friday were James Daley Moore,DeWitte Simonton,Ralph Hedrick,LackeyMyers,Jas.Fred.McNeely and Wal- ter Martin.No reavon assigned for their absence.The examinations are being madebyDrs.Ross McElwee and W.1D Gilmore;Loeke Simons,dentist;J C.Dve,ear,nose and tyroat.Mr.1D M.Etheridce weighs them and Mr Jno.W.Guy,Jr.,fills the cards, Case of Larceny —News Alexander. Special Correspondence of The Landmark. Taylorsville,Aug.6 Floyd Canter,a white man of Sugar Loaf township.charyved with larceny, was tried bhefere Magistrate B.B. Kerley and on default of bond wasbrourhtteTaylorsvilleandplaced in jail,Saturday afternoon.The evi dence was that Canter entered Jo Jenkins’house and stole a worthleswatch,a knife and a poc!ethook with shout 75 cents in it.The Farmers’Institute will be held here Wednesday,Sth.The school committeemen are requested to be here on that day and the teach- ers who are attending the teachers’ institute will serve dinner to them on the school mround.«. On account of delay in wetting out the notices,the first examination for the draft will e held Vy cdnesday in- stead of Tuesday. Dr.Alexander Didn't Say It. Charlotte News,6th. Dr.H.Q.Alexander today made formal denial of remarks attributed to him in his Salisbury speech of July 29,as a result of which it was said in a Washington dispatch that the Department of Justice had tak- en the matter up for investigation of and that strenuous action might be the allegeci remarks were CAN'T TOLERATE TREASON Gov.Bickett’s Wa to!These Who wend InesietDraftDisaffectioncainein Chatham and Union Coun- ties. Frank Burns,a Chatham =county ‘armer,was arrested by Federal of- ficers Saturday,charged with incit- ing an anti -draft uprising near Goldston,Chatham county,by heading a movement to raise funds to be forwarded to Thomas E.Wat- von of Georgia to test the draft act. Burns was taken before a United States comrrissioner at Sanford and gave $5,000 bond to appear for a hearing at Jonesboro Thursday.There is a ;vod deal of opposition tothedraftinsectionsofChatham.os.Bynum,a leading citizen andmerchantofGoldston,is quoted assayingthemajoritysentimentinhis‘ommunity opposes the draft andherearemanyuglyremarks,somefthemdeclaringthey“will die be-fore being taken.”It is expectedhatotherarrestswillfollow.1Ov.t’s Warning.So threatening is the situation insomesectionsofChainamthatSher-ff Lane of that county and SolicitorW.D.Siler,who lives in Chatham,advised Gov.Biekett of the condi-‘ions.In reply Gov.Sickett said: “Your jeint letter of August 2 re-‘eived and carefully considered,In 't you say: “Certain parties in this county are reported te be soliciting funds frommendPafted,using the argumentthatthedraitlawisuncenstitution- tl and pronosing te employ counse!to test it,ete.,and are using lan- ruage that is calculated to arouse the iynorant against the government. Hach day we hear of this going on in different sections,and greatly fear that we are going to have a se- rious situation in evrtain sections inless something can ve cene to stop it.In one township we learn that an effort is being made to prevent any man whose name has been drawnamongthetirsttobeexaminedto ippear and various other things are being done that may give us trouble.’“In reply I beg to aevise that theirstarticleandtheerthsectionof the constitution of the United States clothes the Congress with power ‘to declare war,to raise and support ar-mies and to make all laws whichshallbenecessaryandproperfor carrying into execution the forego- ing powers.’ “In strict conformity to the con- stitutional powers so conferred,Con- gress has,with practical unanimity, jeclared that a state of war existe between the United States and the imperial German government,and has enacted the selective draft law for the purpose of raising an army to carry on the war so declared. “The nation is,therefore,lawfully it war.Through its sccredited rep- resentatives it has declared its wil! ind fixed its course.There was a time for difference and debate.That time has now expired.We are in a leath -grapple with the enemy,andthemanwhointhisperiloushour lifts voice er hand to weaken the nation’s will or shorten its arm is a traitor to his country ang a friend o its foes.He is more than a trait- or.Hie is a murderer.Any word spoken,any deed done,to hinder the Vigorous presecution of the war, means a prolongation of the war and this means added loss «of life. “The men who for love of money are promising to show registrants 1 way of escape from their duty havesoundeddenthsofinfamyheretofore unknown,Send me their names andpromisethattheysnat!be foreverpiloriedinapeople's contempt. “The constitution defines treason against the United Stares ro be ‘yiv- mg aid and comfort to their ene- mies.’Every discordant rote is comfort to the Kaiser.Every at-tempt to prevent the nation frem oresenting &solid front is strength to his arm. “I do net propose to tolerate treas- on in North Carolina’by word or feed,if there be power in State or Federal law to prevent it.You andallsheriffsandsolicitorsinthe State are directed to report by wire to the United States district attorneyandtothisofficeanymanwho, by word or deed,gives aid and com- fort to the enemy by seeking to pal- sy the nation's arm as it is raised testrike.Immediate and drastic ac-tion will be taken upon every reportundmenwhothusdeserttheircoun-ry in its hour of peril will be made‘uo feel the strong arm of the law.” Disaffect in Union.An attempt to hoid a meeting atMonroeSaturday,:n opposition to the draft act,failed.The meeting was called by certain citizens of the county and when the effort to have it ‘alled off failed citizens of Monroeattendedforthepurposeofreplying to attacks on the draft acte No actionwastakenbythepromotersofthemeeting.Mr.J.J.Parker,aMonroeattorney,late Republicanrandidateforongress,made anaddress,in which he urged all citi-zens to stand by the President andthegovernmentinthiscrisis.He also warned those who thought the raft act unconstitutional that they que were =fey It is “believed_7 ers talk will do much in andi STATESVILLE,N.C.,TUESDAY,AUGUST 7,1917. oe ——IREDELL FARMERS LOYALTheyStandiytheGovern- ment —Resolution “Resolved,by the farmers of Ire- dell county,assembled at theiralpienieontheStateFarmdayofAugust,1917,oHherebypledgeourallegiancetosauseoftheUnitedStatesandheralliesagainsttheCentralpowersofEurope,and earnestly support ourercosuasentiadministomaketheworldfreefor. by destroying and blotting from thefaceoftheearthimperialismandPrussianmilitarism,and giving toallpeoplesandnations,both sma’and great,freedom from war and an verlasting peace.”That was the resolution unani-mously adopted at the Farmers’Un-‘on at their annual pienic at the Ire-dell Test Farm Saturday.It was of-fered by Mr.I.N.Paine,seeofthecountyFarmers’Union,was adopted by a rising vote.iletherewasnoreferencetoDr.H.Q.Alexander,State president of”.theFarmers’Union,who is charged with ypposing the war and criticising thefraftactinpublicaddresses,the charwes against Dr.«texander werehereasonfortheresolution.Thefarmers=man ~ae world ‘o know that they are loyal in sw vort of the government in this “ae war,and that they have no sympa-hy with utterances calculated to weaken her forees .Dr.Poe's Address.Dr.Clarence Poe,editor of theProgressiveFarmer,was wie prinei-nal speaker at the picnic,His sub- iect was the things that make ferheenrichmentoffarmlifeinNorthCarelina.Farming,said Dr.Poe. brings into play all the useful andhelpfulqualitiesfoundinallotherwisiness,professionar or industrialceupations.It requires the exer- ‘ise of the muscles,business capac-ty and professional or scientific knowledge.He is only one-third afarmerwhosimplyexerciseshismuscle.We need 100 per cent.farm-“ra for the proper devel ent ofNorthCarolina.One who farmssimplyasanoccupation,an indus-ry,and neglects the business end— vuying and selling—or the scientif-ic end,the research falls far shortasafarmer.If we are to develop aricherandmorefruitfulcivitleetien,all the lines of farming must beveloped. First,we must have better educa- tion for the rural sections.For 20 vears that fact has been emphasiz- sd and we have made #e-c progress, but we are not up with the tail oftheprocession.Not only do we need a greater quantity but a better uality of education.ye must have an educated citizenship before we ‘an realize on our opportunities.In so-called heathen Japan.where we send missionaries,they have 10 months’rural school term =and theenrollmentis98percent.Under ‘ompulsory education we have a 5- months’term and until very recentlywethoughtsomuchofpersonal|it- rty that we refused compulsion at all,and have it now only in a limited VAN.We must nave a better quality of scducation and a quality suited to ural conditions,The arithmetics, he speeches and other books forme: !vy used in schools had little or noth ng coneerning farm life problems All their teaching was calculated tojeadoneawayfromthefarm.The farmer who heard a speaker’talk ibout protein and =asxed where he ‘ould get some of the seed,was ex- cusable beeause his schools hadn't tauvht him the things he ==should knew.The disgrace was ours |« ause we tolerated the system.We nust quit thinking of farm work 4a drudgery.It could be gloried by a:education that taught us to know ani appreciate.Our schools are now urning out better work —teaching he boys ayvriculture and the virlsjomesticscience—but we must make more progress and we must! villing to pay for it.We must way from the penny wise and pow ‘oolish policy and be tiling to pas nore for better schools, The community spirit must be cloped instead of the individual-t pirit.We have rural districts | rot real communities —commu: ies with commen hopes,aspirat:o: and feelings.In every rural neiv! vorhoed and the local unions hould lead the way —there shou! »~co-operation in producing. vutting products in better shape market,in buying and selling.‘ yperation in buying fertilizer is sin tly a beginning.Co-operative store ire not necessary,sometimes not k« sirable,but groups should comordersandgetbetterterms,which hey can often get from local dea! rs.You can't farm =economical! vithout improved =machinerynlyafewfarmerscanafford inprovedmachineryasindivydua! tut groups can combine and =buy ind use the machineyy,to the benefitvfall.There should be co-operatior in farm work,by joining teams,« yperative cotton gins,oil =millsriainmills,creameries,ete,Don't et up one where there is no busin ‘or it,te run out of business,to the hurt of both.But wher: such an industry is needed,the coyperativeplanisdesirable.Theideaistobenefitnetthestockhol!ers alone,but all the patrons shouldbea,&the a.The ad- vantage of co-operat in sellingcottonandotherproductsinquantitieswasemphasized,as was co-ope’ation in financial matters throughruralcreditunioneandfarm lonnrssociations, Hj sons,or for some one else in respect aTREATEDASThoseWhoFallto Answer With reference to the reports thatindividualsandgroupsinsomesec- tions of the country were taking stepstoresistthedraftlaw,Gen.Crow-der,provost marshal,issued the iollowing statement:“There is nothing to resist at thisstageintheexecutionofthelaw.All male persons between the ages of 21 and 30,inelusive,have been enrolledformilitaryservice.A_preliminarycallhasgoneforthtosomesuchper-sons but the immediate and actualobjectofthscallismerelytopro-vide an opportunity for such per- of them,to present to the govern-ment reasons why they should notbefinallyordetoreportformili- tary duty.Deserters If ‘They Fail.“If such persons do not appear andpresentthesereasons,they have sim- ply neglected to take advantage of an opportunity that was offered solelyfortheirbenefit.The failure of per-sons to take advantage of this oppor- tunity does not interfere with the raisingofthearmyand=interests the government only as punishable crimefomission.If they do not desire te make any such claims or,if for any other reason,they fail to appear their names are automatically postedashavingbeencalledandnotex- empted or discharged.Automatically also they are inducted into the milita- ry service and made subject to mili- tary law.Failure to appear merelyhastensthisautomaticprocess. “When the time allowed for mak- ing these claims has elapsed,these persons will be enrolled as in the mil-itary service.They will then be er-dered to appear as soldiers.Fromthispointon,they will be under theswiftandsummaryprocedureofcourtmartial.Failure to report for mili-tary duty when ordered to do so con- stitutes desertion.Desertion in time of war is a eapital offense.Desert-ers may be apprehended by |eithercivilormilitaryauthority.After the mandate of the Federal government hans gone forth,the whole strength of the military arm of the government isavailabletoapprehenddeserters,if it is necessary to use such force. Demonstrations Ate Futile.“Demonstrations against local hoards are simply futile strokes in theair.All the records necessary to holdsuchpersonsarealreadyonfileat State headquarters and at the nationa! capital and since local boards have no eecasion to use any force in simplyofferingabeneficialopportunityte registered persons,there is no field for resistance.If resistance is attempt- ed later when the army seeks to ap- prehend deserters,it will instantly encounter troops of the Federal gov- ernment.” In practice,under General Crowder's construction of the law,registered men who do not appeer for examina- tion will be posted to the district boards as selected for military service as soon as the 5-day period allowed them to put in an appearance after they have been summoned,has elaps ed.Two days more will clapse after their names reach the cistrict board te await appeal action by the individual They will then be posted to the adju- tant general of the State as selected to fill the quotas of their district. Publicity. General Crowder also took action to reduce the number of applicationsforexemptionwhichnewsreports indicate are being filed.In a telegram to all Governors he directed that lo cal boards be instructed to furnsh to newspapers,from day to day,name of all registered mer who apply for exemption,the ground nsserted te support such claims and the action taken by the board.In cases of dis charge for physical disqualificationsthisdoesnotapply All this tends to a richer social and intellectual community life,a richerruralcivilization.Every rural com-munity should be a little republic. Our country ix going to war against a=military-mad country While the German dynasty continues there can be no peace America goes forth to fight for the rivht-of democracy the rights of the common man. Through service te our communi- ies,we can serve North Carolina and the nation.“Great,and there is no other =greatness,"says Carlyle, ‘than to make some nook of God's ‘reation a little better,and —fairer ind more fruitful for your having lived in it.”There should be rivalry as to the best communities and best neighborhoods rivalry that will promote interest in community bet- terment. Mr.Poe spoke fer an hour and was heard with close interes Ile made a capital speech and one of timely interest.Messrs.Turner and i:° After dinner Hon.W.D.urner spoke on the relations of the farmer to the war.The dependence of thegovernmentonthefarmerandop vertunity and obligation of the farmer to serve the nation in this time of war,were discussed,along with the progress in farming.Mr. Turner made a fine talk and one that pleased his hearers.Mr.E.8.Mifl- saps,district demons:ration arent,followed Mr.Turner with a talk =onsimilarlines,urging tMmerease in fooderopsandbetterfarming. pienic,At the the groves,the public having been abandoned.Amentstandprovidedbytheservedicecreamanddrinks \ A good crowd was present at thenoonreeensthelunchWassprendforfamiliesorgroupsin @nner featurerefresh-oa DISTRICT BOARDS MEET. ,yy EA,-,Boards to Formulate ae =5 oe li .a‘hairman of the military ¢hoard of the western district,attend.|ed a meeting in Raleigh Saturday ofmembersoftheboardsoftheeasternandwesterndistricts.The purpose of policy in handling appeals from localboaandinrulingonoccupationalexemptions. ure of the conference,”says the.NewsandObserver's report,“was the evi-dent disposition to allow exemptionsenlyincaseofrealneocessiiy,”Gov.Bickett attended the meeting of theboards.He “held strongly to the idea that exemptions of farmers should be allowed when the interest of agricul- ture and production necessitated it,but that exemption should not be al- lowed to a man merely because hehappenedtoliveonafarm.In any case the necessity of his presence onthefarmshouldbecloselyserutinizedTheboardsopeneywereaboutsolidontheprinciplethatexemp-tions allowed to agricultuvists on gen-eral terms would necessitate the draw-ing of North Carolina’s quota fromthe20percentpopulation.The farm-ers must do their full share of fight- ing as well as farming,the boards be- lieve.”The boards decided to hold another meeting after exemption claims havebeenfiled,and then with the actualfactsbeforethemcometosomeagree-ment regarding policy.A number of requests were formu-lated for submission to Provost Mar-shal General Crowder.The hoardswant20typists,at a rate of pay notexceeding$2.50 per day,to complete the work of indexing duplicate regis- tration cards;an expert secretary foreachboardatasalaryofnotmorethan$1,800 per year;a steforeachboardatnotexceeding $1,200peryear.The boards also want toknowifadefinitepartofasoldier'swagescanbearbitrarilydivertedto the support of his .If suchaprovisionisinexistenceorcanbeapplied,it would facilitate decisionsinexemptionclaimsonaccountofdependents.The boards fear if thematterislefttothesoldiersthede-pendents would not always get ashareoftheirwagesandtheythinkthelawshouldprovidethatacertainpercentageshallberetainedforde- pendents. The following judgments weresignedFridaybyJudgeCline,afterwhichcourtadjournedfortheterm:W.W.Rankin Co.vs.W .A.Moore;plaintiff recovers $107.45 a Railway Co.;non-suit. ion Telegraph Co.;plaintiff recover-ed $100 and costs of action,lesswitnessfeesofanywitnessforplaintiff.R.A.Cooper,et als.,vs.BerthaCooper,et als.;McLaughlin, commissioner,isriectedtopurchase from the WallaceBros.’Company a storehouse and lot on Meeting street,(formerty occu- 750,to be paid for from trust fundsnowinhishandsarisingfromsale of Asheville property.After thepurchaseheistoconveysametoR.A.Cooper,subject to same condi- tions and contingencies which were—to the property in Ashe- Ville,Beatrice Toner vs.P.L.Toner,ac- tion for divoree;divorce granted andmerTonerawardedcustodyof child. No Scruples Against CapitalPunishment. Preliminary to passing the —sen-tence of death on Charlie Williams,Thursday afternoon,Judge Cline saidhewasstruckwiththestandardof citizenship manifested by the special venire called to try Williams.With-out a single exception none had con- scientious or religious seruplesigainsttheimpositionofthedeath sentence where the evidence war- ranted.Even a minister who was in the number called had none.We may differ as to capital punishment,he ‘ontinued.Some think it might bebettertoabolishitbutourLegisla- ture has not seen fit to do se.SomeoftheStatesthathaveabolishedithavere-established it.We have noscruplesagainsttheadministration of the law in its high integrity.Ev- ‘vy murder is an assault upon the law.This is partiewrarly true in this case,where the one killed was arepresentativeofthelaw. Commissioners in Session. The county commissioners and coun ty board of education were in regular monthly session yesterday,passingprincipallyroutinebusiness.Thecommissionersre-elected W.C.Perry superintendent of the County Hpme for another year at same snlcry. County Agent G.B.Dull was grant ed $10 a month increase in salary making the portion of his salary paid by the county 860 per month.The board unanimously passed an order for the issuonce of 840,000bridgebondsasprovidedbythelast Legislature,same to be used in con struetion of bridges across the river Aleo to iss.e $29,000 bonds remain ing of a previous issue. CHINA DECLARES WAR?A dispatch from Pekin,China,saysthatactingPresidentFengKwoChanglastweekedtheuwnani-mous decision at a specialmeetingoftheChinesecabinet,todeclarewaronGermanyandAvatrin- “The outstanding feat-|i C.L.Dagenhardt vs.Western Un-|. authorized and di-|$ nied by Mint Cola Company)for $3,-|Blue the meeting was to adopt a uniform]clerk-carrier Civil Cases—Court Adjourned.|the interest from September 12,1916,and costs of action.Henry Morrison vs.Southern!4), company will go to routine of training.Capt.Westmoreland husorderstoreceivenomorerecruits,Heunderstandsthatthecompanyistoberecruitedto250.Whether re-eruits will come from the — army in the process of making orrecruitstobetakenbytheregulararmyismerelyamatterofconject-ure.Capt.Westmoreiand has noth- ing official on the matter.Jas.D.Morrison of Detroit,Mich.,has reported for duty with his com-pany,the Iredell Blues. DOCTORS NOT SLACKERS, Dr.F.A.Carpenter observes thatthephysiciansofNorthCarolinaare not slackers.As a professionurerespondingtothecall.There are148,000 doctors in the United States,he points out.An army of 2,000,000 would require 20,000aboutoneofeveryseven doctorstheUnitedStates.Of the 1,7001,800 doctors in North Carolinahavealreadyvolunteeredtheirices,or one of every six,would be the State's proportion iffullarmyof2,000,000 wereinexistence, CAVALRYMEN PASS.In a letter to home folks last weekMr.Archie Campbell,who is a mem-ber of the Lincolnton ew troop,—that all the =ede in the troon passed ex-amination.Six were rejected butStatesvillefolkswereamongItisthat probably not go tocampbutwillgofrom Lincolnton totheMexicanborder. WITH PIEDMONT BATTERY. Messrs.Leonard White,Jt.,Thomas Hill have enlisted inField at aae and Hill had see teterFortOglethorpe a n. i a l . 3 oe netproceedsgototheMedCross.Hungary. by the fact that thewaeprominentciti-means,who could xes months ago as well appeared on the list when it into this e.paid at the last mo- -—--to get their before the time limitThursday.; change of sentiment in the matter of payingdemagogueshave ete cone —the op t'ple by tax col- and gublle officials charged collection of taxes,for po- reasons have een too indul- ,until many people actually en- n the helief that the collection taxes is an injustice.Therefore they put off the payment until the last moment or until they are actu- ally pay,and if they can’dodge they think they have done something shrewd and entirely prep- r. i f r e : f zi DE A D In the war period through which we are passing the man who volun- teers to go to the front and risk his life is acclaimed a hero,while the man fit and selected for service,who tries to dodge,is almost universally condemned as a coward or a slacker, or at least as one lacking in patri- otism.And yet the man who tries to eseape army service,or who re- fuses to go into service until com nelled,really deserves s criticism than the citizen who wilfully refus es and neglects to pay taxes until compelled to pay.The man —cailed for army service is calle!to risk his life.Taxes call for a few dollars in money.There is no comparison in the cost;and yet one is just as much an obligation to the government as the other. At first blush mavy may from this line of reasoning.bul impossible to get around it are necessary to carry on chinery of yovernment,which tects life,liberty and property. may think taxes are too high,are diseriminatory and unjustly levied and that tax money {fs often wa all of which is sometimes true.Bat that taxes are necessary cannot be denied,and they are usually justi a high as the public deman-s that is to sey,it is usuaiiy the vublic de-mand for expenditure for improve- ments that makes the taxes hizh.We are usually ready enough to demand publie improvements,but it is when we come to pay for them that we squeal.It is proper to object if we think taxes are unreasonably high are improperly levied or that tax money is wasted.It is the duty of the citizen to protest under such con-ditions.But the remedy is not in delaying payment,in waiting until we are compelled to pay.We get nowhere in that way;we only dis- credit ourselves.Usually when we pretend that we can’t pay,it is sim-ply because wWe don't want to pay.and hence we put off the evil dayuntilweareroundedup.These remarks are not criticism ofanybodywhoisadvertisedfortax- es.On the contrary The Landmark reasserts the belief that 95 to 99 per cent.of those advertised could havepaid,but they simply followed the custom of delay and nerlect because it is a custom.These remarks are to eall attention to the serious defectinoureducationinthematterof taxpaying,a defect by no meanscommontoIredell,but none the lessadefect.It is no excuse to say oth-ers do it.We should seriously co: sider our duty as citizens and pa triots in the matter of tax-raying. and see how short we fall wher we wilfully neglect and disrevard thiscalltoservice.If we do not pay ou: taxes promptly,or wali until we are forced to pay them,we are estopped lizsent it 18 Taxes the mapro- We 0 ted, !tions or exem chairman of the ways and means com- mittee.In addition to his formal statement of criticiam,Representative ief Kitchin saidthe revenue bill as amend- ed by the te is such that the’ House cannot accept it. The Demoeratic floor leader explains that the House provision for an ex- cess profits tax levied a tax of 16 per cent on excess profits as follows:The House Provision.On the profits in execoss of (a)$5,- 000,plus ‘b)8 per cent of the amount of actual capital invested,includin paid ir or earned surplus and undivid- ed profits——that is after all over an ex- ception of $5,000 flat in all cases and a further exemption of 8 per centum net profit on actual capital invested, including surplus and undivided prof- its,the tax of 16 per cent is levied on the balance of the profits.This de- duction applied equally to all,big and little,whether the p efits were larsre or small,war or no war.The amend ment of the Senate finanec committer provides,after the manner of the Ene lish system,as the basis of deduction or exemption and compu.ation of thi tax,the average net profits of the tax able person or corporation during:the three years,19UL-12-18,called the “pre-war period.”The tax ts ' on the eft id taxable year, exeess of theduringthepre-war not as much as 6 pei erage capital was m rneunt of pbevinning * averape age during these yea permit deduction or exemption,i ation of the ti !erage capital ¢ corporatio: ef compu the a’ the taxable ye Instances of Discrimination. Mr.Kitchin the pootes 1 rates of the s profits,which range cent on the excess « ibs.He cory * duction ¢ undue dixert Fortunate Wis ing scale ies: exemption an the that were pre wie prosperous or the hetess pri per committer perous the preower poried aod His prosperous sow,have a larrer tion and pay less taxes,and cases ro tax,than the fess fortundt and less prosperous during suck ried,though it may be a competitor “Fer instance Lh inom netuai \ S100 000 case Cardo cstic capital inv *pre-wal ' per cent profit. then a ve wv. same business, vear ine t? Corperats 7 came capital,ba younger,during thy period made 86,000 0 6 pe Is making £25,000 oF just the same as the oldcr Senate Amendment “Under the 8S tec amer dment ¢ not a cent of ause there the preowor period,wh Bowill pay 86.929,as tt i S6 000,oxen pla Val profit 1)mgr the vears and the first t the first)cor poration,. made £100,000 clear profi B,will have S43 000 0000 protits 129 taves to tt finanee the wie pays nothing “A corporation of tal,making during th and yor 100,000,6r V5 per eer (and there such Will pay now ri p corpornt Unfair. wite fran coun wperacion A wilh pay EXCESS profits t: peofit mgs fe econd, PParg Slo ooo pre-war rhe brands and like iTheSenatebillexpresslysuch—=©counted as vet capital invest n computi \°“tions fromthe'tOthercomplaintsmade theSenatebillbytheHouseleaderin-| clude:“The Senate amendments strike out the Lenroot amendment ee Se surtaxes on large incomes, the large incomes are relieved of $66,- 000,000 ip taxes.“They strike qut the so-called re.troactive income tax,which relieves income tax payers of $108,000,000 taxa,“They repeal the ‘munitions manu- facturers’tax’and relieve the muni- tions makers of $25,000,000 taxes a year.“They amend the present law by exempting all corporations from tax- ation on account of dividends reeety- from other corporations.Corpo. rations,especially the big ones,are thus relieved of $50,000,000 taxes a year.The United Siaies Steel eorne- ‘ation ts relieved of 310,800,000 annu ally of last yoar's income and towill n th verr. “They strike out the additional tax on transfer of estates of descendant and this relieves the big inheritances $6,000,000 for the first yeer an? $28,000,000 ur more ygarly thereafter.” Senate Shifts Tax to Sagar,Rte.M Kitchin ~«that white the Hieuse tell ore ‘tox on the manu faeture and onde of auto tires,sporting: ,nene fowelry preture films, inies,the Sen \to sugar,cof of eat on basi» more of nuto uy on cigar- tob:e K'tchin,“ane HOO)on eof Ther strike out 5.000.000 vearly on le of automo dinmonds ion picture haie made the tax on rood this rom the House bill ,year on the own- and £40,000,000 a the House bill comprar ies rep tax- wt and the her,Wid, 'y un tax o cent on ev- positer in iter, coffee,tea the wher and importer the act the big im- on hand and tea. the leal- cents a txoon tea ex that muct bands of the price that amo re numerous MEMO?and all through the aX on hands Yesaler imated lenters have nas of coffee moaned of n eel mon Mavor in Florida. Marrow N. !Pia, he rinst her ow: wcepted the ,per ‘ Horwits be yomen Tose: was the Ves.Horwitz,: offer,anne th ine mut Horwitz i and the ii Sovth.She ma! m: cent soe val ter progress, \tion,omoue Driver and Team hiltled chtnis truck the wayor uney Bros.,merchants ing to natural,seeing that thetheresolution which would have out of CONGRESS ELECTS OFFICERS The Southern Sociological Con- gress,which divided its tween Blue R and Ashevweek,elected President,Gov,C.H,kansas;first viee president, Sydney Johnstone,Columbia,8.C.;ond viee president,Mrs.T.W.linwle,Davidson,NC.’.O.Branson was named a mem-ber of the exeeutive committee for North Carolina and G,T.StephensonofWinston-Salem is corresponding coretary for this State.serene.tmenttemeeetonme ~~Peace in 24 Hours Stomach Sufferers who take Mayr's Won- ul Remedy Don't negleet your Stomachntsanotherminute.What appdura to be minor Stemach diserders may often beofCaneerandUleersoftheStom-do intestines,i Stones,Acute Indi-0.(Castriti«,ntoxieation,Yellowerousailments,of t aware until loo late crivtilen fer overcoming quickly“t=Intesting!‘TroubleMillionsofpeoCnedosevillMayr's Wyt by Statesville Drur SALE, 200)46 r wattle me of riverber ade howe snd ber penon mdi;nbeut half it yood meadow bot ter ‘eiually Ne ds wate fini a fer these conditions Wei \CGHELINAttorney. pasture ed creek re rely Magnolia LIQUID FACE POWDER, The beauty secret of women who knowhow to take care of the com- plexion,Cannot be :detected.Heals Sun- burn,stops Tan.Soothing, A f 4 cooling,refreshing. ‘+f Pink,White,Rose Red. re 75c.at Drigeists or by mai!direct, Semple teither color)for 2c.Stamp. Lyon Mig.Co.,40 South Fifth S:.,Brooklyn,N.Y. 4IE i\¢ a*‘. A real Drink,at Foun tains and in Bottles,5c Doors,Windows,Mantels, Loeks,Butts,Sash Weights Cords,Sash Lock.and Lifts,Hinges, Pad-Locks and Hasps and Staples. C.WATKINS,N.Center Sstreet and When 1092 careof thesame make average 27.15 mileson onegallon of gasoline each — —when2040 cars of the samemake average29.04 on one gallon each —that car must be mechanicallyright. The figures citedare thecertifiedscores piled upinthehistoric Maxwell gesoline economy contests of May and June. They were made 'privately owned Maxwei!cars in actual dally use by the purchasers. Only the highest standard of efficiency clutch,transmiszion—-eversy detail —-iitied the sn in engine, mechanice! achic (CMI Mts.ni of res Kd.G.White Motor Co. Statesville,IN (ce Fa en TR =ie s : se k Modern Kitchen Helpers. No man wants his wife to.work her fingers to the bone! He wants her to have everything that will make her work easier -save her time give her leisure—fer this makes home life brighter.happier,sweeter. No wife can do herself and her family justice, she is all fagyed out by needless work. Every woman who does not know the value of the McDougall Auto-front should visit this store without delay and learn how it cuts kitchen work in two. Williams Furniture House. not no pennv of excess profits tax while ai littl or on melfromcriticising”those who try to er- cape army service. Cleveland county,0 \ mm foad, insientl Charles Canipe,a mui Wporation hant or farmer with 820 000 capital:1 ver,making ¢ye oe oy the pre-w s6,000,will pay ove “Why Commandeering Ships.aan Immediate commandecring of most of the vessels under construction —inAmericanship-building plants hasheendecidedon-by the =shipping hoard.The step is :fine ro ovenrs and now me SL SO0O ir ae tl fr whentaxe should the government pg huys a Piano Tredell,"it ivht)so from an Iredell irm.MPoTHE MONEY IN IRE- !We have just paid the Sher-ee -goes -1 rT of Tredell another $50 to renew ur licence to Cll musical instru. hundreds of thousands an meeatinLEONARIYS PIANO STORE. profits t )smmaitiecs anedme st HARDLY STAND |WE ARE PREPARED |ng highly prosperou the pre War Veors they ar making th ' i man vhter of n such an ima yiebminary to corporat:or pe the requisitioning of American toi nage already on the seas and will he taken to speed construction that oeccrugsh out % the yards may be cleared for build “Th,erat ing ships for which the government has let contracts There are building in the vards of the country about 700 ships,totaling more than 1,500,000 in tonnage,most of it for foreign account.Hulls and contracts both will be taken over,the final disposition of the foreign eraft to be left to between the United overn- ments concerned The completed American ships will be retained bytheboardforoperation. Prohibitionists Not National prohibition by a}!,nually testionalamendmentwa|ID asa the House of Congress by the prohi-,wen bition leader:the day after the thes Measure passed the Senate It will oe not come up until the regular ses-5, sion in DecemberRepresentative Randall of Califor- nia,the Prohibition party's only Representative in Congress,issued a statement declaring that “thefriendsofnationalprohibitionhave been flim -flammed by the liquor lobby in the constitutional amend ment adopted in the &Headdedthat“a great jollification’ was held by liquor representatives in a Washington hotel and that a (aretina or Tr well -defined rumor had sprung up tural States, that the 6-year claure added was re.Wi!)Pay much—by the brewers’attor-than will the largest inch SACREereoieeone se ndéreds of co whose anual prot millte: PRCESS profits each year reach the finance ¢ cH “rt ame amount of profit ne To repoir that Casing yeu cut on ¢vour last trp and took chances with a blow out patch to get in on We im put it in as geod | condition :t was the day it was put on car.‘ THE TREDELL VULCANIZING"&SUPPLY COMPANY. negotiations:hereforo.have no excess bul States and the :ee twee Restored to Health by Lycia E.Pinkham’s Vegetable Compound. the Sennte nis OF ¢pat Farmer Hit Hard th“Under Many case h making hundred Senate nb Satisfied.ome millions ofconstitu Fulton,N.Y.—‘Why will wome pay out their money for treatment a: receive no benefit }iT when so many have yenr.j so yptber that Lycia!E.Pinkham’s Voge- table Compound will make them well?For over a ear I suffered so rom female weak- ness |could hardiy Sc. Eel esetMat Cale’BetlingSeepcotaWLGahyon_wpcratinn |Company._—.Phane 82,—woukd help me,but Lydia FE.Pinkham's Twenty-four Bottles one Dollar. Phone 201 Court Street.We sell Miller Tire and Tubes!are thar i mO00andwhethi i present |pre 'Wilh meat $6,000 prot in the pre-war vears he di ries r &1,000 know a corporation whose capital ane irplus r $100,000 000 and whose profits are over $12,000,000 annual! “Under the Senate finrnee ¢{ amendemont this 82,071 while th COCOLADE IN BOTTLES, It’s good.Nuf Sed. .while You take comfort,satisfaction and pride in the bed room that is properly equipped.It is no more expensive to furnish such a room attrac. tively and right than it is t®muss it up with a lot of miscellaneous furniture,The important thing ‘s to SEE THE ARTICLES AND THEIR FITNESS BEPORE YOU BUY!We offer thisadvantage!' mm vill 3 will a cent to support the wevernme the w The farmers j1wy' ’.et rover nate.’ecorpocnation pay in perations in the respective State (ther Nations Exempt Farmers. Mr.Kitchin pays the cxcess profits laws of other nations «pecifieally ex empt farmers from their operation,ache orthe bluescouldeee the let.wherens the Senate bill includes terswrittenbywomenmade well by Ly-them.He adds on the subject of EK.ham's Vegetable ©corporations:\f ve bad ptorms and do“The Senate amendment expressly|the —thepermite‘water’to he counted as ‘enp- ital employed,’in computing ‘%, Vegetable Compound has proved it otherwise,1 am now perfectly weil DR.J.M.HOLLAND. and can do eny kind of work.Mra, DENTIST. Neuse Preps,care of R.A.Rider, OFFICE MILLS BUILDING. -R.F.D.No,5,Fulton,N.Y.We wish every woman who suffers female troubles,nervousness, AATMINIce es iT LANDMARE (UT DOWN EXEMPTIONS. ry .7,Not All See Ex-.=empt—Pay of dx|Served at the Fountainof Quality=||sidered inSupportofDepend-|——we enenl,"ine “ge,ante Saat Exclusively For 10 Cents,mm .will make few requests for the ex-™ m ™ -emption of postal employes from*military service.Postmasters are in-ikea,"structed not -for qeein ° KE AND TAY for carriers or laborers or for clerks :, From Charlotte in ¢econd-class offiees below the #1,-CHOCOLATE NUT FUDGE ad ee Sm we =“e@ :0)grade,clerks in first-class of- fires below the $1,100 grade,or any MAP >above these grades,unless they are LE FUDGE sFromTaylorsville ‘alified distributors of mail{No.23 ar.9.50,leaves oes The ruling is the firet formal ae-CHOCOLATE FUDGE * 15 ar. ~—tion an aa department inj :Fingers.ompliance with resident Wilson'sMr.Kelly Swicegood,a memtber ic directi RS:;der divecting that department offiof7—Blues,suffered the .\,),indicate exemptions and that BUITE COTCH FUDGE. i\and 8 ee ore on his :the requirement of indispensibilitv 5 “— ine .ny aie en @ shotgun Ww »rigidly enforced.As generally|Rasa The ee o.mnstructed the postal ruling shows g \.~‘9 ,:.b Recreate AP PETC |the purpose of the xeministration to St t ll D C ‘/Cooleemee.Mr.Swiceroo4,©WFO make the government department §a esvi e rug omp y home was in Salisbury,but who W@s jocders in freeing valuable employe 'jmending the day with cciend at fo,war service.oS 3 Cooleemee.was going teoouals of No Exemption Fer Mail Carriers.;—The Rexall Store.— F i / iFaHh f i i k i Draught.I made himtake a big dose,nee of so with the :The entire mail carrgrs force. and whenit began to acthe fainted,he jw SS t nis un on the yet imbering thousands of men,of erm wasinsuchmisery,but he got reliefand a total he a —eektn nom a —per centage are >fe within the draft age timits,is ne began to mend atonce,He got well,Crepe De Chine |Swie od’s right hand.Mr.Sqlee- cclided from exemption unless fo |tood s heen a member of the loca!hysical reasons or because =thes,.ea:*-.moany for about a year,makiny py.dependent families.Every porandwebothfeclheoweshislifeto Thedtord’s Black-Draught.” ‘Thedtord’s Black-Draught willhelpyou.|tee tipto theborder wih WP GM.i.of the country ix reached by th: to fit,ready ior the day’s work.|...ry.nul Vv,as even the rural earns rs are .eu NC-13)|TOWN BOUNDARY ELECTION,((s!uied.The department's ruling ty ania a and |be election on the question of ex Holi ipa leaves =eet j j »yw >arioa &chert within he eXemption cinos.y ae oP 4 eosU.Pelee tieer Preatel ag gaya a thy are hig aly specialized diviritar On account “=~business that will take to be talked.The registration book:‘';a our time we have deci sePHONEpASecrererintretionbook’Reducing Dependent Claim.time we ha ecided to close out our F b f Da -B }to and including September Ist.A,CO ee Felis business which must be done in the next cs ;A eee oi LY nKe steps €“ince e num ...or a bag0 vis bros,ats oe oe i =,hor of exemptions because of de thirty days.Remember the time is short Graham Flour,fresh lot |Georgette Crepe [necessary to carry the election,The ()eS and you will have to hurry to get your share right from the mill’'lvoters living in the territory whieh i!ae:ent ba One a Ar Ms *;pate °ee : jis proposed to annex are entitled tr -a ae aaa ae a ¢of the many bargains we are offering, Don’t forget that we have}a,well a those inside,month and that local boards must We have a big line of Suits,that will be ::|,9 AN BRET :cosider whether a man's dependent anything you want in the Shirt Waists |the annual ‘Troutman reunton wit!2wit not,be |sunported a §just what you will want next season and way of Spice,Vinegar,jhe heldat Troutmae|travewar’Please call attention af |local @ then for the hot weather.Wehave a big Extracts,Rubbers,Jars |vutside the Troutman family are 0's to he Pcie opelage 8 line of Cool Suits.See the best Shirt for and Jar caps.“kets are "Specter wil “ie a esta aces —$1.00 you ever put your peepers on.Big Phone 89.in diutamuivn wk oe ee ee -line of Straw Hats at your own prices. lhenefit of the Troutman Historiea!cna ally ‘cor “re tae :Many extra good things in cool Underwear.‘a Eagle &Milholland.|Association.——0 2 month are easily able to allot |BIGGER ENGINES.25 monthly to the support of —de- |The Southern Railway Cempany vdents.In ease of death in line of the wovernment wil pay to the You will have to hurry as the time is short. :4 "8 laced about ll of hei il : Flesh and White,|madsen.Sirs Ps ‘a ee =icficiary designated by the soldie lon the Ashoville division,These en months’pay.C I C é a a Ferndell lyines will pull 2800 tons,while —the Section 4 of the sele tive service DO CHOROHORCROHL ORONOOCHO:CRORE PROPOR OHO ORIOL , CL previ:tit theese he State a rt o .|tvpe of ensine formerly used on the :|:|livision would pull 2,000 tons.Thes:1 respect to persons dependent| Red Raspberries.jheavy engines are self-coaling,the ron them for support which renders 4 their exelusion or discharge advisa-loperation of a lever feeding the e:|g calPeeledApricotsNewestFallModels,f/omrsign.of 8 lever feeding the eo OT yiay he tiorhaged,at it dacs := j ea s ot require tha they saat e dis.iu i Joar j TAKEN TO RALEIGH.rherged in all such cases.The dis-)&Hockin Cling Peaches.;Charlie Williams,the negro cor ction of local boards is invoked by @ ; .=..t SP A R S LI E us 1h ine >ivicted of the murder of Deputy this provision and such boards may Sliced I bneapple.|Sheriff John Miller and sentenced to w.!l take the facts above into consid :ry 4 .i tie in the electric caair in the State tion in deciding claims for dis-@ Graded Pineapple.|Some Embroidered,;erison September 14th,was taken to charge due to “dependency,with a)@ a White Cherries.')Raleigh Friday to await ine death view to determining whether as a)&cn , ‘sentence.Williams was tn ihe @us-matter of fact,the person claiming @ rr ;‘tady oof Deputy Sheriff Baron cach discharge will not be in as srood By . This is the best line of smith or better position to support Wis de-|§Are good ones and if you have Canned oods put up ee ,nendents after selection for militar =. .t VIRGINIA PRIMARY.service than he was before,If such!3 " MillerMcLainSupplyCo.—Beaded |A Democratic primary election iG ie Cu a ee Rice,miei =ws =more ~~te a be will be hell in’Virginia today to should not be granted.“—they cost to sav on q ee candidates s for Stete of-Reduce Exemptions to see:2 7 to save the fret.Apple 'jfices.‘Phecse are three candidates Government officials generally are :$' —aos oo pi arn eS for A cl :Lieut.Gov.J.a bewinning to take up the individual z Cider will not take the place of the. r Ellvsor,Attorney Genera!.,Questions that arise where govern-,Hy se ”a iG Har i School.and Garland Pollard,both of Richmond,ment employes are called for service :Quart but to those who have not mony unt Westmoreland Davis of Loudon!Seeretary Daniels says knotty preb-@ -. f ‘oanty.lems are arising in the Navy Depart-.¢4 taken to the water wagon entirely,ae F REE Aa::i“‘ntoas to What individuals in the gg 4 A Farm Life School RED FLAG REMOVED.Met tvae nies traueeioeen.or ci ill be ‘taste ‘ es et Mato ee ae ider will be a good substitute.a For Girls and Boys.}the “Silent Policeman”at the inter-)ape al aha?fy t fadiap ce 4 } :jsection of Mulberry and Walnut)9 mber of exemptions asked bye the.@ ,. —SPECIAL COURSES IN|.others Lace Trimmed.Pee.rhe city authorities insist Werune departments wil be relucel Fruit Canners,preserving Kettles, :that the flag be replaced or the party te the absolute minimum,it is:indi-tf a age ty ilalalal who removed it will ve sorry.enti,cc if come temparary de |i Apple and Peach Parers and other 4 ea 4 SE .we 4 rangement o1 the clerical wor re a Prepare:for College and Universi-MATTERS OF NEWS.ults.;seasonable goods.. ty entrance Thirty -one m n dead and 19 in General Crowiler hax auggertes x i - ‘.,:y -ore men ceaw ain yin-the Govern»that eack issemble ;le 4 hall tran,pens TUESDAY,Sep-|Pl the lot there are fifteenJ ivret is the known toll of an expios:IRC fill member chip ot all district : tember 11,117,Engage board on in a coal mine near Clay,Ky.garde in his State for a general con-44 We strive to please, now at Dormitories.Most of those killed were negroes.ference to jsoure uniform —procecd-“4 John Bean,who reeently deserted mos rey ne hu |The Gor i For further information and new his wife and children at Lenoir ond =ee oF a aan ne wo iMusteated announcement write to leparted with Mrs.Ida Borders and oficial vie erat Medias a . R H LANKFORD P *|her daughter,Mrs.Pearl Bean,wife cmea Scount attorneys ire aug 4 , -i.rincipa jof Walter Bean and brother of John posted..A me ;P :or more styles to select |Was arrested with the women at !be-NCC eee ¥y-i gomery are Harmony,N.C.|troit and brought hack to Lenoir Watching Watson.as ’ ~~In Cleveland county Superior Court THAMA ince Gees at Thomas.ae :. mre last week Preston L.Toylor of that KE Oidkicn ut Th “a ri,1,are re *oc dee Ath id tt Cte a hee et Mh Dn wuins he Tillassee Power pany a ie A ‘2 aa sf u mbites sagt uaa senate ar ’~—"oe a 9 urainst the Talhissee Power (at Justice:|Offeis ire seeking to maar Hat il Mik est gman ud a2latBadinlastfallwhenarWoeucantOtatoe;';::veer <tateme?hing resistance ber,Paint.atruck him on the head and frict cd 4,the seat ah oo ensene his skull.Copies of the p tion lirourhe as C,WATKINS,‘phone No.48. o the Attorney G-ee |Motor Car Headquarters Herel |rhe Paar seneraity.exnrod.cd,.(ae between F2 ar)ti from Atlan-¥ WAN I ED!Sizes 36 to 44 pre eg ears eneralty cere in,Chattanoogn,Darcie,Va.ant We are headquarters for your motor A .-=™.m id *the terrible burden she has ber j umerous small tes 'rth Car-)sg r rant «‘;> SCRAPBRASS—Heavy lirass 7tc.a aa ae ‘it picts France Ola,Te nue ce,Alabama,Ken 73 car.You want itat all times to be fit per pound,Ligh,Brass Se.per le stronger today in fightiny men oo.and Georgia,to a fund to he @ and swagger and we are splendidlyde¥oted to testing the constitution:provided with the best ‘‘tried and pourd ind war materials than at any time hit p the draft law.Th nae *¢luring the war,despite noe vyenre aeity o he dra a e subserip-ees : I (IR SA LE:be gh vn hans ae a =hy vie ons in a recent number of the pub-tested”’accessories. Buildin M {rial .aan.Tayler Aas ing wed fi Fr,letermine whether ne ean bring Z ale 9 from.(000.He was working for the comp NY preeeedings against him because of ttention 4 M 4 =.wrentest share among the allio.has lication totaled approximately &ty-Safeguasd against delays and annoy- pew sat ones Ol tee Priced,$3.50,$4.00,$5.00 fale ‘to the French wrmees.0 anne ances.oy having your car at all times room supplies.|bp Americas pamela given i;An,(Seat SRabe-up te (ermany.read.for any service you demand of GC,H.TURNER.|ee a me ae ice it,by keeping the accessory details Iredell ‘Phone No,14,Bell Ne 7.|)formal communication to Secretary isters of Staic,lain;Foreig:efficient.We have everything here ae |Baker setting forth a detailed -tate-Secretary Zimmermann,aid in 1d .a »j is i b oo ;and $6.00 ment of what the devetio:of the retaries of State,micluding Finance that comfortable motoring is heir to, Trouble Righted aii French people has made po eo.Wt Minister Lentze,ard Petertor Mini at the most moderate prices.Our — Battery -Ht ‘ontains stunning figures ast)the ter von Lowell,had resivned —their Service is prompt.painstaking and de-& ‘eo «Bat trouble,P jmen,runs and money they hav:portfolic ondenl =ye ee C a i locate tributed to the war.It breast!’liv.Richard von KuehImana,th pencable, bring us one <<"by !pirit of confidence and hich r German ambass oder to Turkey,ha Sala ue >eas the trouble.wo done j ave.It asserta witheur he-*n tn appointed sccrewry for foreiys A ((k,~S ()R I E s an expert!t that the United Staves fst:1 in affairs t vueceed)Zimmermant ,oe STATESVILLEMOTOR co..|striking the last blow at the |reeeet |}Quak.ee Tires,Greases, =‘5 ic Sp Tweniy -Four Lives Lost..a .DR.SUMMERS GETS OF!ca fale ee Al Mansfield ©ing Metal Polish, Dr.J.W.Summers,the Charlo't©the sinking of the American steamer |physician under sentence of [re Motano by a German submarine July lyears in State prison for malpoace OO)according to an official report Notice!| Have left my accounts at Stim-ff)Bree,Jace,Chemo,Sie, son's Drug Store.Thosei t tement :.:eaching the State De tment.The ee eae oe eauke ool tice,seta offwith a fineof $1.0"ister und 22 of the crew were sav Patches,Pumps,Carbon Removers © |el The department's telegram . |PURSEAL.tates that four ‘an were saved Cements,Bumpers,and everything else Mv.and Mra.J A.White of and landed.Bight naval gunners andjLaramic,Wyo,on their welling ee ene ers of the crew perishedtripthroughSouthernandEa.tern '6 members of the Ocoeeeeeeeenn States,stopped over for a brief vis Chronic Constipation.Ww.R.Mills Motor Company...jut to Mrs,J.Hn.W .tt in by fo Meee aH CueF Matter pepe |eSe be oe,ea -|_progesh andEberSoouties thin doar tH nae”Tame a 6 Stateoville,N.C.5A2,sa --wm ¢euferty ie comply wi »plain pelete dlirevtacns ol . NE KEEPS)[Beemer diario Son ‘rie ty the clei pind reer)GS 6 QVERLAND and HUPMOBILE,; ':9 .“e Pe :by dleorders of the momach and '@4r,tint acoompene ch smc 1 iiet'=y be avokted by Ge of Chander --- Getheme ewe (They only)' cost @ quarter. Body Polish,for a car." L.Sherrill,M.D. oo cited makestheseduringspare time. oy rete eeee see eeneees who is charged to the government, of the State Board of Agriculturé,an appointee of Rickett,the Governor should take himin hand for discipline if the = charges are true.It is also suggest-— ed that Prof.D.J.Jordan,a member of the faculty of the negro Agricil- tural and Technical College at ..ddreénsboro,should be dealt with on account of a recent letter he wrote “President Wilson,in which he sug- gested that if America was to fight for democracy the negrees have e square deal;that they should not be expected to fight for a gov- ermment which did not protect them. That was the substance of Jordan's letter,which feeling when it was made public recently. if dan the shauld arousec Some they're going to deal with Jor- The Landmark suggests that tre the State University also deag}With Prof.Horace the faculty of that in iitution.In Charlocte on the 6th of May Prof.Wiliams,as reported hy the Observer,told a group of his tees of Villiams,0 Inst former students that there was pripeiple involved in the war;that wevhad vone into it because Germa ny had stepped on our toes,but that Ergland had done worse things to us,which we had overlooked We re- ent Cermany,he said,simply —be- eause Germany is Teuton.No paper outide of The Landmark,so far as ean recall,criticised Prof.Wil- lems for his disloyal utterances.A correspondent of the Observer criti- cived him,tut he made reply either by way of denial or explana- tios.The professor mt Greensbero is more excusable.He has rievanee and is not supposed to be as wise as Prof.Williams.While the negro is not excusable,it would be ea glaring discrimination to dea! with him ane ignore the offence of Williams. A REAL PATRIOT. Representative Kahn of California He is a Republican and a native of Germany.The othe: day when ine conference report on the feed bill was up in the House, the Associated Press report says of Mr.Kahn: Amid applause from hoth sides he (Mr.Kahn)urged unted =sumvort of President Wilson.He emphatical- lv endorsed the conferees’action in eliminating the Senate war expend- itnres committee amendment,oppos-ed by the President and favored by some Republican House leaders. “T want to congratulate the House conferees,particularly for knockingfromthisbilltheprovisionfora ‘snooping’committee,”said Mr. Kahn.“The duty of Congress at present is to present a solid front in standing behind the President.Heisthecommander-in-chief of the ar- my and navy.He will have to give an account of his stewardship later. ne nevro is a real patriot. plet us not hamper him now.”Mr.Kahn predicted great success forthefoodadministration.+Glory to Mr.Kahn!He puts to ,shame those narrow -minded part sans who think politics must be up- permost,even when the country is at ‘war;and the pro -German sympa- thizers who would betray their own ‘country in the face of the foe. RANTLENEEET ;THE MOTHERS’HARDSHIP. Some mothers.”remarks the;PURTHER RESTRICTIONS{Greensboro News,“who before the on elects feaft found it hard te in-If they put on a few more restric- pduce their hove to pay their ewn tlon about exemptions,the chances laundry tickets,now get their full of one physically sound getting by pay check They m not yet all the craft will he very clim.‘The pro-! the pay check hecnuse there may be “°%marshal has notified exemption fone.Gut just the <an na cay h boards that in considering depend ere,who not !receive no help ents it must be borne in mind that a isoom thei:but renily support private in the army gets $380 a month the sone.will cheerfolls ~crt that and everything furnished,and that they ‘cannot possildy vet on without *!least $25 a month of the $20 can he support of thos:ime mother he sent to dependents.And the factsuppertedcorPhelepinea?ia that #25 net a month solely for mother’love have never been the family will be a better income siiited,and the more worth the than some can make in civil life nem,the closer docs the mother aticl Furthermore,if the sotdier is killed to Wim.Poor mothers!Pheir Wore wounded,the government =mak: dae te always heavy;and when war Provision for the support of his de comes the heaviest bucden is laid on pendents,It)exemption beards fo! them.Ofeen they have to excuse low that tip,many exemption claims and apoloyize for worth slacker on account of dependents will be sons and husband...when in their eliminated.Men in the postal serv- hearts they fee!a contempt for them for their conduct. Ag was to have been expected,Ed- iP Harris,who waited in fear and trembling for August 4th,the Seer Edwards of New lersey said the end of the world was to begin, seeing things apparently normal af 'ter the dread day had passed,ix now in fine spirits and says he didn't be- day i lieve it anyhow fetter not shout too svon,colonel.The world may have begun crumbling on the outer edges on the 4th and the disturbance may not have reached Charlotte.arm continuea fasting until ‘that Dr.Alexander is silent should| 1%is the day against the rules,children are to!plain such grave charges.His silence will have the effect of causing people to Gov.|believe that he said what he is re- ported to have said.If he did say that,he should be dealt with.He may not have violated the law,but the Farmers’Union and the State |government,of which he is an offi- cial,should repudiate him.The views attributed to Dr.Alexander cannot be passed in silence at a time like this,and his official position gives them much greater weight than they would have coming from a private individual.The danger of such talk is forcibly and correctly stated by the Greensboro News in the following: “If any considerable number ofpeopleweretobeinfluencedbythe sentiments of Dr.Alexander and those of similar view,including such avowed revolutionaries as Alexander Berkman,Emma Goldman,WilliamD.Haywood and Littre,who was un- fortunately lynched the other day, rioting would be the result.If a great number of people were to be-come persuaded that Dr.Alexander and these others are correct,the re sult will be revolution in the United States;revolution and violence,cha- os,anarchy.All the restless and tur- bulent elements,all the enemies of ,organized society,are looking on at this sort of thing like hunery jack als.This particular assertion of right and wrong,this particular body of doctrine,is @ear doctrine in- stead of anti -war doetrine.Carried to its logical conclusion it means the shedding of American blood,and not by Germans er Austrians or Turks, but by Americans.it is to promote internal war and in presence of the menace of a foreign enemy. STAALNOMETASITTIETNS HISTORICAL ERRORS. This from the Asheville Times: Years of military training are not always necessary if a man is to be a success as a Military teader, re- marks the Winston -Salem Journal, and then the Journaf says:“When the War Between the States broke out the man who was destined to be the North's greatest general in that conflict was not a regular army offi- cer.He was clerking in a country store.But four years afterwardsthecountryclerkwasthecommand er-in-chief of the Northern armies who graciously decline to accept the sword of the Southern commander who surrendered to him.” While the name is not mentioned, the above evidently refers to Grant.While it is true Gen.Grant was a clerk in a store when the War Between the States began,he was a graduate of West Point and had served ten years in the army,the service embracing the Mexican war, and he had reached the rank of cap- tain when he resigned from the ar- my in 1854.In addition to his West Point training he had really had years of traming in the army,some of it in actual war;and had been out of the army only six or seven years when he re-entered the service won lasting fame. It is surprising that the statement that Grant “graciously declined to accept the Southern commander’s sword”should be repeated at this late day.He did not decline to ac cept Gen.Lee’s sword at Appomat- tox,for the very good reason that the sword was not tendered him,as those present on that oceasion,—in- cluding Gen.Grant himself,have tes- tified. Gen. and ice and other government employes also find,by the latest rulings,that their fancied security is rather sha ky.Real,genuine farm =workers, combined with the dependent claim, will probbaly be the surest exemp tien claim. SS ee ee ee The Landmark has never been an admirer of Congreseman Heflin of Alabama,but it wants to say that his remarks in Congress the other day,about the members of that body who are giving aid and comfort to Germany,were all right.It is well that he called names,even if it was oeItistimefor—Ash Amy OneWheHas Used n. | There are who alwaysaimtob%Po.otbro.Tagan rect,forvacrtyChar detdstcr's,§well teacher in Caro-é “See trants who are sick or ‘home should promptly notify the al boards.In case of can,by permission of jwhere they are registered, before the board nearest to But they ‘examination.must notify It —al ithe board uw.such cases and get per-|.the offt aos be ‘mission,Those who think they ean!nick out the who had to go.‘dodge are making a terrible mistake,|Many of them been en by their eye for butIftheydonotappeartheywillbecorWeengineonGetealy. passed up as regularly enlisted,and!7pe commandi:oMcer made a will thus lose all opportunity to| claim exemption.Ii they then fail to appear they will be treated as de- serters and all the civil and military power of the government will be em- ploved to find them,a reward of $40 being paid to civil authorities for ‘heir arrest.The penalty for deser- tion in time of war is death.Ef eon- victed by a court martial the desert- +r will be shot unless the President interferes,and it may be set down us certain that the Pre ident will not «deleful outfit,that made its last soon — interfere except in unusual casea, Eternal cisegrace and probable death awaits those who refuse to comply with the draft act. ‘TEMS OF CURRENT NEWS. Happenings Here and There in the State. Eddie Brigys,ti yerrs ald,acei dentally fell into the rcservoir at Trenton Mills,Ceostonia,and war drowned.e A team lelonging to Mr.Phin Church was drowned when Mr Charch’s boy drove into a swollen | stream—Lewis Fork,Wilkes coanty.| Dr.Wilsen MeConnell of the Da- vidson Coll..re faculty,has been se-lected as one of 20 nose and throatspecialistsintheUnitedStates—to serve in France. Gus A.Price,the Catawba young man who is charged with the theft of an autemobile at Hendersen,is in jail in default of bond,awaiting trial at October term of Vanee county court.; L.S$.Jones,a merchant in North Newton,left a bucket of yasoline ancdipperonhisstoreporch.The two- year-old twin babies of Will Lominae saw the bucket and tvok a drink.The doctors pulled them through. The Second Regiment of the NorthCarolinaNationalGusrd,which has been in camp at Goldshero since it returned from the Mexican border early last spring,has been sent to Camp Sevier,at Greenville,8.¢ Herman ©.Smith,defaulting bant cashier of Goldsboro,charged with a shortage of upwards of $80,000,se: tenced to four years in the State pris on in 1914,out.His term wa shortened by time allowance for goo behaviour. A Union county man,Grover Mc Bride,has four sons in me militarydraftandonehasvolunteered-—fiveoutofonefamilyifaltthosedrafted are taken.A correspondent of —theMonroeJournalsaysMr.McBride's chief regret is that he can-<go with the boys. Fire at High Point Friday damag- ed the dry soods store of H.A.Moffit,the undertaking establishment of Loflin &Brockway and the millinerystoreofMrs.R.L.Voflin,and water practically completed the dam age,oss estimated at $25,000 to $30,000,covered by insurance.Secretary of War Baker has askedCongresstopaytroopA,North Caro lina cavalry,located at Lincolnton,fo: safeguarding bridges after war wasdeclared.Capt.W.A.Fair and his ‘troops responded promptly,uithourhtheyhadbeenmusteredoutofFederalservice.The bill is for one day'sserviceandexpenses—about $51). G.W.Lashley,superintendent\the Lakeside cotton mill at Burlington is under $1,000 bond to appear at Federal court to answer the charge ofmaking“seditious and unpatriotic re marks.”He is said to have expressed the hope that the Germans would blowupatrainonwhichthePresident traveled,NEL TES Root Hopeful For Russia. Faith in the ability of Russia ( overcome her difficulties and perpet uate a great and free demociacy wasexpressedbyElihuRoot,head of the American mission tu Russia,whichlandedinAmericaataPacificportfewdaysago.“LI heve abiding faith that Russia,through trial and tribula tion,will work out,creste and per petuate,a great,free,self poverning democracy,”Mr.Root said in bis ad dress,Professing a sinecre admira tion for the kindly character of tne Russian people,“considerate of the rivhts and feelings of others,and withahighcapacityforself-control and noble idealism,heading:always in abetterwaytowardhigherthings.”hi pleaded for deep sympathy for the nu tion,“which is struggling with theproblemsthatwehavebeenstudyiny for 140 years and have not yet solved” Other members of the party alee brought words of cheer and hope for the outlook in Russia. State Librarian Resigns. Capt.M.O.Sherrill,State Librari en sinee 1899,has resigned on account of failing health.Miss Broughton, assistant librarian,may be elected bissuccessor.The State loses the faithful servant in the retirement of Capt.Sherrill.He is a native of Ca.! tawba county.He served that county|for 14 years as clerk of the court andalsorepresentedthecountyinboth!branches of the Legislature. 1s \ service of a |‘Than C.WATKINS cay) arcech fa which tbforthemashecould,Unsuited byphysique,unsuited by temperament.|meuited by training as many of| them were,said Colonel Slocum,they,rad vevertheless managed to muain-on their grip for three months,|which faet alone,in his opinion,was |cificicnt to dispel any suspicion that |was a yellow streak in them.“Nevertheless,in .prie of the com-mander’s praise and ine universalsympathyofthecamp,the dismissalsmeantfailureinthesupremeobjectofthesummer's endeavor,and it was march across the drill ground to the| end of the car line.”|The elimination occurred just pri-!or to sending the mea m camp on an, so mile march,covering seven daysThi,wos an act of merey,says Mr, Jobnoon.“The officers of the camp, jicured that there would be no jus-,roo in compelling men who ebvieus- I}had no chanee for a commission >muke that terrible mareh.” rhe route of the march was fromhortOvlethorpetoTyreme,Ga.,and about SO miles.The march was in full equipment,the command absolutely -independent in se far a the means of existence wasconecrned,The men slept in shelter tents and ate out of mess kits,both f which they carried on their backs.\ivranwements were made with the inhabitants of the country along theroutetouseuntitledlandforskir- mi hing and other field work as the, «clumn passed.No cultivated field Haken, ’i was touched,the care of crops being| trietly rewarded.'“Everything with regard to the fu- ture ef the men in training,”says Mr Johnsen,"is largely guesswork,hot there is reason to believe now hat after the camp closes most of the men will get a chance to go home.at least for a few days.The War Department has issued an ap- peal to the rejected endets to enlist promising them a furlough un- til September 1,and after that posi- ‘ons as non -commissioned officer: with the national army.That would niieate that there will be a period f perhaps a fortnight between the“lose of the camp and the mobiliza- now ion of the national army,in which most of the new officers are to serve. If such is the case,prospects are bright for at least a flyipg visit to their native places for each of —the newly-commissioned men.” Germans Deliberately Drown Prisoners. Thirty-eight members of the crew of the British steamship Belgian Prince were drowned deliberately bytheGermansubmarinewhichsank her,according to the account pivenbysurvivorswhohavereachedBrit- ish shores.The chief engineer,who many times after the steamer was H t £a i a t z.mind the date of ear ; the place. Mitchell z College. KEEP COOL.Rest and Relax in a Comfortable Hammockeeeee “Sl Prices $2.50,$3.00,$3.50,$4.00 Crawford-Bunch Furniture “‘The Store That Always Welcomes You.”‘PHONE NO,400. NS neea en ene ne A A A a Le ene cel This is the disc Plow that gives universal satis- torpedoed was perilousty near drown- ing,gave the following narrative of his experiences:“About 8 o'clock on Tuesday eve- ning when we were 200 miles off land,I saw the“wake of an approach ing torpedo.The vessel gave a lurch as she was hit and [was! thrown to the deck among the debris.The vessel listed heavily andallofustooktotheboats. “The submarine approached andshelledthevesselandthenordered the small boats alongside the subma-rine.The skipper was summoned and|taken inside.The others were mus-tered on the deck of the submarine.“The Germans removed the lifebeltsandouterclothingofallexcepteightofus,smashed te life boatswithaxesandthenre-entered thesubmarineandclosedthehatches, leaving us on deck.The submarine went about two miles and then sub-| meryved. “T had a life belt.Wear me was an apprentice boy of 16,shouting for help.I went to him and held him up until midnight,but he be-came uncenscious and died of expos-|ure.At daylight I saw me Belgian|Prince aflont.1 was picked up after11hoursinthewaterbyapatrolboat.” The second engineer also was a) surviver,ond sueceeded in reaching|the Belgian Prince before she blew;up.The Germans came on board and looted her,he reported.He was|in hiding,but finally jumped into the sea and kept afloat in the wreckage. The only other known survivor is too ill in a hospital to tell his story (once ©.eee The Overcash Reunion. nrocenondence of The ft andmarkTheannualOvercashre-union wil!be held at Enochville Thursday,‘th.Rev.Messrs.R.A.Goodman,John Morgan,V.R.Stickley and B.8S Brown,Prof.G.F.McAllister,ProfJ.Oliver Overcash and Hon,Theo,FKluttzareontheprogrammeforaddresses.Music by the Kannapolisband.CoM. faction.It leaves the ground in splendid con- dition.Will break harder ground than other plows without leaving it cloddy. We have a full line of Chattanooga Walking Plows,also repairs, Iredell ee Hardware Co. The Chattanooga Disc Plow. Sr r ve c e s WORKS 4/48. ACHARM NOW You don’t have to be told that motor trouble is the one ‘‘fly in the ointment”of the autoist’s happiness.After you have given us a trial you won't have to be told that this is the place whereyoucanridyourselfofsuchtrouble. If motor trouble is not positively inherent in the engine itsclf we can cure it.Anyway we can tell you what is the difficulty and you will save time,worry and money by coming here first. Rest,Henne lean met a eteewaDeshemperformmm aeerer|wers,or nowars.80 BUILDNOW!FS ' cw s a e t w e ce c e Re s a A Pe Os we e eT OS S ~_ —_ = — Se ee ef Oe eS a - th t di t hi o n e e es ai al Ma a l tables erected for thepurpose,was bountiful,consisting of§ all the delicacies that go with a pic-' nie spread and there was ice cream and lemonade.After supper Mr.Walter MurphySalisburyaddressedtheaudience.Mr.Murphy,speaking particularlytothesoldiers,was equal to the pa-triotic occasion,delivering an ad-!dress full of patriotic en iasm.|Following the address there was a)concert by the band.;|The mae saving,te qielr inchargeistocongratuuponthesuccessoftheevening,whichwillbeapleasant snemory for thesoldiersandtheirfriends. Miss Sallie Ellis -and Mr.John|Barkley were married Saturday af-ternoon at |o'clock at the home ofRev.A.R.Beck,who performed the ceremony Mr.and Mrs;Barkley are making ther home in Statesville for the present.The bride is a daugh- ter of Mr.and Mrs.V.(.Ellis of Statesville.Mr.Barkley is a son ofMr.J.A.Barkley,who lives)near Statesville.He is a member of the local military company.Mr. Barkley has applie®ror edmissiontotheofficers’training camp at Fort, 2 Oglethorpe.Unless he receives or-_to report at Fort Oglethorpe, »will proceed with the IredellBluestotheSouthCarolinatraining camp. The congregation of Front StreetPresbyterianchurchspentapleas- ant evening of social intercourse atthechurchFriday.Dr.C,E.Raynal,pastor of the First Presbyterianchurch,Mrs.Raynal,the officers oftheFirstchurchandtheirwives were among the gu-s:s of the eve ning.A’programme o7 songs an! dialogues was given vy the young people’s Mission Band.Light —re-freshments were served by the la-dies of the church. Thirteen members of the lredel! Blues,who have been patients at Long's Sanatorium,were entertained by the nurses at the SanatoriumThursdayevening.Cream,cake and fruits were served and the evening was enjoyed by guests and hosts. Mrs.C.PB.Webb was hostesy Fri-day evening to a number of the younger set of the town.There wasdancingducingtheevening.PunchwasservedbyMrs.Thos.Gales of tristol,Tenn.,guest of Mrs.Webb. Notices of New Advertisements Waitresses wanted.—W.S.Flow-ers,Commercial Hotel,Mooresville. Two -horse farm for rent.—M. P.Beard,Cool Spring. Help wanted.Charlotte Knit- ting Co.,Charlotte.Fresh milech cow for sale.—J.Walter Murdock,Statesville,R-1. Fresh graham floar.—Eagle &Mitholland.Chattanooga dise and walking plows.--Iredeil Hardware Ce. Come to us for your new glasses. R.F.Henry. Fine grain and stock farm for sale.-Ernest G.Gaither. Splendid values in clearance sale. Mrs.Mary Sims.Keep cool in a hammock.—Craw- ford-Bunch Furniture «o.Sea Island Sheeting.—Mills &Pos- ton.A call for women.Mitchell Col-we.The people's bank.Merchants &Farmers’Bank.Peace Institute for the education of young women,Raleigh,N.C.Collie puppy lost.Reward for re turn to W.A.Bristol.Tenant wanted for farm.Minnie Morrison,Statesville. Teachers may secure rooms a Mitchell College during institute. Miss Loray Items. Cor spondence of The Lananart Loray,Aug.6 —Miss Evelyn Os-bern returned home last week.Sheisimprovingpast.Rey.8.L.Cathey and family vis-ited Mr.Cathey’s mother ThursdayandFridayoflastweek.Mr.Clar-ence Sharp left Friday for Mont-gomery,Ala.He took his children with him.Master Clayton and little Nella will stay with their father un- til school opens here.Miss Neil Roseman of Lincolnton,who is vis-iting Mias Laura Bartlette,willleaveWednesdayforherhome.Mr.Elmore Stikeleather and sister,Mrs. North Bratton of Chase City,Va., are visiting their parents,r.and Mrs.John Stikeleather. Mr.John Vickery,who hes been working in Richmond for some time, is visiting his parents,Mr.and Mrs. T.W.Vickery.Mrs.L.C.Sides is spending the week with hee daugh- ter,Mrs.William Watt. Miss Henkel to Demonstrate. “tomato"s home atnext. Aug.4 —Miss Henkel) }siatore| . are guestsof Misses Estelle and AnnieandMasterCharlesCarltontoDavidsonandspentSundayMrs.Ida Davis, Kentucky,erMrs.W.R.James and children of|Winston -Salem Mr.and Mrs.Carlton Andrews, Mrs.|} with Mrs.R.A.Parker and Miss LilaParkerof.Birmingham,visiting their daughter Mrs.H.O,Steele. Ala.,'are and sister, Mr.and Mrs.J.D.Bivins and lit- tle son of Albemarle,after visiting)in the home of Mr.and Mrs.J.McElwee,ieft yestercay ror Blowing| Rock.Mr.and Mrs,Turner ThachildrenarevisitinMr.father,Mr.W.W.arpe.Mrs.Bettie Cumbie and little boyvisitedMrs.James Tharpe week, Mess.,and 2.j .Pred.B.Bailey.lin New Castle,Del.,@f-is spending his vacation with his'rents,Mr.and Mrs,T.V,ka %“et ane re.Mette ee es °| a .|from Charlotte a tewcounty,for a few weeks.Mr.Tea#@¥®@)jays with Mr.ond tan.me Morri- |On,!Carolina about 20hassincebeeninthetheRioGrande, :Mr.and Mrs,E.M.Ervin enter-Of tained the young folks:of the com- time in mining business and con-ity :i.teak t ing j —at a party last Saturday in Mexico,in order f©|Mr.E.L.Sloan left Sunday forTeagnewasforcedtotak@|Charlotte.He will work for the con-Mexican citizenship to receive PPOP*|tracting ania at Camp G es=.—were ‘|There is many a —expedition under .|the present war,weioeIethefonttorWil.‘member that some wars are inevita- ing very familiar with the jhle.So with the present one,Theyoungmenthataregom;g to France| traversed by the ex ition,*are going to for posterity.They Teague was very valuable to will be fighting for the liberty andtu8asascout.freedom of the whole world.The fu- visitor knows Pancho Villa jure of this country is within theirwell,having had many dealings hands.Se we should cheer them on the arch bandit,and has known their way.We shoud not be slack- from the time that he was a fugiinthehillsfromDiaztothetimethat-he was the dictator of northernMexico.Mr.Teague speaks highlyofVillaasamanofundoubtedcour-| age and a crafty,wise military gen- ‘rs,hut should de everything in ourpowertobreakGermany's tyranni- ‘al rule. Personal Mention. ‘orrespondence of The lLandmert.|ius..Teague says that toid|know!—ebteined vet from ee|un”and Mrs.J.W.Benson and rpe’s of Vil wiv rrohare gr ¢Miss Sara Benson and Mr.Maxcey |them)the.Monicon “chief wan)Ki"have returned to their home in ;wounded at Guerro in ,See,|Harteville,&.C.,after an extended kMrs.Albert Dodge of Wenham,Mrs.Seth Keeler ofNorthBrookfield,Mass.,are visitingMr.and Mrs.J.W.Tyler.Mrs.Dodge and Mrs.Keeler,who are sisters of;Mr.Tyler,are on their way home,after attending the marriage of Mrs.|Keeler’s son in Chattanooga,Tenn.Miss Louise Walker has returned from a trip to treat. Asheville and.Mon- Mr.and Mrs,W.H.Morrison left| Saturday for Powellton,Va.,whe re Mrs.Morrison will spene two weekswhileMr,Morrison visits the North- ern markets.Mr.and Mrs.Carl Axley andhavereturnedfromMurphy,they spent several days.Miss caret Meroney nied them homeawhilehere. Miss Rachel and will McLelland,who baby whereMar- of Murphy accompa-spend at- tonded the summer school at Chapel Hill,has returned home.Miss Me- Lelland is an tredell girl but herpostoficeisStonyToitandher name was unintentionally omittedfromthelistofIredellfolkswhoat- tended the summer school, Mr.H.H.Yount,Mr.Harold Yount,Sheriff M.P.Alexander and Miss McBride Alexander spent day at Blowing Roch,Miss Mary Lee Lowe burg,Sampson county, Miss Sara Adams.Mr.and Mrs.EF.F. is Sun- of Parkers- visiting Walden ant theirchildrentefclastweekforGaffney,S.C.,where they will make home.Mrs.Laura Claywell of Cedar Keys,Fla.,and Miss Estelle Morri- son have been guests of Miss Maggie Parks. Mies Lusile Kimball and Miss Rachael Kine have gone to Ashevilleforashortstay.Miss Glenn in Thomasville.Mr.W.C.Stikeleather of Mason spent Sunday Char- lotte is sending two weeks with rel- atives in town and county.Mr.E.G.Gaither returned last week from e few days’stay in Fort Mill,8.©.Mrs.Gaither main in Fort Mill for a relatives. willweek with re- Mr.John Walton,Sr.,and Mr.and Mrs.con days in Atlantic City,New and Philadelphia. Mrs.JamesHavesarein Morganton to several weeks. John Walton,Jr.,are spendingYork Wilson and Mrs.FE.M. spend Miss Grace Johnson of Trinity and Miss Blanche Rives of Charlotte,af- ter visiting Mrs.Frank Bryant here,have gone to Stony Point to visit Dr. and Mrs.Crouch.Miss Sallie McAuley of Albemarle and Miss Lila Anderson ofborowereguestsofMrs.C. ander last week. 8. Mrs.Evgene Fesperman andvisitto andleftlastweekHuntersvillechildren Cornelius, Wilkes- Alex- two Char- lotte.Master Joseph Fesperman isvisitinginMooresville.Mrs.J.A.Brady and Mr.William Bradynelly Springs. Mrs.P.B. ier visiting relatives here. ure spending awhile at Con- Hefner has returned to her home in Washington,D.©»af Miss Nora Neill Foard has return- ed from Asheville. Rev.and Mrs.John M.Varner, who spent some weeks with relativeshereandinRowancounty,left yesterdayfortheirhomein Pleasant,Texas.Miss Bugenia Conder of Mount SouthCarelinaistheguestofMissSarahHoward,on Park street.Mrs.Carroll Suther of Washing ton City is visiting her father -in- law,Mr.H.C.Suther,near Barium SpringsMr.and Mrs.Chas.MeCanlesswereinStatesvilleyesterday ing relatives.They save visit- returnedtotheirhomeinAlexandria,Va. Rev.and Mra.8.W. Concord are spending a with friends here.:Mr.Van Buren Jurney will few Haddon of days leave today for a visit to friends at LomaxLittleJackDunavantandMissLouiseDunavantofCharlotteare'guests of Mrs.C.V.Henkel. Miss Ma Thomas and MissEleanorStocker,the latter of Jer- Sta’myn,Pa.,have returned tovillefromavisittoMr.and;Claude Morrison in Charlotte. Bummer Complaint. the het Weather of Duringmonthsislikelytobetroubledbowels, Mra. the summer some member of almost every familyeatwithanuennateanditieofthegrent-treated ¢Aprilbythe7thU.S.cavalry.Candelario in| visit to Mr.and Mrs.C.P.Holland.and Mrs.J.W.Benson and and Mrs.C.P.Holland made aflyingtriptoWinstonlastweekby auto.Mrs.J.D.Hollard has been with her mother,Mrs.Almedia Temple- ‘ervantes,Villa's second in com-|".mand,who was killed at Cruces,Mexico,May 25,by George 0.HulettofthesameorganizationthatRidgewasamember,M.G.Co,170infantrysexehoxn“nequalaQanee or,who ia seroualy MeMr.Teague says that Pancho Vil-Plies Cured in 6 to 14 Daysla’s real name is Francisco Caldvone,|your druggist will refund money if PAZO which translated into English is OINTMENT jails to cure any case of Itching, Frank Caldwell.The father of —the ,Blind,Bleedingor ProtradingPilesin¢:o days. bandit was a North Carolinian,from —_——epotteation GrinsDane ne See,| THE FIRST NATIONAL BANK, Regrets won't bring back the money you have ex- travagantly spent.One sure friend to a man in trouble is MONEY in the bank. /But the man who banks his money is the man who gains theconfidence cf his employer and holds his job.‘ Money in the bank also means CREDIT and CON-|): FIDENCE.No mancan afford not to have the confi- dence of his fellow men. Make OUR bank YOUR bank We pay 4 per cent interest on time deposits. Statesville,N.C. Lineoln county,named Frank Cald-well.The Tar Heel was m Mexicomarailrosdconstructionjobin Statesvile Produce Market. 1870 to 1875 and was supposed to ‘The following prices were paid yesterday have married a Zacatece Indian for produce on the local market:sqvaw named Villa.The result of the =jrriny Chickens.I6e,per ms.union was Franciseo,who according eee oe5 erototheprevailingcustomamongtheMexieanIndians,took the mother’s name.Mr.Teague speaks SpanishmorefluentlythanhedoesEnglish and he has been told this story many times and velieves it.Prohibition is now really in effeet in Mexico,according to Mr.Teague. The new constitution «s being enfore-ed and it is a “bone-dry”one.If a man is found drunk he is ordered totellwhereheprocuredhisbooze;if ~MARKET REPORTS.— Exys,Y4e.per dozen.Guinea Evws,20¢.per dozen Roorters,ie.per Ip. Butter,25e,per Ib.0c.per tb.Green Hides,lée.per tb. Hams,l5c.to 28e.per tb.Sides and Shoulders,Z2e.to 25.per th. New Red Honey,12 1-%e.to lc.per Ib. Sourwood Honey Comb,20e.to lle.per Th.Old Auto Rubber Casing,40.m-'» Irish Potatees (new?$1.50 per bushel. 6Thefollowingprices were paid yesterdayforgrainonthelocalmarket: Wheat,$2.45 per bushel. Rees ar, he fails to inform the authorities he =©'™.#1."per bushel.is shot:if he tells who sold him the °*"*gy ed per bushel.stuff the seller is shet.Somebody on the local market yesterday 25 cents gets shot every time a man gets per pound was paid for best grade cotton. drunk and it is expecced that the Market firm. prohibition law will prove effective.Mr.Teague,while a Mexican.citi-zen for business reasons,ix still an, American at heart and may go NOTICE TO TEACHERS—Teachersattend-ing the Inctitute ean seeure rooms at Miteh- ell College at following rates:$2 per week fe ~room,linen furnished;$3 forte, .~@ .ne F double room.linen furnished;$1 for entire France to firht for demo Fac v>He sal |term if teacher furnishes own linen.PriceincorrespondencewiththeWarDe-|game for less than entire term.Apply to partment,and being a man of adven-MITCHELL COLLEGE.Aug.7.| ture would ‘like very much to get to,¢:aa |WANTED—+the front.tle will arobably be as-.sia Pome st icoaes h asesignedtosomeengineeroutfitthat|‘1 quired.Apply to MISS MINNIE MORRI- will do great work behind the lines|SON.Statesville,N.C Aug.7inFrance.cay {POR RENT—Two-horse farm.See M.P.Mr.Teague pasted a Mexican!BEARD,Cool Spring,N.C.Aug 7 1t®,stamp on the foregoing story,which guarantees its veracity.Brown or sableLOST—smali Collie puppy.;::8 coor,Four white feet.white breast,white(The foregoing is a very interest-|gpot on nove and tip of tai!Return toingstory—very interesting indeed.W.A.BRISTOL for reward,Aug.7 2t. A word here and there,however, seems to indicate that Editor Sam Farabee,who had the story at first hand from the former Alexander cit- izen,entertained some doubts, Which same is a poor return to Mr. Teague,seeing that he gave the Rec- FOR SALE—Fresh milk cow.—J.WA MURDOCK.Statesville.R-!Aug.7 WANTED—White girls to work in dining room at Commercial Hotel Apply to W.8FLOWERS,Mi»Aun.7 -2t° WANTED—Knit LTERit* resville ting Mil Help.We are now or se ne :.operatine u cool,sanitary ord a ever The Landmark)buildine Sireet os every five minutes.| tee gs .Close at i Saturdays,Good wages|In the Amity Country.we Loppers,knitters,loopers,Can steo Correspondence of The Landmark.ab younx women t 4 ane Most ~~ i ve city in the Seutt orty thousand troopsTroutman,R-2,Aug.4 —Mr.J.and many flying machines to be stationed H.Brown,who went to Baltimore here.CHARLOTTE KNITTING COMPA- last week for an operation,came _NY,Charlene.Nt _Ave © back Wednesday to Statesvilleto his Logt—tmbretta,initials “1.D.HW."on golddaughter's,Mrs.Fred.H.Conger.,handle,Finder please return to MRSC.V.tHENKELAus.3 2t.The physicians in Baltimore decided| not to operate.Mr.Brown will pog saLE—one good driving horse,vane come home Monday.and harness,one colt and one mule.Ad- Eleanor,the little daughter of dress BOX is.Staiesyille,NC.or “phone Mr.and Mrs.D.O.Tolbert,while _371 Black.Aug.3-19.% FOR RENT—Eight-room house,modern con- veniences,barn,with four acres of land,one out playing Friday,ran against anieceofmachineryinthebarnyardlandcutherlegseverely.The doctor;Mile east of square.Address BOX 78,was summoned and the wound dress-Statesville.No C.or “phone Ft — ed.The infant son of Mr.and Mrs.Tolbert is also dangerously il).Mrs.FOR RENT—Three rooms for light house-.keeping.Phone 4:6 Rlach July 31.Florence Stikeleather has been con- fined to her bed for several days and FOR SALE—Pive passenger Cadillac “ear,geod is no hetter at this writing.Mr.Wil-condition.Cheap,for each or on time J lie Orbison,who has been sick for .-ime.08 caxt Broad street duly 3severalweeks,is better. Mr.and Mrs.Ernest Goodman are again at Amity after visiting friendsandrelativesinMooresville,ChinaGrove,Charlotte and Olin.They re turn to their home in Kateigh todayLittleSarahLindaandaryNel fatum are visiting their aunt,Mrs. ©.F.Owen. FOR SALE—Ford delivery bedy.See CARLALEXANDERatM.P.Alexander &Bro'.s store duly 27. FOR SALE—Ford car.See CARL ALEX- ANDER «at M.I’.Alexander &Bros store. duly 27%. LAND WANTED—To correspond with any onehavinganywheretheywishto We real estate turn inte quict believe we have :|‘the best cyetem found anywhere for Graveyard leanings.handling quick «:ind wetting the most All interested are asked to mert money.Ne trouble to look yeur property ..S &er es over and give you the benefit of yenrs of it Bethle a church next Friday at experiences in telling you what we thinkternoon,10th,at 1 o’elock,to clean about it We can furnixh the very best ofthegraveyardandchurchgroundreferences,ENGLAND REAL ESTATE All interested in St.Michael's cem AND PUMIIC Atl TIONEERS.|PhoneB44,Greensboro,N.¢uly 31 MteteryareaskedtomeetthereFriday morning to clean the cemeteryGraveyardcleaningat ShadyGrovechurch,Barringer township.Friday,10th.All persons interestedwillpleasecomepreparedtowork. ERRORS IN TAX LIST. In the tax-list in Friday's [and mark 2 “"~the names of W.| ‘Roller Flour Miil For Sale. Two of the firm having died,we offer forsale,privetely,one of the best 100-barrel mills| ta oom of the beet towns in the State.Cor-reapondence solleited TEMPLETON,WIL-LIAMS &CO,Mooresville,N.C. 5 DR.VANCE HASTY, Auw pals.ud Crowson,R,L.Bradford |H.M.Page,C.R.Sharpe,RN DENTAL SURGEON, Brawley,R.BE.Clapp,Mrs.Nora and Rooms 6-7-9,Sceond Floor. Regina rtness,Miss Lina Me Ro FIRST NATIONAL BANK BUILDING,Lloyd Neely,G.G.White,Bradio!qeuarnouk EncAchuamen Knitti i,Caesar Allison,Lila "Phone 197 Hours ®to6. Falls,Mrs.H.C.Cowtes,W.A.Thom SPECIAL ATTENTION TO 34.W.White,Geo,Kilpatric!..a!)whom had paid their tax.' MORE BIG BEETS.i being plentifully|Mr.A.W.Ste-) as,of For safety’s sake it is a good thing tohave on hafd an 3 EXTRA PAIR of glasses.You may break the one pair you |4 have.Maybe you need entirely NEW glasses.: Comein.We will charge you nothing for testing your eyes and only a moderate price for new glasses if you need them. WE KNOW OUR BUSINESS. R.F.HENRY,Jeweler. Good and Cheap Lands in Bladen County Soil that grows corn,cotton,tobacco,wheat,oats,and all kinds of clover and grasses,withagoodclimate.The health and water are asgoodasinNorthCarolina.This land is veryproductive,and easily cultivated.The County1sbuildinganexcellentsystemofsandclay roads now. Writemefora list of my farm and timber lands. J.C.HENLEY,:Real Estate &Insurance. Elizabethtown,N.C, oe a: Only one night MemphistoTexas No missing connections—entire train rans through,MemphistoTexas.Leave Memphis 10:10 p.m.Arrive Dallas 12:17|aext noon,Ft,Worth 2:00 p.m.Another through train to — _—_—_—_—_—_—_--nn INGERSOL DOLLAR WATCH.© War price #1.35.See meif you are inofanykindofaWatch.I can_supplyneed.In stock,Hamilton,South Waltham,Elgin,New York Standard, Reliance.H.B.WOODWARD Se dae Se cineom a - ° 1 e * f r Po .TA aes| in the of the men from thisdnthefirstdrafthaveheaa j counties.In five countiesjisanise,in 95 a smalt i“has issued the fol- lowing notice with reference to the :account of hates made by the provost marshal in gross quota required of the State and on 'nt of clerical errors discovered ty him in the computation of quotas by the office of the director of mili- tary enrollment for Nori:Carolina, i have wired you as follows: “The net quota of coun ty has been changed on account of changes in the quota required of the State by the provost mayshal ener al,and errors found by him in com putation of quotas for the several counties by the director of military enrollment in North Carolina.— county will he required to furnish -men instead «¢men, the net quota heretofore assigned by me.Corrected notice of your quota and letter of explanation being mail- ed to you.’ “L regret thet the necessity for thie change has arisen,It increases the quota to be taken from only five counties in the State.It decrease eorrespondingly all other counties af fected.Upon receipt of the inelosed corrected quota kindly return notice of quota previously sent you,in or- der that I may know that the cor rected figures will be used” ADD aoe ee ee There will be no material changes in the figures per county except in & very few instances:Bladen —will ehange from 111 to 158;fredell from 135 to 144;Pasquotank from 110 fo 121;Pitt from 336 te 359.Buncombe is reduced three and Forsyth two. |REALNPS Battle of Flanders —Russian Situation Improves. Attacks and counter -attacks without material progress on either side characterize the progress of battle of Flanders.The Anglo ‘French troops,however,continue to make gains. In an Offensive operation near Ba- ian,east of Czernow:tz,the Russian< have taken more than 500 prisoners and captured three mackine guns. Here the operations are virtually on Russian soil,as is the fighting just te the north around Chotin,where the retreat has halted measurably. In Bukowina,between the Pruth andtheBystritza,however,the Russians still are fleeing before the Austro- Germans who have taken severalmoretowns.The repulse of a strony Teutonic attack east of Kovel and the carrying out of severar raids on the German lines between Kovel and Chotin indicate that the Russian line here is in better shape to make a stand than that in)Bukowina.The assault in the Kovel region was madebysevencompaniesofinfantryand the Russians drove the attacker back to their trenches, The Russian political situation has become calmer.Premier Keren- sky has withdrawn his resigna- tion and there are continued indica- tions of the strengthening of themoraleoftheRussiannem-es on thesouthwesternfront.With all politi- cal parties behind Premier Kerensky in his effort to selidify in the provisionalgévernment,it will be pos- sible for him to carry out strongermeasuresforthesafe:y of the revo lution.The new head of the armies, General Korniloff,also will be able to use more stringent means in keep ing the Russian soldiers to their du ty. Anti -Draft Disturbances Oklahoma—Two Killed. After a day of comparative quict in the several counties of |central! Oklahoma,which for two days had heen the scene of anti -draft dem onstrations,the situation assumed a graver aspect Sunday night as a result of a reported clash between a band of malcontents and a posse near Holderville,in which one of the objectors to the draft law wassaidtohavebeenkilledandtwoof the posse wounded.One of —the wounded possemen is said to have been carried off a pr-soner by the outlaw band. According to a dispaven from Sa- sakwa,in Seminole county,Okla,the base of operations against the rene- gades,30 of the draft law resisters surrendered,bringing the total now in custedy to about 200.)Except forthefightnearHoldenvilletheonly blondshed in connection with —the disorders ovcurred when Wallace M Cargill,an alleged band leader,wa shot and mortally wounced in an ex chanye of hets with a posse,He died soon afterward For several days ayitators,who resist the draft act,have caused con siderable disturbance in OMfahoma, by borniny railroad bridges and de fving the law.So far they nave heen devlt with by civil officials.No troops have been ealled out. eee recente enecmec Strikers Restrained. Qn the prayer of the Georgia Florida &Alabama Railway Companytomakepermanentthefempora- ry injunction against the four rail road brotherhoods,restraining themfromstrikinyortakingastrikevote on the road Judge W.M.Harrell,at Bainbridge,Ga.,made the injunctio® permanent.The decision was reach ed after four days of legal argument by both sides. The brotherhoods strike if Engineer Strickland, charged for alleged infractions of train rules,was not reinstated,an: if the road refused to pay standardwages. SOLDIERS HOME FOR SUNDAY. A enlisted young men spendngBanlegatithomesherewere=Morrison,Jr.,of the!Coast Artillery,at Charlotte;L.EFDimetteandLonnieMillsofthePiedmontBatteryat pony Nicholsonlexander threatened to dis the cavalry troop at Sue end’ dingsandSpecialCorrespondenceofTheMooresville,Aug.6-Rain Thurs-day evening the entertain- male and =.for the mem-bers of the Piedmont battery untilFridayevening.A cool breeze and real moonlight made the Presbyterian ready oneverysoldierplentyofwatermelon. ramme Was opened with prayer by v.F,A.Barnes.There were sev- eral familiar choruses;vocal solos a Miss Mabel Cocke and Mr.Hug Sloop;vielin solo by Miss Mary Belle Flowers,two songs by a male quar- tette and short speeches by Dr.5. fk rontis,Mr.Z.V.Turlington and Rev. L.A.Fails.Bach number was thor- oughly enjoyed and the soldiers show- ed their appreciation by enthusiastic applause.At the close of the pro- yramme the crowd adjourned to the Pharr lawn near the church more lus-where a hundred or readiness.Ifciousmelonswerein any one failed to eat enough it was due to a limated capacity,for the sup The oldiers explywasplentiful. pressed themselves as delighted with the veeasion and with the generous srood-will and hospitality of the town Young Turbyfill’s Death. William Turbyfill,the young son of Mr.and Mrs,©.M.Turbyfill of Davidson township,died Wednesday of appendicitis.Billy,as he was com- monly known,had many friends here haviny attended the yvraded senool year before last)On account of his unfailing vood humor and gentle na ture,he wae a favorite anion his friends.From childhood he had suf fered from a spinal trouble and his condition made an operation lnpossi- ble when appen:icitis developed.Be sides his parents,he is survived by everal brothers and sisters.Funeral erviees were conducted Friday at MeKendree chapel by Rev.Messrs.J W.Jones and J.T.Ratledye.Before his death Billy was keetily interested in the war and requested that special prayer for the welfare of the soldiers be offered at his funeral.Needles: to say,his request was yranted.And so,though he often sighed because he could not be a real soldier,his friends realize that he was one in every sense of the word.While suffering intense pain and realizing that he could not live,he forgot himself in the interest of others.And who shall say that this is not true heroism”?New Fire Truck. A fire is always exciting,bat in Mooresville formerly the excitement was heightened by speculation as to whether the fire company would sr rive on time.The men were up to the minute,but the fire horse wos some times inclined to balk and required Vigorous persuasion Of course the horse was a record-breaker if it chose to be wnly it)sometimes didn’t However,this is past,for Mooresville has a splendid new fire truck that would do credit to any city.Tt is in stalled in the municipal building,and besides being proud of it the town is relieved to know that when the fire alarm is turned in it will neither have to be coaxed,pulled,pushed or threat ened,while one’s friends rush wildly about in an endeavor to save the in- surance company with water from the spigot in the kitchen.The truck is a Denmo model,full equipped with al! standard apparatus. Piedmont Battery at Work. The Piedmont battery is in)good shape and began real worth in drill practice last week.The tnuense heal tor a few days “yot next”to many of the boys whose idea of work up to th present has been to juggle figures in an office under an electric fan.Bat they're a brave Jot and made litth complaint,drilling patiently in the dusty streets in the hotest part of the day.The officers are highly pleased with the drill work so far.Uniforms have been ordered and are expected to arrive by Wednesday.It is uneertaar when the battery will leave for camp hut the town is hoping that the boy will get to stay at least a week or s« longer,and in view of the way they are being entertained,it’s a safe bet that the boys hope so,too.A readin: room has been fitted up in the armory and a piano installed for the benefit of the musically inclined.As fel low expressed it,“If you went to get the glad hand in this town,introduce vourself as a member of the Died mont battery” Community t air. Phe Community Fair and Good Wal! Itiy will be held here on Wednesday and Thursday,the lotn and Tith ot October Every effort will be put forth to make this oreasion the big it was last yeor and oo little The people of the communi urged to co-operate Iredell col owill produce thing:and)Tredel] Women are not to be surpassed fancy work and cookery.Let the fai prove it. one UCCESs bigrwer tv are Red Cross. A mecting of the Red Cross wa held Friday afternoon in the chamber Several impor¢.of commerce room tunt committees were voppointed —t look after the work,The seciety Warts more members and not only members but workers.The ladir are willing nn engrer to do their bit and the bigper the society the bigyerthebit., Dienic. The speakers for the creamery pic nie at Ouk Ridge Wednesday,Sth will be Mr.G.8.Rubison,assistant direetor of the Farm Extension Serv ice,and Mr.W.F.Clevenger,dairy specialist of Washington,D.©. pienic will be insructive as well as enjoyable and all who will are urged to attend Weddings. Mr.Charlie Knox Morrison andMissNinaMaySmithweremarriedhereSundayafternoonatthehomeofMr.Othe Cledfelter,Rev.W.E.Hel-combe of Southside Baptist churchofficiating.The bride is a daughterofMr.Jim Smith of near Mayhew,Mooresville;|and the groom is a son of Mr.J,8. Morrison,a well known farmer of thecommunity. |A merri of interesttethepeopleotMocreovilleandvicinitytookplace The | Sundayeeeties taeWare ierare,. jaccompanied by Mra,W twosons,returning to 8 y afternoon.Rev.L.A.Thomas and Mesags,J,A. B.Goodman and Watt at- tended the Lutheran con at St.Frieden’s church,near ie,re Friday and Saturday.They report agoodtripandsplendidcropsinthasectionofthecountry.Dr.McLelland’s Call,Lr.W.D.MeLelland has receivedhiscalltoservice.He has been in structed to be ready to at imme diate notice to Fort Ogh wher.he will report.for service th reserve medical corps. Notes. The last issue of the Enterprise carriedanoticestatingthatMr,Arthu: Conner,who lives st No,1 eotten mill, has a 12-year-old boy whom he would like to place in a goed home,M: Conner has only one hand and is wna- ble to support himself and the boy.Mrs.C.R.Parker and three chi! dren of Largo,Texas,are visitinyrelativeshere.Mrs.M.Oumen will leave Tuesday morning for Ejki:to spgnd several weeks with relatives Miss Pinkey Kader returned last wee! from Cullowhee,where she attendedsummerschool.Mr.W.H.Corneliu and daughters,Misses Willie and Ca: lotta,passed through here Sunda: from Statesville,con route to BSeut! Carolina.Miss Mabel Cocke had a her puest last week her college elas mate,Miss Margaret Golden of Atha:ta.Miss Blanche Murdock of State ville is visiting her sister,Mrs.Sta mey Kelley., The Landmark in Demand.One subseriber of Phe Landmar: was out of town the latter part ef th: week.Immediately after dinner Sun day he demanded “the paper”—said/paper being The Lanmark.Th members of the fartriily looked askan™ at each other and began a hurried search.It developed that the pape: had been loaned to a neighbor,which neighbor tad loacc!it to anethe: neighbor,ete,uniil its:final destine thon could not be located.Exeeeding ly wrathy,the wrathy citizen fare’ forth to the Enterprise offiec,but alas’ The Landmark had been berrowed from there also.And then he com meneed a house to house search that resulted in his procuring a copy.of that beloved paper.Having satisfied himself that the news had been pub lished,his wrath subsided ind he clos ed the incident with this remark “Hanged if I don’t lock that paper uy in the safe hereafter cill T wet time t read it.”VERNIE GOODMAN, NEWS OF CURRENT EVENTS Incidents Gathered From All Parts of the Country. King Alexander of Greece,re- ‘contly ealled to the throne to succeed is)father,Constantine,who was forced to abdicate,took the oath of Mice Saturday at Athens. John LL.De Saulles,former United Statex minister to Uruguay, shot and killed at his home at Ros lyn,Long Island,by his divorced wife,whe ‘vas Miss Blanquitta by razuriz of Santiayo,Cuba, Charles Fleischmann,son oof Ju hus Lo Fleischmann,former mayor of Cincinnati,was instantly killed sien the hydro -airplane in which| he was flyiny collapsed in Great} Seuth bay,New York.Harry Witty,! pilot of the machine,was also killed Was ' Danville,Va.,has had near race dashes several times recently and) cunrds have been on duty to prevent nuit-breaks.A crowd of oldiers | eed a negro a few days ape to hrow him into the river on account of some remarks he made,bat he Was rescued, An increase of 30 per cent.in the lumber of candidates to be admitted o the second offieers’reserve train- ing camps opening on Auyust 27, has been ordered by the War Depart- ment Sixteen thousand =were to have been admitted.The number has| heen raised to 20,800,| Five persons were instantly killed| and two others fatally injurcd when i train collided with an automobile| it a railread crossiug at Crossville, Fenn.Four of the five killed in-stontly were women and the two fa tally injured were women.One of he latter died in a short time. The extent of the congressional| “franking privilege”as a burden on) the mails was disclosed as an inei-dent to a House committee's investi-| wation of that opoctal in On ooo; vidual incomes of $15,000 and over,$27,600,000;spirits,$95,-000,000;beer,$12,500,000;wines,$17,000,000;war excess profits,$5,-600,000;bank checks,$2,000,000;floor,or stock,taxes on sugar,cof-fee,tea and cocoa,$6,000,000;total, $527,000,000,The additional levy on incomes ofcorporationsappliesalsotopartnerhips,joint stock companies and as-sociations,including Hite insuranceompanies.normal income tax:increased to 6 per cent.,4 per cent,more than the present law,and 2percent.above the original House ind committee programme,The increased surtaxes fajl entire-»on individuals having i es of»15,000 er above.They range frompercent.on $215,000 incomes to 4 maximum of 33 per cent,on incomes cxcess of $500,000.An additional $1 per gallon tax is npoced on distifed spirits with-iruawn from bond except those used industrial purpusea,increasing tax on distilled beverages to $3.-«per gallon as compared with the resent rate of $1.10.ihe commit- prohibitory tax on grain,mo- es and other ingredients of whis- cy to step further manufacture,al-sos retained,Keer would be taxed $3 per barrel, ouble the present reve.Wines wouldcarVirtuallytrebletheir—present The House levy was only-6 100,000 on wines. The $5,000,000 increase on war ex- profits was added =by minor hes, hanges in the schedule of such tax- providing for a total revenue of 28 600,000,The $2,000,000 addi- nal from bank cheeks would make10,000,000 in all from that souree. ihe committee origiaally planned to ax only checks of #5 or more,but decided to extend the one-cent rate to all cheeks, The new floor,or stock,taxes on sugar,tea,coffee and cocoa,all the ame rate propesed in the new con- mption taxes,are lewed only on \holesalers and retailers —havingryeaccumulatedsupplies. |CANADADtEE The Texas House of Representa- tives is investigating the impeach- ment charges brought ayvainst Gov. Verguoon of Texas. FILLING THEPAIL! More Geod ood Goes Into GarbagePailsThanWouldBeRequiredtoFeedBelgium! TELLS HOW‘WwTheAmerican nation the bestfedpeopleintheworld.and we arc also the vreatest food wasters We throw more rood food vito the varb age pail than would be required to feed Belgium.Stop fillinu the garh- age pail! This great STC ”GARBAGE TO ELIMINATEASTE! waste net wilful. Most of it caused by the ill health of ;some members of the family.Indi |yestion,constipation,Our, ffUssy stomach,werk —kiene bladder trouble,sluepyish liver,ete,are ail- ments that are almost)common to us.En that condition there is very little appetite created,no matter how good the food that placed be fore us. The real solution of |climinatings waste,therefore,is found in keepingthesystemtonedupandthevitalor vans working properly.A)wood ton ie is the proper course.Acid Tron Mineral is tne best tonic to take.Htaidsthedigestiveorgan:to perform properly,creates appetite,purifies the blood,increases weight,bring a healthy color to the skin,strength ans weak Lidneys ound bladder,set the liver to working properly,and tenes up th:whole cyscvem ti yeoner il.Acid Trou Mineral is net a patent medicine.Tt ois obtained trom the only naturel medicinal iron mineral leposit of it kind known to the world,and is free vom aieohol will pnot injure or discolor the teeth. fifty-cent bottle ofBydilutinga A.;M.in four gallons of water acnarges} spectors have tampered with letters |Splendid mineral water may,be hadofCongressmen.They send free of |for use by all the family.Try this postage every day seven ton of |Pecipe,watch the contents of —the matter,.|garbage pail diminish, William Herman Arndt of New!,At all dragiists in b0e,and $1 York State,applying for exemption under the draft act,made affidavit that his sympathies in the war were with Germany and that te wouldikeuparmswithGermanyrather han against that country. was arrested for treason and placed inder $5,000 bond. The war tax with prohibition out-look brought the total of withdraw-als ef whiskey from bonded ware houses during July up te 28 million rallons,three times the normal andhiwherthananymonthfor2% Then het The entire volume of withdrawalswasineastern,middle western and}outhern districts.} When the motor of their airplune|stopped 300 feet above the yround, c Lambert of Welch,W.Va,a student at the West Virginia aviationschoolatBeechBottom,W.Va.,was killed and E.L.Frey,a member of {the British royal flying corps,detail-ed as an instructor at the school,‘who was accompanying Lambert,|oustained injuries which it is beliew- m will sizes. For Sale Ryc.Db.MOORE,N.C,BRADFORD &nape.Laray,N.C.And All GoodDealers,: |{Cc.H.LESTER, ReGisTeReED AkCHITECT, Statesville,N.C.'Phove340Green. 9 ,Styledom’s .length CINCIN ae ee.ee ae eee —<_FOR FALL S=— An extraordinary display of Woolens in full | -——By_—_—- THE GLOBE TAILORING COMPANY —,= Orders taken for immediate or future delivery. SHERRILL-WHITESHOE CO, AUGUST 6TH AND T@TH. Globe Man,Mr.J.P.ALLEN. eer a oe ee drapes ' NATH YOU HAVE TRIED THE REST— NOW USk THE BEST! FOR SALE BY Lazenby-Montgomery Hardware Co. Statesville.N.C. “A SATISFIED CUSTOMER Is THE BEST ADVERTISEMENT"!| We have the itismed customers.| Let us furnish you woth a list)of them. LEONARD PLANO STORE,"NEWSEED BUSINESS Turnip Seed in packages and in bulk.Also a _variety of other garden |and Field Sced, All New. T.N.BROWN. Second Hand Pianos We have a lot of second- hand Pianos that will be sold cheap.Price $85.00 to $225.Callandinspectthem.Andrews Music Store. Everything Musical.108 East Broad Street. Phone 304. SPECIALS__-FOR-PICNIC PARTIES! A nice shipment of pienie Hams,Block CreamCheese,French Sardines, Potted Ham,Vienna Sau-sage,Potted Hash,Chip-Beef,Veal Loaf,ickled Pigs Feet,PorkundBeans,BreakfastSausage,Cooked Brains,Cucumber,Sweet and Mixed Pickles,all kindsofCakereceiveddaily.Phone me your order,Prompt deliveries.Quickservice,J R.Poston’s Grocery. Phone 134. — TAKE NO CHANCES.| to Atlanta, to examine inte the causes of the The expert sent Ga., great fire there May 21 found that “the Atlanta disaster was essentigy a ‘shingfe-reof’?—con- flayration of the familiar type.” A word to the wise is sufficient. See us for a tin roof, STATESVILLE TIN CO.‘Phone 85,114 B.Broad Street. heOTon tine eee semen ment Mae RYE. We want a quantity of SEEDRYE FOR CASH. If you have any bring ittous,and you will get agoodpriceferit. J.K.Morrison Grocery &Produce Company. esaame oma = Battery Inspection Free. We are thoroughlytorechargeBatteries oan tireinstockafulllineofBatteryae- cessories, STATESVILLE MOTOR CO, NOTICE TO CREMTORS, Having qualified as adminietratrix of the extate of tvey Sherrill,decensed,this ia to|notify all persons havin clatms againet sald extate th present them to me on or before daly 6,(918,oF thin notice will be pleaded in bar of their recovery All persons tadebted ite enid estate are required to nake wettloment.JULIA SHERRILI,|RT.Weatherman,Atty.Adminintratrix,}duly 6,1017.* |Having qualified a»executrix of the estatelotM.V.Marable,deceased,thie is to notify all persons heving claims aveinet said eetothemtemeonoFdaly6,1918,oF this notice will be .CHEERWINE PINE SHINGLES! JUNIPER CEDAR SHINGLES! Nails,Ridge ‘alley Tin,Brown and Green Shingle Stains.C.WATKINS,Shingle King of Ire-County.det «a Y our H er,Ab POL OES Arsenot tied from carrying cut your ex- pectations and desires when you have mIN THE BANK. Your Bank Account depends on whatyousave, It is not a matter OF GOOD FORTUNE. Acquire the saving habit while your in- comeis small and it will be casier as your income incregscs to Increase Your Bank Account. Now is the opportune time to open an ,The House of Congress voted wan-imously to accept the conference PO)y.,unlimited benevolence toward Hot on ©:—bme™Te eo wen.| A German subject in the intern-' ment camp at Hot Springs,N.C.) who before the war was an officeronaGermanship,has written ay Washington official conveying thethanksofhimselfanehiscompan-ions for their treatment at the camp.| “I bee to be allowed,”he wrote,’“to exprees my heartiest thanks for Ri At (pest a"administration food ©0M*)\..snd my family and for the trou-The vote was‘ing.Representative McLemore of eee Texas voted present.vote the House subsequently adopted the conference report on On a viva vooa 357tonoth- behalf, ‘LT ulso wish to state that all exception—are exece!Sas oe efforts you undergo in my iei Sak ai“ed with the conditions theacom bill for a food survey by the ied States arranged for us at!t of agriculture and y the major measure.The debate on the corference e-|,.. pert on the food bill the “stimu|1,,,,Springs,and that this humeAtionofproduction.’This bill was)...~cick :ate’7andSs‘passed several wecks in gdvance ef ,Fine at i che spam!ayStatesauthoritiesbetterthaneouldbeex oad f vy py OUTIL excbrows6".any othe y .state:speech from Representative Heflin 7 ei States.oo Lil arranwement wave t t thiofAlabamaattackingpersonsDelaio interests opposing the war legisla-)||re the Oa ar kt tion of the administration,Mr.Hef-|i wks |Pee lin was so bitter in his attacks upon ,,.ye hese a gs\when he declared thattwemembersoftheHouse,Repre-ea Seea ganinetl Uke sentatives Written and Mazon of Mie)°°ae iividh aie?™ -nois,Republicans,that a portion ke ae ae yo ne coe wee his remarks was stricken from the (he Germans ee record.Splines are welt ireated.Re- Representative Heflin accused (0's 2 correspondent wrote the Mr.Britten and Mr.Mason,whe ate h out,of the city,of “strring up eppe- sition te the war and drafi,”say:the Washington ¢erres-|, pondent of the Greensboro News,E The Alabama member : Sicharply members of the S lobatraucted the passage cantrol messure anil BDI,His snecch created considerable "*|"i excitement in the Hows f called to order for refer wr Account with us.:.hould be made comforts ;find that they do as well on Buckeye »bers of Co .Ww “yr os..|y do as well on e 3 Spent {‘a ‘i wie 2 oo *bheoand given enough to eat-Good {style and that they like the Buckeye Hulls better than People’s Loan and Savings Bank while this was against the rules,a a nat Brg |the old style.4ee[pote eee FF :‘CO THE W yACY?Re L ene |eoteas ell alin een ‘Phe letter of the German prisoner e hours ore ing.easy a “MONEY MAKES THE VY AY FASY.:;deg othe r day one —aa \,ut :atify ane oo id a ;.ee —__ing for the next vane at anytime a .:.etaer body.by hi nije tions,held v ;rik ee A ne a -is cannot ec,wet nm at leact thirty minutes.youprefer te a GEO.H.BROWN -President,for 10 days the aientane bill”gad 0)"PES a nee feed thehulls dry,usc only aif as muchby bulkas ofold stylehulls.4 O.L.TURNER -Cashier.Pe woe tke cee ison comm in Germany tell of Book of Mixed Feeds Free _, XK 8t ot the clackers and the traitess of Corer oe Kies,Set only are Gives the right formula for every combination of feeds used in the a amemamne Lied {re f ne “te ‘selection 'metmicatly arve |d South.Tells how rauch to feed for maintenance,for milk,foF fat-“a LL ST ee ref Wold the Kabser have asked h voeriuble meee Viet tening,for work.Desevibes Buckeye Hulls and gives directions for s ane aera _cena a omen”Nnoihier has tried to diseredit a UE <o ke athe using them properly,Send for your copy to the nearest mill,a Ae»ity ei ofore the country S 'He exeuar for us eta .jing :a “Fr ~”A ee ee on le,bat it’s a pity the Pert.k The Buckeye Cotton Oil Co.dem.x 4 4 .4 |‘ule m whe ae the commander-in-incrt oor this German pre Aitonte ——-Genens od Sots Rast $g ‘‘.ae CXINe 2 *+,oe wee ae at 3 éloat *Creer con *we pS hould cend men out upon the ee!hroadeast over Ci a ——a be Nee aeSore A I |voonty .ficht for tne liberty of this .uy \a he ood ee hy ::IL }: Halts Drug Store,to «eve ry man one |ernantry Wold hoi wcatoer nave had ee 1 ak 1 :iodo Anne AAEAA AMER SO A RE Lf.wa mmerwaree+rs _a |a “fh |win change hi weties ?i :ca ten IT I ER eeee en a Simple .|“In the :oa member from F seat -ada l -kealtus PROC OTe PAO OH”EP nan q San:tary }noise ietredsged a bill and it is now ne ‘mae ¢.i “eharud {}wend aod the Germar spe system iA :+fr i ;a |!ABLE TQ ATTACK 4 a ids pe rob pecition st to members A ai 2 7 t :a Safety Razor.bat the selective draft,he Tr wove awaes st >HA SOD y ;] The Ideal Army Razor.thee MO te,otceed ee are 5 -_‘!4 The Feonomical Home Razor.AGM to lexemot ait omen of Geeman ee ;Any day you never know WHEN;5 q n ::le cwut Pe HH ohined |lity in thi :rT 2 éPhe109percentEfficencyRazor,ow one ae ea ae It is stated that their |a Tht .wi kn WHERE ou een pel momet Meee | ‘The Strictly Guaranteed Revor,|that do?Why,ch wand their need”;But you know WHERE you can Ret prompe Oy ;i ne io th eople af a cure relief fron the ils that summer brings. Come and get yours.':re Ge ee a re wen 4 . ©-oT 7 |the Germans.wont fet FoR ms died ime ah Gar PRESCLIYTION DEPARTMENT affords you 7HALLSDRUGSTORE,|.tee Oha 2g Gor PRESCRIVTION DEPARTMENT alfords you 9 >’5 hil hich cpeghs that fact.Is bag mo chlor.Sunpesed Le :VEPISIVO ALI L1On Alt WORLEY ;ee 4SoeTaticdetiietoando.the cele snd nat intentional 2 ut all times,‘ ———ee Sn ete teh od hee POS Sere SVILEE PYIDENCE Pen ‘cet dos “ON THE COTAREt wereamen:mabans 0 yee me a fe hwel celia a YATESVILEE PEOP 4 Leave vour troubles “ON THE §QUARE”! 5 mas wits wh p e ; ‘)fight The Statements of Statesvite bh 2 ;:.THIS BANK [etiommecctc:Btsserectccas f PO!.K GRAY DRUG CO. ‘cr ’ace th ere {avi ome 6 t r SBtroneers, a.Si ‘r who nl to tig 7 ;BCE OEOa MEL VEN OLRM OHO OR ICe ‘ie \pas oie ai Se lettin hina Bont 1to .suid es v ue 'Pi ER ET EE A LS ATL.TT TT, nee .Loo.Naat mad peak the Ve -Is cosentiaiiy an institution for all ‘the people;tia Beition W Mt |a ‘A R j i ? the People.Mt places at the dis-canine WW ee ae UI lryIn Nw’Ad posal of the Farmer and Laboring ountrs ane cee | Manas well as the business man I are Bn lege ee Her A |:a .. every facility that a conservalively won arrest ud an Berkman heer mest,We Are fforaa ‘5 some splendid values IR managed -Gapk may offer.Pu hee el ene ee ee ee Seer ea ea }that clase 4 hein.”ee }weanyl2 Skirts, the oint Mr.He vs a )Sea ! °..~7 \caller o th thers r Th;iMerchants«and Farmers’Bank.onan Th In OF bakes eee ee 7 :!A.B (ty COON ., ,M State »NC.mit ta 1 ae aes .Of Statesville,N.¢oe eee |States."1 tot $1.75 to $2.25,-$1 48. “fhe Haak For Your Savings.”Fe Lah ee wean&‘aan Plot 250 to +3 00,$1.95, save i va t them.ib opposition to the war,te th 1 dot $$25 to 21,58 -2,79. C.«|Tomlin,Pres.IK.Bo Bune iy,Cashier.tents nutt,aid pains Gere :b “i .MAES:’$ .'wre i o 8 ’te cold ome Ctpee an 'thieL.kK.Lazendy,Vice Pd.A.Knox,Assis’t.C.Pek Tipe ai eat Fae oo bale Ga 4 it |birt Wai .rae 'owas at this point that Rejpere i We stil!Wee oly st lLraclive s “rt faistsDIRECTORS.ee on a ce ee ,|:oe Seaford oof |Wascons demman |p do tae Crore de Chine We are C.S:Tomlin.o Ww.S.Pare.that Mr.Heflin’s remarks reflect es me feel better a i Very ann!ti ed out t }j {fe it bie fore I K I een .i.C Gaui }=Hpom his twe colleas ves he e |Prion ae rm oe ,;;"; w WK,batnenuy,»G,Gaither,from th ord The Vous |x a Luin)nar i «~befere Ki..Watt 5 =J.A.Knox.finally ta expuny the latte n simply ask for a kidney ren 4 --i:;\\:W ‘®rob or eo ynere he eu an’are |ree ha Viti PI UTYeOL sae -Tee WV Car We J.L.Stevenson.-J.R.Hill.ieeenuae hn Pebble oe soi Kidney |cn NAA i POISE CUES ees fi ae :a CePre set Line tte voy Mr.Gaither )puree id meer tt ’y Clarence Stimpsen.-Herman Wallace.on of stirtiae up appesitis an ae iy ibsCo.,Props,Buffalo,N.Y, k.TT.Weatherman. Every good citizen at this time should do his share toward strengthéning the Federal Reserve Banking System which our Government has created with itsbilliondollarsofresourcestostandback of its member banks and all their de-positors.You can contribute directly to thestrengthofthissystem,and at the same time secure its protection by depositingyourmoneywithus,since part of everydollaryoudepositwithusgoesdirectlyintothenewsystem,whefe it is alwaysreadyforyouwhenwanted.Thisis a suggestion for prompt action. Member Federal ReserveSystem. STATESVILLE,N.C. Sendfor Booklet,“How Boss it Benefit Me?” .COMMERCIAL NATIONAL BANK. wmdenee of “Phe taNewHope,Ro FLD, acta throwch the Blond or tarrh Cure falls te etre,ond testimen le Sold by Preewinte,he.Halls Pamiiy vee: fats,F.J.CHENEY &CO.,Toledo ng tare ’ ifacturers’Reeord complaininy they were too well treated.The nondent said they had Jaxuries hon were furnished summe who paid high price ant ilso critielzed ['""'they were so particilar abou »Senate who |"!eccommodations that they © of the feed:(2°!to sleep two ina bed.Poss)|j furnishestneaviation[YU report of Juxutic oxaggrerated,The Landmas 1 to think it is.Hf tt houll be di continued.The the selective ‘ } \- and he was ee ring Lo mem-: eReree emme in New Hape Countr:.ereee.|The Brady Printing Co.| are having crowbng:weather Het 4 |(h &FE unshine is making corn loot {!ve Clas tere ” Same of othe threshing he “Has taken over from d hata ;i a big Nal P sotto ee 5 :,{y ,P Allis on thy |orwewesmwmmesHr wee ee eee re reereRte . fhe cociveved wet saved co ‘.Ps i ea ——c ee ee ———ee - Nhe worl but the grass is vs agency for Vas ry Ba 7.‘The right along with the corn.;Ma razines and Book q t .i.5 j A i ESVILLE \littl child of Mi 1 Re i .,4 Halton Williams has he en rit it Publicationsand wants REA TY f INVESTMENT COMPANY ‘f for several days,es.Fi :coer 4 4 \i 4 ,a liams is still quite feeble.Re J ry your orders for sub-.a .j 4 nae Bn a ee scriptions to Maga-Appreciates the very liberal patronage of its F com to have be |ermaneni!y |zines of all kinds.Will as policyholders,_NEW and OLD.4 eMed a °i ;.t '@ s«t «r r .afeCoctr]onder anyhook wanted,||UC office is an openone,and weinvite all_our Soring has ns ended fo fos :‘ustomers ¢t NOS W y eC ‘ustomere ; weeks ahr Alta "Youn ned All Magazines on coun-|to use the same when they so desire.As in the e 4 Chin |i rthe ’aa }.coo avesieachineschooe.aaa ter soon as out,past,we will strive to give the same 4 .C¢«’«i y relat “‘‘+a r 7% in the Tecccteaioe”Mi Red)——a -il I(r Li (‘R A ]ye SER \I¢K i Barker,late of Gaston county t a .Vy s won for this Co ,»of the pact week with heme fol nil Dr.S.W.Hoffmann.tl vt =oe this Ce irre Ros!29g -and thie ‘pact of Gee Guuneer.Gumepathie Paguiten.confidence of over seventeen hundrec patrons, RTO ETee “'‘nk Try ve Omen cre "a mo Tae |“WE INSURE ANYTHING INSURABLE”and PAY ALL country than other wee meet ft '7 esoyohPvegecchesoPPoimmert”Anderson tide.113||HONEST LOSSES IN CASH WITHOUT DISCOUNT. stantly failing to cuge withtoca!wevn li)!Qealdence ‘phone 279—green.‘We willbe glad to have you eall at ouroffice pace gtspA...genal «Tiina atv amma for any information,or telephone No.54 if our conditions und therefere tewstres constit:‘ional |"ae eisSthaebeacWEATHERBOARDINGtyF.J.Cheney &Of,Toledo,Objy a ’ conetitutional ly,is taken internally and »the Meron Sure 2ceeotteetet.Gap Benied 0 .Framing,Composition reward lo offered for any enee that Pal Ca one,two andSend(for cireulonm eonetipation us ‘Cc.WATKINS, JUCKEYEHULLSare realroughageineveryparti- cle.Theyare free of everything hasnovalue asforage.Theyarefreeoflint.Theyarefreeof trash.They are free ofdirtand dust.Whenyoubuy|BUCKEYE .HULLS LINTLESS you are payingfornothing but roughage,and youare your stock nothing that is worthless or injurious.22° like a real feed and are a real feed.Their very appearance will convince you that you should use them. Even if Buckeye Hulis cost as much as old style hulls it would still be to your advantage to use them.Selling at several dollarspeg ton less,they put old style hulls beyond consideration. Other Advantages Sutere Hulls aliow better as-They mix well with other for- similation of other food.age. They are sacked--casy tohandle.Every pound goes farther. They take half the space for 2000 poundsofreal roughageto storage.the ton—not 1500, Mr.S.L.Jones,Jackson,La.,says? “1 havebeen feeding my deiry cows Buckeye Hulls and wkgr ay _Oe Sao aaa a . as MRS.MARY SIMS. service in needed. We do NOTARY PULIC work also.Cordially yours, J.F.CARLTON,-Manager. “THE ADVERTISER ASKS FOR YOUR BUSINERE !«” soe at ap eine eas;OF 60rt +:deineaihid ca re 4 eo ; “7 .9917,‘Officers and _Members of ~:a tredell Blues at 1 Time=SERSION.Their Muster Into the Feder Transacted at Regu.%Serviee. -—Postponement ‘Vhe following ix the muster roll of ss mpany EB,First Infantry,NerthElectionRe-G ::ef thjvolinaNationalGuard,, quested.United States army,mustered into The regular monthly meeting of 'eleral service on the 3d day of Au the board of aldermen was held 1 t - a night at the town:“eontral of Captain,William M.Westmeor First Lieutenar Oscar Kateounin Shelton,Meck!a hile:Seeend Lieutenant,Reher {:. French were appointed a con ue .—_Serjeant veake !Marks this man,He was a to act with a committees of «na to k:Mees Sergeant,0 g -the consider the plucing of as in iN;Supply Sergeant,.’king.but he committed a on West End avenuc,from Hall’tman;me eants,John Har greatest crime in history.Cir- eorner to city limits,said comniittes \Tearere Kilpate °,., w have power ta ave.T ee hall,Willie R ilaaeatd cumstence gave hin power to committee is composed tep,Kenneth SH mould the fate of a nation,and Pig con i.cor ee ha We he sent his people to war—such A number of cits a.a war as as world never iad fore the board ¢:Fiannn 3 \ election t Lt Sept "dts Sat fat known. vote mi ENE ,.|4 j withdrawmatterittot THEATRE /There a ‘:Mr W :|=——-eee .Ly C DA YS ee Thao Tf:Milcan Doll Yc watios.H.face's Villon Davar Spectacle,Civilization, Wesinesy anc.bersday,August 8th and 9th. WS).Prices25e,and50. Strange Animals i NOW ON SALE 4 'i a)—-—({T—— 1S &POSTON'S. 4)INCH FINE|=ISLAND SHEETING. “we {SCI AL :{:NOG *° Staple »l-iand Sheeting known to the itl for Sheets,Pillow Cases and Yours truly, MEL LS &POSTON. one ee ee nee.eame-o~-aoe a emneeatnatpeo-teneeenimee<n a mcm‘MBING.if ee ACE INSTITUTE,T RALEIGH C. |co the Education and Culture of Young Women. mumbing all vy und &ntifie Cour leading to diplomas. lL en-ys Depart nt Bducation for Teachers’ }plomas awarded in Music,Voice,Art and that ’t tonmercinl Course,Domestic Science if REL VI ts all departments,.ty wives special opportunities. ,ndoors and outdoors by athletic direc- mnps on hand.pe .individual development Climate permits W.k.MU NDA Y.er information,write at onee to Your Plumer 114 KB.Bread St Voss MARY OWEN GRAHAM,President. Miea 3 7 |ieee tae ewes +newereremncene ee |FOUNDED 1836 TEGE.IN 1669 Myr :Kila Dried Flooring TRINITY COLLEG Mi h I iH .“9 ~'rik Mrives Out Malaria,Build.Up System "College of Wi ral arte ea cadena1AM,N.C.Bliss Al Ud ceesions come :vaghten Ceiling,Base,Case amd ‘xin cna vrogresive tiles.ie note ToCure a Cot tn One Hey VF s TASTER ON ®out W couipment end lerme faculty at wel 'nterw 'tow,Comfortable,new we ‘®tt .Oka Oleasien!and sctentilTar:aSH BHOMD Quinine 1 o'rhanh wh 14.Bethel Moulding.ensteemne,.Veteas sw ; :pence Por catalowar andmeneyiti+ogee yg :Pa ee >is :¥sane ne BEL DING C.WATKING RUTLDING?~~C WATRING i C.WATKINS.|R.L.FLOWERS. iv RI TEM I T BeSareeThefoodbillpassedthroughthe of Examined.Hast stage of enactment ’at afternoon, 15 of whom in formtheicalexamina-House.esident Wilson's Wither New!rman,Carl siunature makes it law ~—,Daniel Lather Ritch-'Spe vate wes 66 to 7.Steer eaonesingin©tion were Hard ’,Odell oe Henry.wi lis and ,Democrats;Gronna,La- man,William Thomas Colvert,Wil-Follette and Penrose,Republicans.liam Cleveland Lackey,Wiliam’.|mmediately after the final vote onPierceHager,Jay Wice,Vance the control bill the Senate,by a vivaHouston‘We .dames Vander-voce vote,also approved the confer-,Samuel Torrence,Goley West.'cence report on the first administra-45 who passed were:Robert tion food bill,providing for a food Lee Bailey,aa ra Charles |survey and appropriating to stimulate 3,Francis gar ‘Troutman,production.Howard Gregory,Walter Davidson|Prompt appointment of HerbertBrown,Clyde Lee Austin,William Hoover as food administrator andSam.Stevenson immediate operation under the legis-Cversem,lation is expected to follow.In addi-Leroy Cald-tion to its comprehesive provisionsHenry,for control of food,fuel,fertilizer andCharlesSylvanusJohnson,Wiliam farm equipment,the control bill car-Logan Hobbs,Royal Gwaltney Mon-'ries drastic prohibition features.ey,_oo ~Flake Lun-|Thirty days after it is approved it will»Clayton ‘ampbe Fins arks Elliott,Robert Graham!manufacture of distilled beverages ortema,oe a to import dating apietan for sewer. ,’-“age purposes;a the President wionTorrence,Mason ——be empowered to commandeer for9esWashinonie.,"military purposes distilled liquorsSneekteaeSaasesennewheedibondél»venuinte orAul,»)’‘restrict the use of foods in the man-—Frank Brown,—Lioyd El-ufacture of wine and beer. Seni Hu:h Ivey ——-"Del.The final vote in the Senate wasthwa—Th rmon Hl *secured by unanimous agreement tofinger,Nic _Tre _—?.“r-dispose of the bill and after four_,rary routnwmn,womas|days’discussion of the conferenceveretteCash,Clyde i.In addition to the six Sena-.ser rai |peportertCopeland,Silas Javidvon,tors voti ;;uch ieee,denne ors voting against the bill,SenatorCarson,Queen Gore,chairman of the Senate agri- ta te co Bennett,culture committee,and Senator Sher- Those who have failed so far “ne = one ca =a hae they been at liberty te vote theytlWilliamBreeMwouldhavevotedintenegative.ri Wiltam,Tarieraude Mar "te Renate acti virtual on,Seve,sheeepe,‘ludes work of Congress upon theee—)ars ftom Cutt,|administrative food legislative pro-Rankin ‘J eg cchong James.Zramme initiated last May.It putsheareeDeWitthe,eee oe the President's hands for _per- Tanate William Che ae Marca he sonal use or delegation the most thur Vance Overeash Collier oo lat a sl.Mar s .y (ing to many members of ongress, +orneg ceria Rt ita —jmarks the innovation of national So-H.B.Overcash,Carl Vaughan.Alex.|“alte experiment.ander,Coleman Anderson Deal,Jo-|None Has Asked Exemption.seph William Beaver,Thomas Ens-ae .; ley Venoyd 4ill,Alvin Grier Tolbert The commissioner of internal reve-Heaskish Houston Samuel Tomlin,|2Ue has made inquiry cf CollectorWilliamThomas’Nantz,Monroe’“tts with reference to exemptions Pickens,B.D.Kelley James Reu.!from war sevvice to be recommended ben Myers,Henry Peoples,Talma for employes in the internal revenueDeWitteMurray,Dove Blake Wauyth.|Service.So far none of the men un-Grover,Cer Collector Watts’jurisdiction have David|2sked for exemption.About all theCharlesEscarLewis,RoyChurch,Syivester Campbell,anesTuttleBeisch,Walter Eli’Shercill,|division deputies are over the age ofLemuc!Russell Stikeleather,Gar-|the draft.Five men in the collector'slandShoemaker,Hugh Torrence,|office are subject to cxll—D.M.Eth.Milton X Willinms jeridge,John Bell Glover,Horace The above absent ones will have |Stikeleather,Allan Mills and W.R. last opportunity to appear Tuesday,Plott.Mr.Plott has been called and morning at 9 o'clock for examina-|has gone to his home in Heywoodtion.Their failure te do so autoe-;county fer examination.Messrs matically drafts them into the army.|Etheridge and Glove:have applied forAfterthe100calledfortodayare“dmission to the officers’training examined no more will be cailed for,camp at Chattanooga.The numbers examination until the exemption.of Messrs.Mills and Stikeleathe:board has passed on those who have!show up late in the drawing ond theybeenexamined.|will not be called for some time,if atWorthyofespecialnoteamong)oll. those examined yesterday was Char-|Collector Bailey of the Rale'yh di: lie Dobbins,colored,of Union Grove trict seys he will not clzim exenip township.He is 29 years old,has tion for anv of his employes,as hebeenmarried11yearsand11chil-|does not think it prover for ther te dren have been born to him and his,ask exemption solely on the ground wife one set of triplets,one set of that they are in the Federe]service. twins and six consecutively.Fourofthechildrenareliving.Charlie FOR EXTENSION CAMPAIGN. is ready to go to war if his services A number of representative citi- are demanded.jzens of the town met in the Commer- Of the 75 catled for Wednesday cial club rooms last evening and dis-68 appeared,14 of whom failed to)cussed town extension.The —senti-pass the physical examination—-Le-;ment of the meeting wes practical-ander Washington a John ly unanimous for the extension of Moose,Parks Morrow Goforth,Loy;the town limits and @ committee of Arthur Shook,Charles Floyd Nesbit,|(ive waas appointed to inke charge John Edward Coon,Lee Ros Ingle,jof the exmpaign for extension,asGeorgeMonroeProctor,Claude Al-!follows:C.V.Henkel,Thos.N.Melison,Doyte Moysee Smith,Mack|Fiwee,G.Kk.French,W.A.Evans, oe P samen Lloyd |.H.Hoffmann. elchor,Howard Turner Campbell,Charlie Nicholson.ORDERED TO CAMP. The 54 who passed were:Earle CC.)Gen.Wood has directed Troop A Fesperman,James Amos Sharpe,|(the Lincolnton cavalry troop,inJosephPaulCarter,Graham Parks|which a number of Statesville boysAyers,Ortel Landers Mayes,James)ere enlisted),and Company B (Gus Burtor Murdock,Burton Rae Con-|tonia)of the First Nerth Carolina ner,Fayette Ramseur,Burton Rank-|reviment,to proceed te Greenville,S.in,Samuel Gaither Hudspeth,Alex.|‘'.,as an advance guard for the or- Clinton Beaver,Robert Franklin!ganizations that will move into the Milholland,Marion LeVan_Benfield,!encampment there from the twoJohnMeachamGriffin,Floyd Trip-|States. lett Mills,David Edward Stewart,|home stations is not given. Fred.Wilson,John Gaston Pruitt,Malcom Potts,John Henry Nichol-WANT TO BE CITIZENS. son,Lackey Myers,James Owen Frederick Chapman,bern in Moun Woodsides,Sherrill Cloer,Charles!Sorrel,England,Nevember 15,1866 Neil Waugh,Emmett Brown Mor-!and Frank Waterfield,born in Trevor, Lee|North Wales,January 6,1874,bothaaneee Glaspey,Walter urdock,Charlie|paving cutters at Granite Quarry,Martin,Samuel Torrence,Robert)have filed with Deputy Gas aa Walter Brotherton,Hugh Alonzo!Clerk Gill their first papers towardsWallace,William Clyde Current,|becoming American citizens.Carl Chambers,Sherman —Cicero Lambeth,James Franklin Cash,OdelCaldwell,Palmer Alex.Morrow,Walter Clarence Gibson,ThomasionTilley,W —Christopher,Oscar ‘amp-bell,Carl Bloomfiela Riddle,HHermanPope,Clarence Poole Aber-nethy,George Samuel Day,VernonReid.William pare tee, ~y ‘Har “Tate nly,James ersonkey,Hinton B..Louis L 50 called by local exemp- rd for examination Tuesday,14 of whom failed to;ee ‘artr Wi Osear Pierce CampbelThe55whopassed were:JamesFranklinShoemaker,Raymond Bel-mont a.k Honeycutt,Henry Solon ,Ransom As- bury CaMeare ar Orren,DokeStevenson Steele,WilliamMelton Somers,De-|be unlawful to use foodstuffs in the]no The date of departure from!),, ———= STATESVILLE,N,©.,FRIDAY,AUGUST 10,1917. re a “NO.12, DR.ALEXANDER’S ST He Did AdvisetotheeS oetheDraftWrong. Dr.H.Q.Alexander,president of the State Farmers’Union,has sued the following statement in replytocriticismofhispositiononthedraftlaw,the war,etc.: “During the past week ItheeasternpartoftheStateappointmentsinfarmers’mSatumyattentionwascalacriticismintheGreensborobaseduponareportofmyinRowancountyaweekago.InotseenthereportbutgatherthecriticismthatthepersonoutthereportGeanetwewithvisingtheStatetoresistthedraft.“J have not given any such advice,but have been careful to say that Iwouldnotadviseanyonetoresistthedraft,because it is the . right or wrong,just or unjust.ten years I have been 2 joes ofthepenceandam_therefore sworntoobservethelawanduphold=the in ace.“The Statesville Landmark,asquotedinanotherpaper,which IhaveseensincereturninghomelateSaturdaynight,appreciates m sition on this draft law;that I ‘op- posed -the measure if it was meanttosendAmericanstoforeignsoiltofight;that it should apply only incasewewereattackedandthatonlyvolunteersshouldbesentabroad,’Iwouldmodifythatstatementtothisextent:that we should not haveintothiswar;that unty an invasionofourshoreswouldjustifyusingo-ing to war end in that case we would vot need to resort -o conscription;that the patriotism ov Americanmanhoodwouldrallytothedefence of cur homes.“But right or wrong,we are nowinwarandconscriptionhasbeenforceduponus;and while we believeitismorallywrongandunconstitu-tional to draft our boys to fight in aforeigncountry,yet until the law isamendedbyCongressornullifiedbyadecisionoftheSupremeCourt,weshouldallobeyit.In sapport of ourpositiononthisdraftlaw,we needonlytocallattentiontothefactthataconsiderableminorityinbethhousesofCongressopposedit;andmanyofthebestrawyersinthecountrydeclareitunconstitutional, And while the war beosters are try- ing to deceive themselves into be- lieving that ‘the heasts of the people are in this war,’our observation cov- ering a laree portion of the State ismostconvincingthatnine-tenths oftheruralpeopleareemphatically opposed to this draft law for a for- eign war. “The Charlotte Observer saystheypavehedseveralletterscriti- cising my Salisbury address as re-ported.I,too,have received severallettersofapproval.Here is onefromawellknownbusinessmanin the Observer's own town,Charlotte: “Dear Sir:I write this to say to you in reference to your speech at Salisbury Saturday,that I admire you for what you stated in reference to the conscription of men to send them to a foreign counsry.A manwhowillspeakthetrutnasyouhavefoneisworthyoftrust.The spirit you continue to speak the truth,and eventually the truth wit?make the people free.With kindest regards etc.’“This letter was not prompted hypersonalfriendship,as I am not ac quainted with its author.Here another letter from azoiner section of the State.It is one of strong ap- proval.I quote this extract from it as it is teo tong to use in full:‘Tl am now 50 years old and have voted theDemocraticticketsinceTowasold enough and have always been in har- mony with the party until the =ad- ministration’:foreigw pocy was foreed upon the people,regardless of their wishes,and under tne present Where is there a newspaper that conducting a peace propaganda’I! half as much was being done to findequitablebasisofpeaceasisbeindonetopromotewar,the chan: are the war would stop within (""days. “Will not some newspaper start 4 campaign at once to demand thi Congress state at once what w:fighting for,what our peacemandsare,on what terms we =o are willing to make peace?And =the: temand that all other beligerent nx tions do the same at once.Wil!»:some member of Congress introducabillatoncetothateffect? “We have started at a terrific pa: to bankrupt our nation,and,proba bly,to sacrifice millions of the very ick of our young manhood.It ilyfourmonthssincethedeciarationofwarandyetWearealreaclyloadeddownwithasbigadebtasGermanyhasthree many +.fraudulent row he will vaccinate the Iredell)from theENstaandtwo,The vaccination is against street,inlionsofponeeeurren-.fever and para-|wa»,While the at war,|t those no have hot peeteee andcludingourown,ape inter-‘heen vaccinatedwill be.! of God must be working in you.Mav| pied by the Western ————__—_——_ ‘CONSERVATION THE TOPIC ‘Things Discussed at the Farm- ers’Institute Yesterday. |An interested but rather smalllerowdattendedtheFarmers’Insti-tute held at the State Farm yester- day.A joint meeting of the ladiesandgentlemenwasheldatthepa-vilion in the morning.Miss Lizzie Roddick,domestic seience dermon-)Strator for Forsyth ao spoke on the subject of a community fair for the county,Miss Roddick had no-iced that Iredell was specially inter-ested in a joint commencement for‘the schools of the county and urgedthatIredellhavethisfallatleastthreecommunityfairs.The |Department wives $20 to be used as‘premiums at these fairs,which have-&two-fold advantage —they edu-|jnconscriptedmenofourcateandtheygetthepeopleofthe!the results of advers>weather con-jecmmunity t r.|Mrs.John 8.Cunningham of theStateinsurancedepartment,spokeandconservationwasthekeynoteof ther addréss.She urged carefulnessinthehandlingoftheconveniences jof life —ma .ps,etc.—to‘curtail the fire waste,which amount-ed to between three and four mil- lions of dollars each year.Conservation was @ the keynoteloftheaddressbyProf.C.L.New-man of Raleigh,Soil Cnservation, ithe prevention of soit toss and the[prevention of plant food loss,werethethingsProf.Newman urged.The unusual times call for the utili-zation of the soil ane all it contains. |The average farmer rarely secures25percent.of the vegetables thatjheshouldfromhishomegarden, |The average gardener is intensely\interested in his garden in the spring jof the year,and then forgets his fall ‘garden,his winter garden and the early spring garden.Mr.Newman iurged the saving of seed by thejhomegardener.Seed may be diffi- cult to secure next year.At any irate,where plants grow well they |reproduce well.Prof.Newman ex-|plained the process of the selectionjundpreservationofd¥frerent seed.Following Mr.Newman's talk Mr,;Karl Davis of the Iredell Ice and Fu-‘el Company,presented to the farm-(ers a plan of his company for thejeuringoffreshmeat.Mr.Davis’leompany proposes to take the fresh- ‘ly killed meat,killed in the carly au-!tumn,or at any season of the year,and cure it at a small cost to the |owner..Supt.Meacham of the Iredell Test‘Farm,then announced the dinner hour,urging the entire company to make themselves comfortable on the premises. After the noon recess,the men met at the pavilion while the ladies assembled under an arbor onlawn.Mrs.Cunningham addressed Babies.”Miss Celeste rrenkel spoke of food conservation and club work, Dr.G.A.Roberts of Raleigh talk-ed to the men on the subject,“Ani-mal Production.”Mr.Newman spoke of “Soils.” ||Misses Matilda and Martha Stein- i'metz and Miss Catherine Whitten of|Raleigh were in Statesville accom- }panying Dr.Roberts.The party will‘take an automobile trip through |western North Carolina before —re- turning to Raleigh Treat For the Cavalrymen. State| the! the ladies on the subject of “Better | A RECORD CROP OF CORN. Also of Potatees and Other Things—Wheat Crop Short, A corn crop surpassing any evergrownbefore;a reduction in wheatprospects,due to damage to the spring wheat crop,and record crops of bar- ley,rye,white and sweet potatoes,tobaceo and hay are forecast today in|the August 1 erop report of the De-|partment of Agriculture. |Corn production is placed at 3,191,-|000,000 bushels,an increase of 67,- |900,000 bushels over the July forecast j and 68,000,000bushels above the ree- }ord crop of 1912.The showing is due to vast improvement in the grow-ing corn in Iiinois,Indiana,lowa andMissouri. Spring wheat production,forecastulyat276,000,000 bushels,shows ditions.The prospects are put at 236,019,000 bushels,a drop of about 40,000,000 bushels from the July 1 report. Winter wheat,however,is turning out better than previously forecast,with a forecast tota:of 417,000,000,or 15,000,000 bushels more than in-dicated from July conditions.Thecombinedyieldofwinterandspringwheat,therefore,shows a reduction of 25,000,000 bushels from the produe-tion forecast in July.The crop fore- cast from August 1 conditions,avill beonly653,000,000,or 13,000,000 bush-els more than harvested Inst year.Potatoes are expected to yield 467,-000,000 bushels,or 15,000,000 bushels more than the forecast from July con- than the record erop of 1912.Sweetpotatoesalsowillbearecord,with86,400,000 bushels. There will be an enormous crop oftobaceo,almost 120,000,000 pounds|larger then the record production oflastyear.The buckwheat crop willbethelargestin|many years and oats will come close to equaling the record made in 1915. CAN'T CALL OFF ELECTION Aldermen Have No PowerPreventCityExtensionElec-tion —Roard Favors CityExtensionandMilkandMeatInspection. At a special meeting of the boardofaldermenWednesdayevening,theopinionofthecityattorneywithref-erence to the town extension election,‘which had been requested by the|board,was read.The attorney,Mr.Dorman Thompson,advised that theboardhadnopowertocallofforpostponethe—election.Thetheboard,all the memberswentonrecordinfavorof|tion and for town extension.Dr.Roberts,State veterinarian,inStatesvillewiththeFarmers’Insti-tute party,came before the boardbyinvitationofMayorBristoland|Dr.Roberts and Dr.Cruse gave theboardvaluableinformationaboutanabattoirorcentralslaughterpenandmilk—At the conclusionofthetalkbytheveterinarianstheboardexpresseditselfunanimously1favorofacentra?slaughter nandathoroughinspectionofmilk.In his opinion with reference tothecityextensionelection,City At-torney Thompson quoted the firstsectionofthelawtoshowthatitis elec- mandatory on the board to call the|A party of Statesville people,/election.“The language.”he says,friends and relatives of Statesville|“leaves nothing to the discretion of;members of the Lincolnton cavalry|the ,aldermen.”Had they refused to|troop,will go to Lincolnton today.te spend a day with the Statesville cav-alrymen.Twelve automobiles haveis,been provided for mothers and other rplatives and friends of the boys hav-ing no conveyance.The party willleavetheCarolinaMotorCompanyat18o’elock this morning.Twenty-six|boxes of picnic lunch have been pro-|vided.Ice cream and watermelons ;will be procured at Newton The party will spend the day picnicing inLineolntonwiththeStatesvilleboys Any friends who desire to vo are in-vited to attend,each person to fur-order of things I do honestly think |nish lunch for themselves and.one onditions are enough to provoke!other.Mr.J.M.Deaton,Mrs.H.P.pen revolt.I do not believe there)Grier,Misses Sara Adams,Louise one man out of 25 in my count’!Sherrill,Mary Bettie feild,FaythetisinsympathywithourPreStearnsandothershavebeenmem-lent,regardless of party affiliation.”pers of a committer RiRnTiniithencr There are a half dozen other|tertainment,which will doubtless beterssimilarincharacterandfrommuchappreciatedbytheStatesville lifferent sections of the State,A!hays in Lincolnton.Fifteen dollars|>!these letters are evidently writte”was left of the amount subscribed.to intelligent,thinking men.To me:furnish a picnic supper for the [redell tion these letters only to offset the Byes,This money will be used for] statement by the Charlotte Observ«the purchase of the ice cream andthattheyhadseverallettersofcri:watermelo:for the!hove in Linealicismofmyaddressasreportedon22eee ‘Why is it that not an officia!°ee a voice is heard in favor of pen Vaeating For Western Union. Mr.W.W.Foushee has moved hisstockofmusicalinstrumentsfrom the store building on Center street, near the postoffice,to the buildingonBroadstreetbelowBarron& Conner's stere.He will keep his stock stored until he finds a suitable store building.Mr.A.E.Frye,who formerly operated a shoe repair shop in the rear of the Center =street building,has moved his shop to rooms over N.Harrison's clothing store.The building on Center street is being remodeled and will be oecu- Union Tele- graph office Vaccinating the Soldiers. Capt.R.A.Campbell arrived yes-terday from Rutherfordton and spentafewhourshere.He left in the af-ternoon for Winston -Salem =andMountAiry,where he will vaccinatethelocalmilitarycompaniesthatareduringmembersoftheFirstRegiment.Heonyof~.But Ger-|will return here tonight and tomor-|bruised call the election in tne first instance,they could have been compelled to dosobymandamus.faving perform-ed a duty,in calling the election,that was mandatory,that was im-posed upon them by statute,it fol-lows that the board has no power topreventtheelectionbeingheld. |Testaments For Soldiers— 1 Church Services. Rev.L.D.Thompron went to Lin- colnton this week to join his family, who have been there for several weeks.Mr.Thompson will return in time to conduct services at Broad 'Street church Sunday morning |The union service ‘at Broad Street lchurech Sunday evening will be a «px cial service for the Iredell Blues,1 Raynal will preach jand a pocket especially to them Testament will be preentedtoeachmemberofthecompa-iny A special meeting will Hebron church Sunday j cordially invited. .Mrs.M.F.P.Troutman,delegatefromtheWoman's Missionary soci- ety of St.John's Lutheran church,and Miss Pauline Holler,a delegate|from the Children's Missionary so- jclety of that church,attenced a con- |fere nee of the Lutheran ‘rennessee(Synod at Lutheran Chapef,near Gastonia Another Prisoner Escapes. |Robert Steele,a young negro,es-lcaped from the county jail some time Monday night.He has not been ap- prehended,Steele,who had beenplacedinjailMondayunderbondfor his appearance at next term of court jto anawer for a petty m@:sdemeanor, jleaving his supper untouched,made j his exit from jail by tne window ;of the cell from which prisoners re-|cently escaned.The door to the cell|was thought to be locked;but the‘negro leaving his own cell entered‘the other and left through the win- — |Severely Bruised By Fall. Mr.Walter Roth waswhen on hegin at E verybody | | ditions and 47,000,000 bushels mere)has |J it,| ascement.‘ Ww heBristol CourtMr.Roth|was.work Z car” made up his DRIEF ITEMS LOCAL NEWS —The Sunday school pienic at Har-mony is tomorrow instead of Wednes-day,as stated in Tuesday's Landmark. —A play,“The Red Acre »will be given by local talent atacademybuildingatHarmonymorrownight. to- ~The Junior Order councils'Oak Forest and CoolhaveajointicatThursday,16th.Public invil —dJim Byers,a negro convict -food 06she Somme se lemeanor,esca rromTuesdaynight.He returnedanemorninginimeto go to work, —Mr.and Mrs.i.§ond tomily of Graton andmembersoftheOvercashIredellattendedthereunion theOvercashfamilyatEnochvilleyes-terday. — i zF in that —Mr,Frank A sonMrs.W.E.Anderson ofwhorecentlyenlistedwith theArtilleryinthephysicalwas —Mention wasMr.Landmark of :M. K.Overcash,whobeeofmathematics in lege,Newton,for two years,signed that ~|member of the fi ofCollege.Mr.Davidson twoyearsago. One Day’s Session of Court—Appointed. yesterday here,heari ions in a few .|peagias motigns Court “tutingcasesameeaweredasaofa udge Cline spent ville vs.T.F.against asjonnote,with interest from Decem- ber 1,1915,Mooresville Loan &,Co.va.recovers Be W.Sterne; |Ludie Linebeaier vs.Francis Line-'beaier,action for divorce;divoreegranted.Lon Spann vs.Mag.Spann,actionfordivorce;divorceElizakertW;:and R.D. Watts v¢.Harrison|Miller;judgment for Brown D.-_A.>were appointee rece|take charge of all property de- fendant and to hold samesubject toorderofthecourt.a)TWO WEDDINGS. Miss Laura Bingham and Mr,J. W.Jchnston,a merchant ofman,were married lastbm at &..80 at the home of Mr.Mrs.C,Lewis,brother-in-law and of the bride,in northRev.Dr.Ware performed the cer-emony.The marriage was a sur- prise.Mr.and Mrs,JohnstonforTroutmanimmediatelyafterceremony.Mrs.Samuel E.Lintonthemarriageofherda '.Mins|Lottie Linton,to Mr.=4'Stewart,whi@h took pi fednes-|day at her home in Raretgh.Mr.-|Mrs.Stewart will be at homeBlewettFalls,Pee Dee,after Au-|gust '5th.Mrs.Stewart neferaltermsandiswellknown " 'Will Be Published Tuesday. The list of contributors to the RedCrossfund,which is ready for pub- lication,could net be handled for lack of space in The Landmark,'t will be published m next issue. It is proper to say,in behalf of the jladies who have this work inthatanumberofthingshave‘the delay in publication,but thejchiefreasonwasthatanumberwho|subseribed delayed payment of theirsubscriptions.Some have not_paid,but the list will be pu|Tuesday without the names of subscribers, |Dr.Summers Dead. Dr.J.A.Summers,a native of Ire-|dell county,died Saturday —Johnson City,Tenn.,and was ,at Mooresburg,Tenn.Dr.Summers,who had been a practicing physician, |was 69 years al as is survivedhiswifeandfiveorsixchildren. ‘was a brother of Mrs.M.L,Hall ofStatesvilleandofthelateHenrySummersofShilohtownship. MISS HILL TO GO TO FPRARNCE. Miss Elizabeth Hill ofia.poor yewdl&Dr.Bren pital unit w expects to seeiveinFranceatanearlydate.Hill ic a sister of Mr.J.BR.Statesville and aandMrs.R.R.Hill township.She has been aDr.Brenizer’s Sanatorium if lotte.|SOCIALSESSIONS. eywy railway,&.C.,He was sitting onacross-tie when the train of Cleveland countythemselvestolook on of their brother go to the war and to to them a third of their the practice. .Furr has resignedSt.Paul'sCharlotte,his resignation toOctober1.He succeeded i. i |i as i .Raynal to tne pas:orate of|He lived in treceli at one .8.D.MeAbee,a preacher ofValdese,was made to leave the messfallofCompanyA,Hickory,becauseent@edandexpressedcontemptforsoldiersandwaringeneral.Sol-diers followed him to Brookford andmadehimleavethere. Henry Lewis,colored,wanted incountyforthemurder,lastFebruaryatEastSpencer,of HenryEsterminger,was arrested at Pitts-Pa.,and was brought to Salic-y.He jumped from thetrainatHarrisburgbutwasrecap-tured. John C.Reister,47 years old,at one time a resident of Newton,com- mitted suicide in a hotel at San An-tonio,Texas.At one time he wastelegraphoperatoratCatawba.His wife,mother and several sisters sur-vive.One sister,Mrs.«.‘T.White,lives et Newton and one,Mrs.W.D.Ballard,at Gastonia. War Draft Will Cost Millions. Secretary of War Baker has sent to the House of Congress an estimate of $8,660,480 for the expenses ofdraftingthenewnationalarmy.Theryadvisesthat$2,658,415 has already been appropreatec,and ap- proximately $6,000,000 additional isneededtodefraythecostofregis- tering 10,000,000 men and draftingthemorethan1,000,000 for service._The unit cost for drafting each ofthe1,187,000 men of tne nat:onal ar- my,according to Secrezary Baker,is$7.29.He thinks this is cheaperthananyothersystem.“On a tentative estimate that the generous system of exemptions and Wischarges will result in the necessi- ty for examining four registrants to produce one soldier,said the Secre-tary,“it is apparent that the system must be capable of examining some 5,000,000 persons during the year.For this task the organization —re- quires a personnel of over 18,000 persons.” Secretary Baker explained that 1 number of persons utilized in the draft process serve without pay,but there must be provision made forthepayofrumerousassts:ants.He adds:‘When the boards are not in oper-ation the cost of the system is prac- tically negliible.Therefore the costofinductingonemurmtomilitary service will not vary greatly witthenumberofmenraised.The unit cost is computed at $7.20 and the es-timate shows that this is less than one-half the cost of indurting men under any other system that has vet been devised.” Money in Circulation $16.53 Per Capita. Money in circulation in the Unit_ed States,the Treasury Department’s circulation statement shows,reached a new record August 1.Thetotalonthatdatewas$4,852,094.-469,an increase of neariy 23 pereent.within a year.This includes gold,silver and all forms of curren-ey,but does not incluce money the Treasury,which would bring thetotalupto$5,513,392,894. per capita circulation August1was$46.53.Within a year the per capita circulation has shown the Phenomenal increase of $7.53,yrea er than during any other <imilar pe-riod of time. The amount of gold in the Treas- ury and in circulation was $3,086, 218,498,an increase of $586,000,000withintheyear,and of approximately$1,300,000,000 since the European war started. Value of Last Cotton Crop. The total value of this cotton crop,including the seed,for the trade year ended July 31,last,was $1,412,860,035,as against $958,- 200,000 a year ago,according to the detailed annual report of SecretaryH.G.Hester,of the New OrleansCottonExchange,made public Tues-day.Prices paid for this year's crop,mentioned,were the highest forthelast47years The average price per pound for middling fo:the year just closed,he puts at 18.41 cents,compared to 11.- 99 last year;7.89 year befere last and 13.49 in 1913-'14 The averagecommercialvalueperbaleofthisyear's was $94.82. Farmer Candidate Won. Westmoreland Davis of Loudoncounty,who ran as a “farmers’candidateinTuesday's Virginia Demo- cratic primary election forStateoffices,was nominated for Gov- ¥,estimated on returns,to be.2 of the op- t support of+Saloon and the iv country’s Presbyterian , i)nt s.Hobbs,burial ex-Mrs.Sarah L.London,Xonfederate soldier,$20;.A.Foster,burial expenses ofHenryC.Foster,Cenfederate sol-dier,$20;the Harris Company, work,$46.92;Crawford -Bunch Fur-niture Company,pauper coffin andcoffinandrobefor:inmate of countyhome,$11.56;City’Flour Milling Ce.,supplies,$30;“Statesville GroceryCo.,$24.21;Statesville Drug Co.,drugs,$10.80;C.Watkins,lumber,$4.28;D.J.Kimball,ow plies,$$5.-60;C.E.Ritehie,work,$79.15; La- zenby -Montgomery Hardware Co., supplies,$16.45;Smitn &Brown, supplies,$128.49;Sherrill &Reece,supplies,$20;Presbyterian Orphans’ Home,¢lectric power,$10.24;M.P.Alexander &Bro.,2 kegs,$1.50;Ire-dell Telephone Co.,telephone service, $4;W.E.Munday,work,$3.25, Ordered,that Moltie Goble be senttocountyhome,to be delivered with- out cost to the county;that Jule Hallbegiventemporaryrelief,$5;that ‘hairman of board look into matter of ‘property belonging to inmates; that John Bridges ~e siven tempo- rary relief,$3.Court House--H.C Cook,janitor, $45;M.P.Alexander,sheriff,post- age and ‘phone message,839.73; Home Electric Co.,work,85c.;J.A. Hartness,clerk of court,postage, 82.50;The Falconer Company,sup- plies,clerk of court's office,$3.60; City Electrie Light and Power De- partment,lights,$28.74;City Water Department,water,$24.80;Imperial Brush Company,supplies,$5.08; Brady Printing Company,supplies register’s office,sheriff's office,clerk ef court's office,$84.15; Statesyille Printing Company,supplies,sher iff’s office,clerk of court's office, treasurer's office,$22.05;Iredell Ice and Fuel Company,85;PD.T.Morri- son.renairs,$1.50;W.EE.Munday, work,$2. Jail O.L.Woodsides,jailer, $98.44;City Electric sagt and Pow- er Department,lights,$7.94;City Water Department,water, STS.15; Statesville Drug Company,drugs, $3.55. Miscellaneous —f.T.McRae,re- bate on poll tax for 1916,$3;J.N Alexander,charged with poll tax by error,$3;ordered,that T.T.McRae and Frank Bridges be exempt from poll tax until revoked hy commis- sioners;E.P.Sprinnte,rebate on poll tax,83;J.L.Deaton,rebate on real estate,$7.63;J.C.Hawn,rebate on personal property,66c.;W.M. Ramsey,listing taxes,$142.50:R.E Hill,listing taxes,$27.57;J.R.Joy- ner,listing taxes,$36.18;T.L.Ad- ams,listing taxes,$29.88:Mrs.Ma- ry Sims,hat for Lena Gaither,in- mate State Hospital,Goidsporo,50c.;State Hospital,Geldsboro,expenses f James Summers,£21.40;J.© Williams,conveying Mrs.J.C.Wil- liams to Morganton Hospital,87.32: O.L.Woodsides,bringing insane persons to jail,$10.50;W.G.Good- man,taking grand jury to chain vang,$4;C.A.Brady,taking grand jury to county home,£1.50;Cafe Carolina,feeding jurors,$17;J.A. Gunn,summoning five witnesses ’ Enos Roseboro case.$1.50;N.G Sloan,judge of election,June and November,$4:Dr.Ross McElwee, ‘ounty physician,June and =July, $100;Miss Celeste Henkel,countydemonstrationwork,$24.47;L.© Caldwell,attorney,professional! services,$lz;Western Union Tele- graph Company,telegram,62c.;The Landmark,acvertisiig notice to tax- payers,etc.,$13.10;Statesville Ser tinel,printing court calendar,adver- tising tax notice,$21.50;Statesville Drug Company,druya,$4.75. It was ordered that J.E fovd, thairman,and C.S.Tomlin repre- sent the Iredell board of county com Missioners at a meeting of the board in Wilson. The following were ordered paid commissioners: Barver Bros 3,WoT Baity shire 830.95,J Sennett &',D Brady $15,M hills county roads the grood by 84.07,L.T $18.75,J.©.Brook E.Boyd $125,Henry A.Beam $20,©.A A.Current $8.25,F Fo Cravin 8853,City Flour Milling Company $14,A.F.Cravin $37,M. Bk.Cranfield 75e.,J.Campbell $4.- 63,Dettz &Patterson $12.94, Erwin $19.09,T.LL.Erwin 81.65, John D.Foard $25.48,Thomas Gray $16.50,Sanford Gross 888.50,R.F Gwaltney $5,H.G.Goedin $4.80 Harness,Vehicle &Supply Co.$15.- 25,LL.W.Hicks &$57.59,Harris @ Linker $18,J.C.Horn $5.53,W.H. Hartsell $169.20,W.H.Hartsel! $124.35,CC.Hartness $262.73,Hol land Bros.$15,8S.H.Houston $25,N Hussey 89.30,Iredell Hardware Co $31.74,Iredell Feed store $179.90, Iredell Telephone Company &5,Ire-dell Feed store $96.59,C.EK.Jones $177.15,C.FE.Jones $186.71,D.F. Jenkins $10,W.C.Johnston &Co.$15.56,€.Jarvis $29.41,D.F.Jenk-ins $15,R.C.Kyles $1.50,P.B.Ken- nedy $52.81,Lazenby -MontgomeryHardwareCo.$50.34,L.CC.Myers$8.02,H.M.Morrison $80,W.A. Massey $12.55,C.L.Murdock $98.-50,C.L.Murdock $96.18,J.K.Mor-rison $789.60,E.A.Matheson $3.12,Mooresville Furniture Co.$28.80,W. H.Moore $11,W M Neel &Co. $222.48,J.F.Pharr $18.75,G.C.Putman $17,W.A.Renegar $7.92, Reid Mardware Co.$35.91,E.L.Ruf- ty $16.50,J.W.Reavis $16.44,Statesville Lumber Co. Brawley E Grocery Co.$8.80,T.M.Snow $20,Southern Express Co.$1.40,B.P.Smith $11,J.L.and Reid Sherrill ‘‘stantly the soreness diseppears $32.61,)Stimpson &Steele $7.50,Statesville! and which attractedterestthroughoutthis seetion of the State,owing to the ofthevictim,as well as the factaagewasinvolved, |From time to time Governor Bick- ett has reprieved Dr.Summers,usu- ally for a neriod of ninety days at the time.The official reasons for the eom-mutation of Dr.Summers follow:“1Upon a petition signed by allthejurorssayingtheyoethey made a mistake in returning a ver- lict of guilty;2—Upen a letter fromHon.M.H.Justice,who tried theicase,saying that in view of the at- titude of the jury and certain new vidence he would recommend a par- don;3—Upon affidavit of a new wit-ness,who testifies that on the eve-ning of the alleged ayortion he sawthewomanknockingatthedoorofthedefendant's office,her appear- ance indieating that she was suffer-‘ng great pain;4-—Upen a lar number of personal levers stgned physicians of character and promi- nence and upon a petition signed by.very large number of erttzens of Mecklenburg.” Continuiny,the reasens state that three of the jurors who signed the etition have since advised by letter 1 wire that they did so not because they think the defendant is not guil- vy,but because they thought the pe- ition simply meant that the sentence of the defendant was to be lightened; and one writes that he signed be- cause he thought the license the de- ndart had to practice medicine hadbeentakenawavfromhimandthatthiswouldbeproperandsuffleient punishment. “Ararnst this pardon numerous by officers of th lawyers.The application for a protests are filed law,physicians and chief of police”of Charlotte,the city physician and others protest against pardon =and the solicitor of the distric:appeared before me in person an®mace an ar- cument ageins’granting a pardon. “Upon the facts before me I find no sufficient justifleation for disturb- ing the verdict of the fury,but in jew of the petition of the jury which I interpret in its entirety,as vcing a petition for leniency,rather than an absolute pardon,and upon the recommendation of the just and ‘earned judee who tried the case, and view of the age and health of he defendant,I think the purposes of othe would be carried out i” this ec:by commuting the sentence f th surt to the payment of a fine and with the further cor that the defengant must not vetice nor cffer to @ractice med cine with or without eompensatio: in North Carolina for a period« years ‘rom this commutation.’ AEAOA NeeAER NET MRS,VANDERBILT HOSTESS TO THE SOLDIERS. Mrs.Geo.Vanderbilt was hostes- Wednesday afternoon,io hundred of the troops mobilized a! Asheville and the First)|regimen: band,entertaining them at Biltmors villace,Notwithstanding a downpour of rain came soon at the troons arrived,the event was continued after the shower had pass d.There were prize drills and other contests,Mrs.Vanderbilt the prizes.A large number of ‘ators were present. law se of S100 jitwor nree sever! LEAS \ ter present poe graph Co.82.97,W.F.Walker 1 50,Melvin Williams %6.50,J West $34.04,R.W.Zeiselr The above expenses =included ries,materials,machinery,supplerdincidentalexpenses. WONDERFUL STUFF! LIFT OUT YOUR CORNS| Apply a Few Drops,Then Lift Corrs or Calluses Off With Fingers—No Pain. No humbug!Any corn,whether hard,soft or between the toes.wil loosen right up and lift eut,wither a particles of pain or soreness This drug is called freezone and is a compound ‘of ether diseovere.!by a Cincinnati man, Ask at any drug store for 2 bottle of freezone,which wil! but a trifle,but is sufficient to one’s feet of every corn or cal!Put a few drops directly upon eny tender,aching corn or callus.In- and malicost rid shortly the corn or callus will loosen, and can be lifted off with the fince: This drug freezone doesn’t eat out the corns or calluses,but shrivel. them without even irritating the sur rounding ckin.Just think!No pain at all;no ness or smarting when applying it orafterwards.If your druggis's don't have freezone have him order it for vou. Barium Springs Water. Will relieve when drugs fail—Stomach,Kidney =and BladderTrouble,Rheumatism,Eczema =and other Skin diseases.‘Phone WA.EVANS and the POLK GRAYDRUGCO.erento ~FOR SALE. Two high-class farma of 2600 serves cach,in healthful communities;geed residences and allnecessaryouthuildings;fine shade trees Most excellently adnpted to all crop::accessible tomarkets;mail:dnily,One hax wraded topsoilhighwayofnearlyamilewithownershiponbothcides;about 100 were in cultivation,in. cluding pasture,remainder woodland:new4-roem tenant house and bernOtheraleeontapeohread “OTe. about half in ‘t }i | } { That'sthe beauty ofthe New Perfection.You'reneverdelayedandennapenetesfy8“dowie.The Perfectionis as promptasit is ient.Does everything a coal stove will do,and costs no more. A quick boil or a simmer,just as you like.two million five hundred thousand homes. The visible flame stays put—no need to Ask your dealer to show you the reversible watch it,reservoir—a new and exclusive foature.No waste while not cooking.It keepe the ALADDIN SECURITY OIL kitchen cool.for best results—alwaye clean and clear-New Perfections are now serving over burning. STANDARD OIL COMPANY(New Jersey)Washington,D.G BALTIMORE Charlette,N.C,Norfolk.Va.t fey Charleston,W.Va.Richmond,Va.:Charleston,8.C. Many people suffer the tortures of |4lamemusclesandstiffenedjointsbecause|os? of impurities in the blood,and each suc- ceeding attack seems more acute until | rheumatism has invaded thewhole system.|| To arrest rheumatism it is quite as im-| portant toimprove your general healthas 4 to purify your biooa,and the ced liveroil | in Scott's Emulsion ts nature'sgreat blood.| |maker,while its medicinal nourishment strengthens the organs to expel impurities and upbuild your strength. Scott's Emulsion is helping thousandseverydaywhocouldnotfindotherrelied ||Refuse the alcoholic substitutes.\«|a |CHEER WINE A real Drink,at Foun-© tains and in Bottles,5c’§ Doors,Windows,Mantels,| Locks,Butts,Sash Weights and} Cords,Sash Locks and Lifts,Hinges, Pad-Locks and Hasps C.WATKINS, Hocking Valley Cider Mills Are good ones and if you have applesthey are worth more than they cost to save the fruit.Apple Cider will not take the place of the “Quart’’but to those who have not taken to the water wagon entirely, cider will be a good substitute. Fruit Canners,preserving Kettles, and Staples.{Apple and Peach Varers and other N,seasonable goods.catreet.Center Ng Sai & ,We strive to please. ‘ & « Lazenby-Montgomery Hardware Co. 4 i | Tay, an Tredell man buys a Piano for his “Daughter of Iredell,”itshouldbeboughtfromanIredell firm.KEFP THE MONEY IN IRE-DELL!We have just paid the Sher-| iff of Iredell another $50 to renew|our license to sell musical instru-| |ments.| LEONARD'S PIANO STORE. WE ARE PREPARED To repair that Casing you cut onyourlasttripandtookchanceswithablow-out patch to get inifon.We can put it in as goodconditionasitwasthedayitwasputoncar. When You take comfort,satisfaction and pride in the bed room that is properly equipped. THE IREDELL VULCANIZING It is no more expensive to furnish such a room attrac- &SUPPLY COMPANY tively and right than it is to muss it up with a lot of 'l phone 201 i miscellaneous furniture. il We eell Miller Tire al eee The important thing is to SEE THE ARTICLES ANDNeeme}THEIR FITNESS FEFORS YOU BUY!We offer thisCOCOLADEINBOTTLES,|gam ee It’s good.Nuf Sed. 5c. Bottled exclusively by‘Statesville Mint Cole Botiling Company. =al a|——Phone 82,—a°-.ms||INGERSOL DOLLAR WATCH:=Warprice #1.35.need age oo prohibi-pas one Ach Ane OneWhe Mes Vee he. cultivation:wired for pasture:good meadow +of kind of a W.any a Waltham,Reliance. $3.85,Southern Railway Co,$4.48,20 fertile,dredwed ©ome ;J,W.Shell $2.70,J.C.Steck &‘Trae reper ion are coat ouliabte teBone,$98.6 Statesville Ol Co.we ae owners.1%forced sale and ne;tman $36.30,J.E.Ta-,%prices entirely fetr,nnd rene »a8.T Eorifice,somahte teres wader these condionontes.fee or address s he McLAUGHLIN.Attormey, “pedis malt For a bag of Davis Bros. Graham Flour,fresh lot right from the mill’ Don’t forget that we have anything you want in the way of Spices,Vinegar, Extracts,Rubbers,Jars |and Jar caps. Phone 89, Eagle&Milholland. FerndellCanned Goods. Red Raspberries. Peeled Apricots. Cling Peaches. Sliced Pineapple. Graded Pineapple. White Cherries. |This is the best line of Canned _oods put up. Miller-McLain SupplyCo. eeanemane-coamanpee rene aD Harmony High School A Farm Life School For Girls and Boys. --SPECIAL COURSES IN-—- Home Economics,Agriculture and the Manual Arts. Prepares for College ty entrance. Fall term opens TUESDAY, tember 11,1917 now at Dormitories. For further information and newillustratedannouncementwriteto R.H.LANKFORD,Principal, Harmony,N.C. Hardware,Material,—,Paint., _€.WATKINS,"phone No.43.a WANTED! SCRAP BRASS—HeavyBrass74c.5.=Ligh,Brass Sc.per vm "FOR SA LE: New ndsecond hand machineryforsaleandallkindsofboilerroomsupplies. oat’H.TURNER."PhoneNo.74,Bell Ne.7. and Universi- Sep- Engage hoard if have Seay trouble,oie en your Car.ell locatetrouble.All work Flesh and White, Newest Fall Models. Some Embroidered, some Beaded and others Lace Trimmed. In the lot there are fifteen or more styles to select Priced,$3.50,$4.00,$5.00 |NEARLY HALF Alexandrians“Pail Ph )Of’the first 100 men exam'der the draft in Wilks cour were found physically diseuOfthe50foundqualified35asi ef b exempti>n.i Yancey Wall,aged 60 years,wa~‘found dead'n his meadow in Yadkin‘eounty Tuesday.Died of heart diseasewhilemowing.Wife and sever-jal childrensurvive. ieee D.7;a native . sor,recently a resi o;Richmond,Va.,was kiied ‘in Rich.jmond Monday night when he,ridingamotorcycle,collided with an automobile. ,50 for |Gov.Bickett is in western North|Carolina,principally for a rest,it is|said,but he is billed for two or moreladdresses—the first to the Confed- erate veterans Hendersenville lyesterday. |M.L.Woodhouse,a respected cit- teen of Yadkin county,died Satur- at j day at his home near Boonville,aged °|72.He suffered a stroke of paraly‘sis last March.He was a Confeder jate veteran and a prominent Baptist. |Mr.Geo.B.Crater,who recentlyseveredhisconnectionwith—the‘Greensboro Record to hecome busi- ness manager of the Charlotte Ob-jserver,passed up the eater job and ‘is now with the Meridian (Miss.) Star.Capt.T.B.C.Knight,a well-known Asheville railrond man and for yearsanengineerontheSouthernrailroad,has filed suit for $60,000 in BuncombeSuperiorCourtagainstthe railroa:! company.He was injured in a col- ilision last month. Rosa Cline,a white woman about 38 ~=years old,committed suicide'while out driving Wednesday after-inoon,in the vicinity of Winston -Sa lem.She shot herself.The woman /waas in the company of Chas.G Poole and both had been drinking. The coroner's jury fourne that death resulted from suicide, A mass meeting held in Morgantonthisweek,composed of representa.tives of the counties of Burke,Me-Dowell,Caldwell,Yaicry,Catawbs Lineoln,Avery and Watauga,was foi,the purpose of devising a plan to in- duce the government to send interned ‘German prisoners to the mountains to ‘build roads.Delegetes will ro.to Washington to press the proposition, The Report on Russia. Russia,newest of \rows Stronver of hyart and purposedaily,and with aid from the Unitee in the vreat war and emerge a powerful State.This was the message brought to President Wilson and Secretary Lansing by Ehhu Roet «nd his fellow -members of the American mission sent to Rus- sia three months ago. Unqualified encourayement =from the United States,moral,and finan- ‘ial when necessary,is avseiuiely es- sential to keeping life in’the new rovernment,the commissioners uzreed.A separate peace with Ger- many obviously is their gravest fear.Left to fight along with herpresentgovernmentincontrol,the President was told,Russia will emerge triumphant we strong,but if either by great masses of troops or clever propaganda,Germany should accomplish the overthrow oftheKerenskygovernment,the out-look would be dark indeed. Methodists in Food Conserva- tion Campaign. The Methodist Episcopal Church, South,has selected Gen.J.S.Carr of Durham and Mr.C.H.Treland of Greensboro as the North Carolin members of a commission wio wil assist Herbert Hoover in’that =de- nomination’s part of the Church campaign for food conservation. The members of the commission,prominent citizens and members of the Southern Methodist Church, were selected by representative f Southern Methodists who met inWashingtonforthepurpose.The members of the Washington mectiog formally recorded their confidence in the food administration and lal stres.;on the advantages of the planforhavingweeklyreportsfrom church members on fooe savin: complished,and termed use of food stuffs in the manufacture of alechol “an unpatriotic and indefensil waste.” her part Too Academic.Sometimes,to be sure,the openin is so unfortunate as to inmeur istantresentmentandpositivelyinvitere-fusal.Take the case of the diminu-tive man of kindly appearance who was accosted by a seedy purist with the words:“Sir,|am looking for a litt! cor.” ,“Well,”snorted the wearer of the size 13 1-2 collar,“do J}look =like jone”? PERSONAL ITEMS. and Mre,J.M.Clark leas - marron for Montreat.Dro Clark |will spend bis vacation of teortwoweeksatMontrest.Miss Anne Ferguson hasBlackMountaintospendcome time.Myra.Thomas of =Stony copending several weeks vis- i pl ae,Mre.J.P.*—at Dudley, fone to >ah Shewill also v | and Rock. Coast Artillery company atofwhiehsomeCoa? Un-Brown, democracies, States can be depended upon to do Ry »Divernon, _Who has Watts! Taylorsville,Aug.9 —TheofCounty‘commiasioner,inrotar ,meetin onday,postponed -ing of land for taaee until the ‘rst. fers lan tee GeeMa Goes of Eee|jury list for term September principally routine.The jury list Bt as follows:First week —J.W.Deal, T.T.Payne,J.B.Patterson,N.A.Childers,W.Herman,J.A.Cline,::.C,Ford,P..oe!Matlock,J.T.Wike,C.ener,J.S.Hendren,D.(ea Lackey, H.A.Mills,J.C.Fortner,C.H. Watts,J.W.Childers,J.T.Sharpe, J.L.Sloop,W.A.Teague,E.© Walden,J.S.Bowman,D.P.St. Clair,W.J.Regers,D.W.Herman, W.W.Patterson;——.Week —8.P. Marsh,HW.Lentz,M.L.Bark- ley,E..Daniels,BE.A.—s H.(.Payne,J.L.Childers,H.C,Miteh- cll,W.A.Bogle,M.L.Childers,D. P.Deal,R.P.Brown,J.E.Gryder, J.C.Barnes. The good roads commission wereinsessionTuesday.They ordered $15,000 set aside as a fund to main- tain the roads.It has been decided to build two roads into town oneonthepresentrouteandtheother outh of it,passing through Mr.R.| |.Matheson's property and openinginoldstreetthatcomesintothe treet between Mr.W.J.Allen’s and Vrs.R.B.Burke's residences.The treet will run seuth of the cemetery. Mr.R.J.Hawks,brother-in-law of Mrs.Edwards,of Nashville,Tenn.,and Misses Bessie Morris and Herta Wilson,sister of Mrs.Edwards,of Suvar Hill,are guests at the homeofDr.A.M.Edwards. There was a very good attendance at the Farmers’and Woman's Inati- tute at school building Wednesday.In the morning Mr.Newman talked on winter vardens and taking care of seeds,and Miss Roddick talked briefly on eanning and drying foods, At the afternoon session Mrs.Cun- ningham,who represents the State insurance department,talked on the conservation of life and preperty. Then the gentlemen went downstairs to hear Dr.Roberts discuss dairy cows,horses,sheep and hogs,while Miss Roddick talked to the ladies about home conventences and Mrs, Cunningham discussed poultry rais- ny,ete.Afterwards they met with ihe teachers and committeemen and discussed ways and means of having better achools, The old -fashioned siven by the Eastern benefit of the home Greensboro and jocis causes was a decided success in every way.Mr.A.T.Allen gave out the words fromtheBlueback.Mrs.W.P.Hedrick worthy matron,and Mr.T.H.Mil- ler,worthy patron,were the cap- tains of the team of ladies spelling against the team of yventlemen.Mr.Everette Teague was the last srentle- man to go down and Mrs.R.E. unson and Miss Adn Viele |were the victors.The prize,a box of ean- dy,was presented to them ond Miss Viele presented it to Mrs.Brunson,| Several entertaining readings were given by Mrs.Brunson,a talented elocutionist of Florence,S.C.,whehasbeenvisitingheraunt,Mrs.C.R.Zickler,and music was furnishedbytheTaylorsvillecornetband. Mr .Atweil Matheson has returned to Greensboro from a “a to his pa- rents,Mr.and Mrs.R.Matheson.Mrs.Gienn Hplland: visited Mr.and Mrs returned home.Miss son accompanied them In the absence of the pastor,Rev. L.L.Moore,who is assisting Rev. F.A.Barnes in a meeting at Shear-er chapel,Rev.Mr.Henderlite,pas- tor of the First Presbyterian church of Gastonia,who is spending his va- cation at Davis Springs,Hiddenite,wil!fill the pulpit at the Presbyte-'§ rian church here Sunday morning at 11 o'clock.Rev.S.W.Moore,pastor of —the Presbyterian church,Bluefield, W. Va.,arrived Tuesday to visit his fa ther,_J.W.Moore,He left Wednesday for Blue Ridge to attend the Y.M.©\onference,Miss Eliza Gaston Moore went to Char- totte Monday to ver aunt.Mrs. J,W.Zimmerman Mr.and Mrs.J. L.Watts and children have return- ed from a visit to relative n Wilkes and Watauga cour Mr.Chas. BE.Eeherd of Statesville is spending a few days with h family at the home of Mrs,Eecherd'’s parents,Mr, and Mrs.J.L.Gwaltney.Miss Em ma Feimster has returned from a tay in Mooresville and Statesville. Attorney W.M.Smith of Charlotte 's visiting his brether and isters, “dr.J.N.Smith.Misses vennte and Addie Smith.Mr Jehn Watts of Hil.,is visiting his parents, Vr.and Mrs.M.LL.Watts,afterhavingspent30yearsin’the West. Mrs.Jame Watts of Enid,Okla., and Mrs.C.©.Everhardt of Newton, were called here by the serious ill ness of their father.Mr.Thomas Watts.Mrs.Jefferson Ingram’s children are at the home Mra.Ingram's brother -in -lnw,Mr. G.T.Ingram.Mrs.Ro &.Spencer, heen here with her son,Mr R.C.Cox,has gone to Asheville to visit relatives, Of the 4 men examined yesterday for the military draft,25 passed and °8 were rejected. New Record in Aviation. Edward Stinson,aviator -instruc- tor at the Langley field school ofaviation,Hampton,Va.,Tuesday es- tablished a new world’s record for consecutive ‘oops of the loop,car- Trying a passenger. Stinaon from an elevation of 4100feet,with Mrs.Robin Grey of Nor- as a mesenger,looped the loop 82 times in rapid succession,beforefinalllidingsafelyontheturfof he.held.This feat was performed Stine,G.F. spelling hee Star for the for old folks at Matheson,have Lucile Mathe- visiting hia machine.Army off__.apertaters'ped [A Call For Won ThePresidentof MitchellCollege has i—Boardingand one bos Tee aEarnest,ambitiousyoungwomenfromtheage of.i | twelve to twenty willbe in the firstcall.|Theenlistmentwilltakeplaceat theOffice of the College Wednesday,September 5th.The sacrifice’“.,willcost somethingbutitwillbeworth the price “ andmore. Superior Officers will be in charge of the talsing,:Ms The advantages will be great for the development’: of aricher womanhood.Failure to enlist will be a reproach. Bear in mind ihe date of enrollment,September’: 5,and the place. Mite ; hell OS atiw & inte ol bellany This is the disc Plow that gives universal satige': faction.It leaves the ground in splendid con: dition.Will break harder ground than other, plows without leaving it cloddy. at?We have a full line of Chattanooga Walking . Plows,also repairs. Iredell Hardware Go.: 3 and ste sen,who of @ aot a single mishap or pause jn)| Statesville,the of sauna nn pee INif i Served at the Fountain of Quality: Exclusively For 10Cents.o CHOCOLATE NUT FUDGE MAPLE FUDGE CHOCOLATE FUDGE BUTTERSCOTCH FUDGE. |Statesville Drug Comp’y. —The Rexall Store.— tg HF RAR ai |ae iWolaCaHeadquatersHee We are headquarters for your motorcar.You want it at all times to be fit and swagger and we are splendidly provided with the best ‘‘tried and tested’’accessories. Safegu’rd against delays and annoy- ances,by having your car at all times read,for any service you demand of it,by keeping the accessory details efficient.We have everything here that comfortable metoring is heir to, at the most moderate prices.Our Ser vice is prompt.painstaking and de- pendable. ACCESSORIES Quake:Tires,Mansfield C-sing and Tubes.Horns,Jacks,Pumps,—nd ¢ tw.R.Mills MotorComnama: OVERLAND and.:HUPMOBILE@ ** Et t.He on being “forced on us,”being and constitution- ally wrong,which will cause those who him or who are y him,to over- look his in to obey the law; and his further statement that the law is to be obeyed until it “is amend- ed by Congress or nullified by a decis- ion of the Supreme Court,”is distinct encouragement to make a test of the law,either in a test cose before the Supreme Court or to secure an amendment from Congress.In nor- mal times,when no real harm could result from such opposition,Dr.Al- exander’s position would not be im- proper.But in time of war,when we face »foreign foe,opposition to measuics enacted by the representa- tives of the people to carry on the war,is a distinctly different propo sition.We may properly oppose their enactment within the bounds of reason,but after their enactment if we do not put our shoulders to the wheel and do our besi,no matter what our individual opinion,we are giving aid and comfort to the enemy,no matter what our purpose. Dr.Alexander's position is deplor- able.It would be bed enough if he were a private individual with only neighborhood influence.It is doubly deplorable when we consider the po- sition he holds,which gives him State-wide influence.In two or thee localities of the State there have been outcroppings of resistance to the draft act.In one a public meeting in opposition was called off,but with the announcement tat it would be held later.fo another locality a citi- yen was arrested for soliciting funds ty send to Tom Watson,the Georgia fanatic,to bring a test case as to the onstitutionality of the law.There is not the remotest reason to believe that the act would declared un- corstitutional even if it could be got- ten before the Supreme Court!There is absolutely nothing in the constitu tion to hold out such a hope;and it may be set down as absolutely cer- tain that Congress will not amend, the law.Therefore opposition is fu- tile.But Dr.Alexander's talk will!encourage opposition—encourage ac- tual resistance.The doctor does not mean that of course,but that will be the effect;and many a peor fellow may land in jail or face a_firing squad because he may think that he ean put into practice what the doctor opposes,put what his attitude ¢n- courages.He should know that there are many people who will not draw the distinction he draws,especially when he criticises the law,says it was “forced cn the people”and i “morally and constitutionally”wrong ERGRIAADOpAEELESS?OSomNAD ~~ALO SEE THOU TO THAT. When the people turned out registered under the draft act with such unanimity there was general applause deserved applause for the loy sty and patriotism of the American people.It seems,howev- er,that some who registered with- out objection are like the folks whocheerfullywritetheirnamesona subscription list and then fall away ‘when payin time comes.Now thatFtheymustfollinforwar,some otheregistrantswanttothinktheact ae be and ;untomstitutional.The time for their:objection was the =first —irfpgance. p Then the worst punishment wouldhavebeenajailsentence.Now that they are actually enrolled,resistance :means death for desertion;and someofthepoorfellowswhoaremisled will be eternally disgraced and lose their lives in addition before all oftiemwillunderstandthatresistance td the fact is futile.See to it,men and brethren,that their blood is ngt on your hands;that neither by word nor act you counsel,directly or indirectly,resistance to the govern- ment in this time of war.On the contrary,every good citizen should uge his influence to aid in upholding obedience to the law. Remember,too,men and brethren,that opposition to this ‘taw means revolution at home.It means shed- ding of American blood ty Ameri- eans;and as the Greensboro News hgs so well said:“All aad turbulent elements,all the ene- mies of organized society,are look- iffy on at this sort of thing like hun- ty jackade.”They hope that inter- the restless nal war will result,for they would rével in death and destruction here at home. ooee6see At last the food bill i law Can- gress hos tyke:practically thr months to accomplish whet should have been done in three weeks—-or 30 days at most Latterly the oppe sition meant nothine but delay.Those who opposed knew the hil would pass,but they consumed weeks of valuable time simply te exploit their opposition and to cnuse needless delay Every member of Congress has ‘a right to his opinion as to the wisdem of any proposed act and has a right to express his view But when a mi- nority in Congress hamper the pas- sage of leviclation favored by the majority for the prosecution of the war,and intcrpoxe unreasonable de- be lay simply to cause delay,when they ba their opposition serve no *purpose,they are giving aid andforttotheeremyandareguilty moral treason if no more.The of Congress who have un-ibiy delayed the passage of bill are mora)traitors,if not ©cee rn peat of the United States per cent.more freight serv-May,1917,wan the rorres-mally"month &yeer ago,with vir- ead mame of cars and H ii b e Provosteyoe - selective war ; govern takeninto F service Au-taken ne 18008cficers and 210,804men.Another statement showed180,766 war havebeenre-eruitedfor the service sinceApril1,leaving 2,000 vacan-ciesin the regulars at warstrength.These figures meanthat approxi- rine corps,with-in the next few ual 687,000raisedunderthedraft.Of thelatterabout500,000 will compose thethirdelementofthewararmy,thenewnationalarmyandtheremain-jer will go to fill up the regulars andtheguardandtheirreserve.The mobilization rexusattons will!show how the drafted men are to beassigned.Already the War Depart- ment has received counttess applica-tions from men certain to be called in the first increment of the draft forces for assignment to some par- ticular arm or branch of the service.It is probable that some effort will he made to meet the wishes of the drafted men in this ferard as far as possible,when they are mobilized.It‘an only be done to a limited extent as the regulars and guard are prac-tically filled up now.The War De- partment has taken over recruiting for the National Guard as well as the regulars,the entire guard now having ne connection with the States.The stateme::says that about half the men applving for en- listment are within the draft ages. Those accepted wil!count as cred- its on subsequent quotas of their districts.The statement lays stress on the fact that the country wants all the men it can get who can be spared at home.It is regarded as likely that the mobilization regulations soon to beissnedwillshowthatthesurplusof drafted men is to be used as recruit reservoir and that the men will be put under training as quickly as possible.A recruit depot will be es- tablished in France feom which reg- iments at the front will be kept fill- ed up,drafts of men fromthe .main recruit depot in this eountry being sent over to this distribution center as needed.In the same way,sick or wounded men will be returned to the front wher recovered and a steady tow of recruits to maintain active regiments at top fighting efficiency will then be provided.The only hint of the probable method of mobilization of drafted| men lies in a recent ruling by Gen- eral Crowder which shows that the \djutant General may summon the wotas of the districts in inerements. Division of each quota inte five equal parts is suggested,each part to be called up as needed. Under this arrangermen:it wouldhepossibletocalloutatoncethe men to form the new national army and to summon later those who are to compose the reserves for all ele- ments of the army.Men temporart- ly needed in harvest ftetts or else- where could be classified by loca! boards into these latter increments to meet emergency situations In their districts without delaying organiza- tion of new forces. More Than 200,000 Called. Gen.Crowder has sent the follow- ing telegram to Governors of States:“New regulations governing mo- bilization and the certification of men from district boards to adjutant general will be mailed to you on Au- gust 9.In the meantime local boards should certify to district boards dai- ly those who have been called and who have not been exempted or dis- charged,cither because they failed to file any claim or because theirclaimhasbeendecidedadversely.“Strict compliance with this ruleisnecessary,since on September 1! the War Department will call forInottoexceedone-third of the quota{from each State to be entrained for\mobilization camps between Septem- ‘ber 1 and September 5. wish to be put in a position of not \furnishing men as fast as the War Department ready to receive ithem,each State should have aceu- mulated by September 1 a minimum of one-third of its quota not exempt- ed or discharged.This can only beattainediflocalboardscertifythese lists up with great expedition. “Surgeon general advises that in order to prevent the terrible ravages which result from the intreduction nto the army of that dread disease of the eyes known as trachoma,the lids of every recruit be everted to in- ure the absence of this disease and that any border line or suspicious cases be referred to an ophthalmie tas especially qualified in’this ine. is ' ’Cut Down Exemptions. The messages were followed up by a new ruling regarding exemptions because of dependents.Boards are authorized hereafter to deny exemp- tions to married men whose wives are solely dependent upon them but where the parent or ocher relativesofeitherwifeorhusbandarewilling to assume the burden of her support luring his absence.The same course is to be followed where any drafted man's employers agree to continue his salary as a patriotic duty.An-other supplemental ruling provides that where a man has supported hisdependentsbyhisownlaboronland which he owns and the boards finds that the land could be rented to ad- vantage so as to con:tnue the sup- port for the wife derived from the rental,exemption for the man maybedeni LOSS OF SHIPS. The weekly statement of Britishmerchantshippinglossesshows sliwht inerease over theweek. ii t He out to raise $1,000,000 to comforts and recreation for Cathe-, 'rained.to families of employes who have join- ed the army or navy and areedbytheraiabsence.A ruling tomadebytheinter-State Commerce| Commission. The Treasury's offer of oa 000 in certificates of inde’maturing November 15,first finane-ing under the projected second offer-| ing of Libertyover-subscribed when subseriptions closed at 3 p.m.Tuesday . ‘that the Americen steamship Navajo|caught fire at sea and was abandoned,the crew being landed in safety, fire is supposed to have originated in the stokehoild. ed and her naval guard reseued with; the crew. employes of the express companies was disapproved by the eter -State Commerce Commision.The com-mission interprets the law as prohfh-iting the transportation free of} charge of packages to officers and! employes.|Liberia,the negro republic on the coast of Africa,has declared on| Germany. brakedeclaration of war now givés Oppor- tunity toandothers who have vecr aceused of unneutral activities. millionaireexemption from the wer draft on the ground bride The slacker! to support his wift never did an honest dey's work in his life.{ at selection boards,directs that all such jreal military value. Unless we! ,ed serious and permanentwhile Twenty -on ls of morethan1400toneendOweoflemstan :* The Knights of Columbus,~ Catholic organization,recently lie soldiers and sailors in the war,| and it is said the moncy has ‘been| vrant passesRailroadsmay remand.|lroads as on leave ofentseffectwas | largely |bonds,was The Navy Department commen The The Navajo was arm- Free packages for officials and Some time diplomatic ao relations,off intern Germ::merchants| Kingdon Gould,2 member of the| Gould family,is asking has a dependent—a a few weeks ago. He has abundant means, ant probably; that he he married Construction of an aircraft factory| the League Island navy yard,Philadelphia,to cost approximately| $1,000,000 and to be completed in;100 days,was ordered Tuesday —by | Secreiary Daniels.The plant will|employ 2,000 workers and be capable| of producing a thousand small planes| vearly.| The ranks of the new national armyhavebeenoperncaformallyto friendly aliens as volunteers.A rul-ing by Provost Marshal GeneralCrowder,communicated ta the local aliens who waive their right of ex emption on nationality be’prompt!y accepted for service. Three persons were killed and two! seriously injured late Wednesday at-ternoon when shrapnel from the field pieces of three batteries of artillery from the officers’reserve training camp at Fort MePherson,Ga.,pass ed over the top of Kennesaw moun tain and svrayed deadly fragment:over a part of its north side.MrsSethHarris,55 years old,and twonegroeswerekilledandtwonegroe were wounded . BRDSheetACERTALTEI Awaiting America’s Help. There is no chance for peace dur-ing the approaching autumn.The al- lies are delaying their next great of- fensive until American troops havearrivedinsufficientnumbertobeofThesearethe two salient facts in a copyrighted,dispatch from the Paris correspond-ent of the New York Worta. French military experts haveagreed,it is said,that the war willcontinueanotherwinterandspring.British and French are counting onAmericaandavastsupplyofmen,guns and airplanes wo break theKaiser's lines.Von Hindenburg’s front cannot be broken by a slight numerical supe- riority of men and guns,not even by jouble his feree,but if the proportionjumpstothreetoone,artilleryandflyingcorpsincluded,the resultwillbeacatastropheforhim.The, innihilation of the German army,toaccomplishthis,it is the Franco-! British strategy to destroy as’many $1.00 and $1.25 Shirt Waists and Middy Blouses,79c. 50c.and 75e. values,39¢. Children’s Dresses, worth 40c.to $1.25, selling 25.to 79c Liberty Aprons, worth $1.00 For 79c. Sport Skirts,about 1-3 less than regular Germans as possible without regard to their own losses so long as they are less than the enemy's,so every .rriving contingent of Americans in- ‘reases the ratio of the allied supe- riority.Much has been hinted concerning France’s weakening morale,and the nation indeed bled grievously while holding the Hun by the throat until England was repared.But the German Crown Prince's fighting for the Chemin -des-Dames in the lastthreemonthshasbeenyustasfierceashismostsavageattemptsuponVerdunandhehasfailedevery-| where to retake observationcapturedbytheFrench. PLETALLSEALESSI1SONATE Convict Sues For $20,000, Asheville Citizen.Buncombe county and the board of county commiesioners,together | with J.E.Shuford and Steve Stewart,|are named defendants in a suit for! $20,000 damages,filed in Superior |Court by Ernest Fowler.| Fowler,who was serving a termon] the county roads,asserts he receiv.| injuries|a member of the road f of dynamiteatarockquarryseveralweeksago,in which several negroconvicts jallbeing closedout at bigreduction. |This Merchandise will "least you at least 1-3 more next spring. 7 OMAP AM wr aa eth ue Att You will find all our Sammer Dress Fabrics ie Let an “IDEAL”Fireless Cookstove do your cook-ing.It will save food,time,fuel,trouble andoy,you will have better cooked food.one or write for descriptive booklet.Craver each Parsitege Cpa.“The Store T haPHONE NO,400, THE UNIVERSAL CAR No Change in Price— For The Present. The Ford Motor Company does not guarantee that there will not be an advance inthe price of the Ford iater on,but forthepresentthepricewillre- main the same -$884.25 de- livered Statesville. GET YOUR ORDER IN EARLY. @e - e & eb e e ee oe c= — - oo == : Carolina Motor Co. Mooresville. Newton. Harmony.Statesville. If You Want a Racer We Will Get You The Best There Is. is sensible:all ‘The present day demand,however,| for a car with lasting,satisfying qualities and the speed you willever need,a Buick or a Dodge I for instance. There isn’t a reasonable test that we haven’t given this car and it has passed them all,New models unexcelled, FOR SALE 206 acres,level.productive,red land farm,fronting quarter mile on the most traveled,public,sand-clay road leading into States- ville;nice two-story,frame seven-room dwelling,located in a beautiful grove;barn and out-buildings,fine well water,two branches;abundance of fruit;quarter of mile from school and churches;80 acres in cultivation,30 acres in meadow,balance in i woodland,part of which is inclosed in pasture.An exceptional s opportunity to buy a fine grain and stock farm.Will take in part payment,small farm if well loeated. ERNEST G.GAITHER and| ra} he *Oe, camp.J.H.Ham,at No.2 mill,isill..J.&.Arthurs and daughter,Bell,leave Friday for a visit’cee Pe where Mrs,Ar-,has children living.They |e for two weeks.was em-| | F ighly recom :26 years old and has a wife and two ldren.Dr.Davies MeLelland his|friends farewell and boarded thetrainforFort~~.Each ofthesephysiciansmanyfriendshereregrettoseethemleaveandwhosebestwishesfollowthem.q Dr.Ben.Taylor of Lowesville,brother of Dr.Geo.W.Taylor,will -focate in Mooresville August 20th.He will vecupy the office vacated byDr.MelLelland over Goodman's drugstore.Dr.Taylor comes highly rec- ommended.ooresville is fortunate to secure his services.VERNIE GOODMAN. Child Dead —Children’s |DayatWesleyChapel. Correspatuenue oF the lentes® Troutman,R-2,Aug.8 Paul,the small son of Mr.and Mrs.TildenShinn,died Wednesday morning ofcolitisafteranillnessofoneday.HewastakenseriouslyillTuesda morning at 2 o'clock and his deatwasexpectedhourlyfromthefirst.Paul an unusually bright andcheerfal‘child and the sympathy~ofthecommunityiswiththebereavedyoungparents.Funeral services atSt.James Episcopal church.Mrs.Chas.Rimmer of StatesvillespentthepastweekwithMr.Rim-mer’s parents,Mr.and Mrs.Sam.Rimmer.Mr.and Mrs.Sam.Rim- mer have returned from a four-dayvisitwithfriendsandrelativesnearHillsboro,the birthplace of Mr.Rim-mer.It is his first visit since leav-ing that place 45 years ago.Theymadethetripthroughthecountryinamachine,rae by Messrs.J.A.Rimmer and Grant Compton.Mr.Fred.Abernathy,Miss MyrtleGrahamandMisseg.Brown ofSalisburyspentSundaywithfriendsandrelativesnearOstwalt.Children's Day at Wesley's chap-el Saturday,lith,at 10°o'clock. Songs and recitations by the chil-dren in the forenoon.In the after-noon there will be an address by thestor,Rev.J.C.Keever.It is alsoopedthatRev.Mr.Ratledge will be with us thai day also.Pubiic dinneronthegrounds.Everybody inviteatocome,bring well-filled baskets andenjoyapleasantdaywithyour friends. Teachers Urged to Attend theInstituteNextWeek. To Iredell County Teachers:Prof.J.H.i ith,instituteconductorforI1countyTeach-ers’Institute this year,requests metourgealltheteactobepresentonthefirstdayoftheinstitute,Mond@y,August 13.Those who at-tend for the full two weeks arerantedacertificateofattendance.Fhose who do not are debarred fromteachunlesstheycanrytheStaterdofExaminersandInsti-tute conductors that they were prov-identially hindered.The county su-perintendent has no authority in the matter.I am mailing cards to the teach-the institute,few because I didnothavetheirnamesandaddresses.The books to be used in the institutewillbeonhand.Daily mmesoftheworkcanbeobtainedfromthesuperintendent's office.ne see every teacner pres-ent on the first day,I am,your,SHELL.Very respectfullAug.9.JOHN F.MI Items From Taylorsville. Carresponaence of The Landmart. Taylorsville,Aug.6 —Rev.L.L. miere will go cola to assist Rev, F.A.Barnes,pastor of the Second Eoashaceien Sook of Mooresville*©,in a week's= bade |Sarah and Thomas Lee,are spending| |Miss Mary LH sa l ii ; E> Charleston for the t month,Miss Katherineturnedfromavisit to Miss ClarissaAbernethyatHickory.i -nethy accompanied ner home and.will spend sonie time here.Mrs.H.L. |'3s aE several weeks in Waynesville,{Miss Margaret Wwrth of Chatta-||nooga,Tennn.,le visiting Mr.and| Mrs.C.V.HenkeMr.and Mrs.H.P.Grier and son,|Barron,will go to Lincolnton tuday|by automobile.After spending thedayinLineolntontheywillleavefora)motor trip to Asheville andwesternpoints.jMissgeHoltofHighPointis;the quest of Mrs.L.L.Lanier.Miss Alma Hamm of Roanoke,|Va.,who has been Fisiting her un-cle,Mr.L.C.Deitz,and other rela-tives,returned home Wednesday..Mr.and Mrs.B.M.Ste nwillleavetodayforsakeJunalus- baie and Mrs.C.t.Hicks and MissBessieHickshavegoneforatwoweeks’stay in Richmond county.Misses Pauline,Mildred and =Sa-rah Smith have returned from a vis- it to friends in White Oak,8.C.Mrs.Clara Turner has arrived from High Point to visit her son,Mr.Chas.A,Turner. Mr.Ray McGinn of Charlotte vis-ited Mr.Maurice Dunlap this week. Miss Gladys Sherrill has gone toRockHill,S.C.,to visit friends. Miss Marie Stevens spent severa! days this week in Salisbury.,Misses Mamie and Annie Alexan- der have gone to Blowing Rock to spend several weeks.Miss Sophia Henninger.is spend- ing a week at Lake Junaluska. Capt.Claude Morrisor and daugh-ters,Misses Claudia and ElizabethMorrisonofClmrlotte,Misses MaryThomasandEleanorStockerandMasterDavidThomasarespendingafewdaysatBlackMountain. Mrs.W.E.Anderson,Mr.FrankAndersonandMasterRichardHal! have gone to Catawba Springs to spend a week.They were joined there Wednesday by Mrs.Andeisen's daughter,Mrs.Malcolra Mason,Mrs. Mason's two childrcn and =cister-in- law,Miss Mason,of Louisville,KyMissMaryaretStikeleatherhas gone to Hickory to spend two weeks. Miss Margaret Clark of Washing- ‘on (N.C.)is visiting Miss Willie Poston.Miss Julia Sherrill left this week for Rock Hill,8.C.,to attend a house party. Miss Mildred Bedford is severn!days in Chartozee. Mrs.P.S.Torrence of SalisburyarrivedthisweektovisitMrs.R.Y. McNeely.Miss Dorothy Dixon of Charlotte is spending the week with Misses “Louise and Margaret Sloan. Mics Miriam DeBerry,who has been visiting Miss Ehzabeth Cun-nineham,has returned to her home in Terbero. Mrs.C.B.MorrisontwoweeksatHiddenite.Mr.and Mrs.W.A.Sample andchildandMr.and)Mrs.DeWitt Ramsey and child went to Valle Cro-sis yesterday to spend a few days.Dr.and Mrs.T.Grier Miller ofPhiladelphiaarerelatives here.|Mr.and Mrs.FE.P.Clampitt and daughter,Miss Katherine,of Char lotte,are spending trro weeks with Mr.and Mrs.L.C.Caldwell. Social Events. Miss Claadia Morrison,daughterofMr.and Mrs.C.8.Morrison ofCharlotte,was hostess to her house guests,among whem were MissEleanorStockerofJermyn,Pa.,and’as of Statesville.Progressive was played andMissThomaswontneprizeforthehighestscore,a box of candy. spending is spending visiting Miss McBride Alexander was host ess to the members of her club and afewotherfriendsWednesdayafter-noon.Miss Gladys Gentry of Atlantawasguestofhonor.Miss HnssieMillerwanthehighscoreprize,acrepedechinehandkerchief,in thegameofbridgethatwasplayed.Asaladcourseandtenwerefollowedbymints.Miss Blanche Alexander assisted in serving the refreshments. Mr.and Mrs.C.V.Henkel enter-|tained Wednesday evening,compli-mentary to their guest,Miss Marga-ret Worth.affarr was an infor.mal dance.Nine coupies participated Mrs.M.L.Horney of High Point,| Mise Mary Trice and Miss Pear!Here|Rev.¢Lexington,house guests of Mrs.|.L.Cruse,were guests of honorwhenMrs.Cruse entertained a num-| i | ui = fe l ‘4 i iH reckon,waskhaki,at lenst thatseemedtobecolor,but there was alsokandsilverwith«a bushelwers.I'm not streng on society andcernedI ,Despite and tonatboyswecan't forget chat behind it all issomethingwhiehcantbeidljustlistenatthissow,willthebunchatBro.Sherrill's iast nighterwhodidn't have to go to Pranee."t reached the age limit oftiontherewassomelittleminor defect fortheFederalinspectorexemptedhim from further service.All he had to do wangohomebuthedidn't ge.“1 think it is mydutytotheboysofthecompanyandtomy country to go ot the front.|amWillyoutakeme’‘They took him.wan and so forth, 37 ter love hath anye's no craven fear in the hearts of Ire-|:They speakof j I 1? 's| ‘ dell Biues about going over.it and are holding themsetves in aieuetheywouldexpecttobecnlledtodesksorlayshereathone.But a pleasant page in their memories hasbeensetapartforthedelightfuleveninggiventhembythevivaciouslittieMissMarie. Notices of New Advertisements Storeroom for rent.R.A.Cooper,Fresh milch cow for sale.J /,Allison.Sum of money found.Apply at Landmark. Farm for sale.See W.L.NeelyTenantwanted.J.H.Rockwell.Cotton salt bags for sale,Statesville Cot- ton Mill.Mule for sale.Jim Tharpe.Hickory blocks wanted.Hickory Handle &Mfg.Co.,Conover,N.C.Account book lost.Return to Landmark. PLE is the;|ment in faw Continued use by trongest possible argu-:of trying me ALL ” Hardware Co. Statcevilie,@.C. NEW SEED BUSINESS. TurnipSeedinpackages and in bulk,Also a + and Field Seed. All New. } i> | Big reduction on summer merchandise.-J. M.MeKee &Co.Oakland Sensible SixTrunks,suit cases and bagsShoeCo.Last season's prices.Mills &Poston.Andrews Mu- Yount &Alexander. Sherrill-White Best pianos money can buy. ate Store. No change in price of Ford for the present.Carolina Motor Co.Get that monument now.Racers or sensible cars Co,Ideal fireless cookers niture Co.Ford for saleHouseforsale Rarren &Conner.Statesville Motor Crawford-Buneh Fur- Mrs.W.L.Neely.W.L.Neely. MARKET REPORTS.__ Statesville Produce Market.The following prices were paid yesterdayforproduceonthelocalmarket: Spring Chickens,I7e.per bb. Hens,t4e.per tb.Ewes.Die.per dozenGuineaExes,20¢.per dozen. Beosters,Te.to Be.per Ib. Butter,25c.per tb. Hams,27¢.to Ze.per fb.Sides,27¢.to 28.per Ib. Shoulders,26c.per tb.New Red Honey,12 1-2c.to I6e,per tbSourwoo8HoneyComb,20.to ive,per tbOldAutoRubberCasing,4c.pe:ibIrishPotatoes«new)£1.50 per bushel. The following were paid yesterdayforgrainonthemarket:Wheat,$2.45 to 82.50 per bushel. Corn,$1.95 to $2.00 per bushel.Oats,Sc.to We.per bushel.CottenOnthelocalmarketyesterday 26 pound was paid for bestMarketrm. cents FOR SALE—Nest bargain you ever saw in asoodmule,Don't need him.JIM THAK!® Aug.16°It. FOR SALE—Large quantity clean cotton salt barge duet the thing for dried fruit,ct« STATESVILLE COTTON MILL.Aug.10 2t, WANTED—Tenant fer good two-horve farm.J.HW.ROCKWELL,Statesville,R-2. Aug.10.It. Owner can getFOUND—Sum of money. same by describing low and paying fer th: ad.Apply to THE LANDMARK.Aus.| Return te Aug.1L.OST—Book containing accounts. THE LANDMARK. FOR SALE—Pive-room house on Elim strec.Water and lights.W.L.NEELY.Aus.|i FOR SALE—Five-passengMRS.W.L.NEELY. FOR RENT—Two-horsebuildingsandwater. ’Aug.1. FOR RENT—Storeroom formerly eceupied by R.P.Allison.R.A.COOPER.Aug.10.cecenengenes 12—hgpesiaeeesarees FOR SALE—Fine fresh milch cow.J.W.ALLISON.Aus.| HICKORY BLOCKS WANTED—Will pa good price per cord.Write for further i:formantion.HICKORY HANDLE &Mi CO.,Conover,No ©Aug.10 it WANTED—Tenant for three-horse farm near Loray.Plenty of farming limplement«quired.Apply to MISS MINNIE MORK!SON,Statesville,N.C.Aux LOST—Small Colliecoor.Four white spot on nose and tip of tail.W.A.BRISTOL for reward. WANTED—White girls to work in diningroomatCommercialHotel.Apply to Wo &FLOWERS,Mooresville.Aug.7 “t WANTED—Knitting Mill Help.We are nowoperatingournewmillcool,sanitarybuilding.Street cera every five minut:Close at 12 o'clock Saturdays.Good wavtotoppers,knitters,loopers,Can aleo ure bright young women te learn.Mort atirn:ive city in the South.Forty thousand tandfhanyflyingmachinestobestationedhere,CHARLOTTE KNITTING COM!\NY,Charlotte,N.C.Aug.<“t FOR SALE—One good driving horse,buccyandharness,one colt and one mule.A78,Statesville,N.C.,or (phorAug.3-10 FOR SALE—Five passenger Cadillac car,goodcondition.Chenp,for cash or on time.JC.HENLEY,606 east Broad street.duly 31 at. POR SALE—Ford delivery body,See CAR!ALEXANDER at M.P.Alexander @ Bro»store.°duly 2 POR SALR—Pord car.See CARL ALEX- Sa M.P.Alexander &Hro'.«stor Ford bile.iwAus geod farmfarm, y NEELYSeeW.L .Brown or sableeet,white bremst,whitReturntoAve.7 2t =:(PLUMBING. }|j |1}j\ \“A)SATISFIED CUSTOMER 1s|THE BEST ADVERTISEMENT"! ,We have the satisnea customers.|eet us furnish you.with a list ofem. LEONARD PIANO STORE.—— Battery Inspection Free. We are thoroughly — to recharge Batteries a ve in stock a full line of Battery ac- cessories,° STATESVILLE MOTOR CO. CHEERWINE ‘nm Bottles and at Foun- |tains,5c. Is your plumbing all right?Are you en- joying that bath that is so invigorating?If not see me. Some Pumps on hand. W.E.MUNDAY. Your Plumber 114 E.Broad St. Phone 55. TAKE NO CHANCES. The expert sent to Atlanta,Ga., to examine into the causes of the great fire there May 21 found that “the Atlanta disaster was essentially a ‘shingte-roof’ flagration of the familiar type.” A’word to the wise See us for a tin roof. STATESVILLE TIN CO. "Phone 55,114 E.Broad Street. con- is sufficient. We _ya« i Regrets won't bring back the money you have ex- travagantly spent.One sure friend to a man in trouble is MONEY in the bank. But the man who banks his money is the man who gains theconfidence of his employer and holds his job. Money in the bank also means CREDIT and CON- FIDENCE.No mancan afford not to have the confi- dence of his fellow men. Make OUR bank YOUR bank We pay 4 per cent interest on time deposits. Statesville,N.Cc. =‘ }‘The Thoughtful Husband Supplies His Wife With er Modern Kitchen Helpers. No man wants his wife to work her fingers home life brighter,happier,sweeter. No wife can work, delay and learn how it cuts kitchen work in two. Williams Furniture House. |©THE FIRST NATIONAL BANK, good as a good climate. J.C.HENLEY, in North Carolina. Elizabethtown,N.C. Vv clay Roller Flour Mill For Sale. Two of the firm having died,we offer forale,privateiy,one of the beat 104 rel mills in one of the best towne in the }Cor espondence solicited TEMPLETC WIL- LIAMS &CO.,Maoreeville,N.¢ Aus.3 4t. DR.VANCE HASTY,DENTAL SURGEON, Rooma 6-7-0,Second Floor. FIRST NATIONAL BANK BUILDING,.Statesville,N.C.TELEPHONE SRC Agee,"Thene 197.Hours §toSPPCIALATTENTIONTOCHILDREN'S CG.WATKINS for ' a1 “7 do herself and her family justice,when. she is all fagged out by needlessEverywomanwhodoesnot‘McDougall Auto-Front should visit this store without, ean 7 rat to the bone!” He wants her to have everything that will make her workeasier—save her time—give he®leisure—for this makes know the value of the. ee Good and CheapLandsinBladen County Soil that grows corn,cotton,tobacco, oats,and all kinds of clover and grasses,The health and water areThislandis productive,and easily cultivated.The is building an excellent system of sand roads now. Write me for a list ef my farm and timber lands. Real Estate &Insurance. ‘LENOIR COLLEGE (Co-Educational)HICKORY,N.C. An unusually successful school;under Church management;rated byCarolinaEducationalexpertsamongthetenA-grade colleges It will be unwise for you to decide on a collegegatedtheadvantagesofferedbyLenoir. The Department of Education secures complete recognition for its Grad- uates from the State Board of Education. The Yoder Memorial Science Building offers superior Laboratory facili- ties for the study of Chemistry,Physics and BiologyDe Home rtmentsfconomics and sub-Freshman. Literary,Education,Business, of North \before you have investi- Genuine college advantages within reach of all the people. Write for a catalegue toR.L.FRITZ,D.D.,President,Hickory,N.C. Seee PACE NSTITUTE,RAFortheEducationandCultureof Young Women. Classical,Literary and Scientific Courses leading toGraduatescreditedbyStateDepartmentialdiplomasawardedinMusie,Voice,Art andCertificates,Expression. LS Excellent Commercial Course, IN:Specialists in all jon for diplomas, * ‘Music,Art,Expression, Location in capital cay’ves special opportunities. w.66 acres setnee wees -L eeeeee Tee Re ee @ ” ‘ipactubdyiered be ane Peeee ,ets? mae eGencesc a *Peete eeenere Wieesee e s to be Arthore F =3 acres and |Brown,4.Wi:Sp sen . Brown,p om je ........0. . seeneee nen |ee ES id ane |... . ’ and Deve +ee eee —_—. _. 4.36 Sas ; a eee eeee viers. \ieamtiie,dunF.00acre a0 | nee eeeeee enlarging some |.a2 : os tribes Pes in con rection in a,Ee eee " eat training cam Paste ;G.8 ae 3.70 Rates s ck Is at PS.Parker,»54 meres 6.48) Shi skpds igi ports are Wallac Sam. ! igi by the army.Two »2”pong acres . +3 and a __being en-Allizon, Colored.. : 2 <i ‘or are being tak general hes-Byers,Wade ‘14 acres Sills,Mrs.White ats eene new oh 2 a0 ‘are special treatme jen over or built Pale,Povey.4 cares...Leg Moos.J g%“wea e ee being taken nt work.Ste =1.62 Dayvault,Mr 22 acres acres or ade work Stepa |Benton.Mrs.C Bethany aaa!.hate bed act’+B51 J rk out festen.Me CB.7 . 188 sae +H rtificial hoapi plans ye ea Clee.8 aeren Lib oad limbs will bx spitals where zoe hy gets ~e 12.95 |Carter.igi!berms oe |eet Su »repar »made oa ra.C.i re —we.139 Sais ss a eit SR ae Pc .ueation 7 paps oe done,and and fit-Houpe,J.."=26 acres L..,185 acres cn Holland w.G,—cme ee ce wie eypieahe a ee aka Hayes,Mrs.PA.170 |Rae Py.eee eo ‘The Mga the aon se gd enable mecca 4%A.,178 neres 11 12 |Moore -c uM Daca acres...as ap ances be i We Sa 5 ("the im of the,modiea!depart Ham,i A."eae ia Heaney Ae cat;GES a r cent.of —provision _"s es."ites 1-2 acres’1.00 |Sanit +4";to au.so t ;or 5 wy hols«,431-2 wer 2 |Smith,a a 10.49 ‘all and then oes enlisted force |5 |Seecmohene Mins W .og 10.81 anit,i ae a cent.Abroad tend that to 1!»Y Pressly,D.“1 Poetical he anton “Ts wan RW.73 40 neves nap _gent.of the 1 facilities for 20 por |Seve.L.F.Ba .,25 acres oa gD Wo ae er Yorces will merican ex .per eon ers,Joe.,as Ge tte |Reseboro,E Cabieed.:1.93 eae Provi ill be rovided peditionary —»wers,Mixs oe eer 5.69 icoaeana:oe.4 a :mn) cree aoa §will be mad Aline ne.19%acres avis)Parmer.coe an cue eniceg an 2 tech pepe Tg |. ent my in this cou de at the can-eager 5 meres o058 |pp we,36 nerwe se vebees bee Seal eee i :the troops i ntry for 3 per Bailey,+bee 2 acres me HJ.a vepene ca i Re ieee modern fae each camp.A a a. —Go.a ‘aWiley,200 avi "| -Gae Yee structed ;ospital -_Cohen,Wie,5 aeres #8 |Carpente |$8 eewen |.[eee ge n e ing at f at each c will be)Cowa ,Wiley,1 1-4 2'33 |Carpenter *104 eres nec aoe Hage Oe ag fae Ha o t ‘ewest 1 camp,cont Chi nm,Julius,1 ne acre Cornelius,.., pS fat e j=S e > pital,wi ,000 bed .ntain hipley,A nere Ce _wew weres $53 dees a hk ate gcc fae He .th the eds,Each Davidsor niddersen,|ae “31 |Gormetius.C +»60 acres +3 |Keainaoa &Ohattam,8 Wis fae Yee : hie allots will —resery a Lyneh,<<4h ae a " ‘he |—wii.wee n ped ye eee ta eteneee as e s allotme 'quire 6o Summers Is 1-2 ner a1)pis *,A} faite sepa : nt Ww acres,|*&&..zs sa K.68|a her,J.8,10 aeres toes > “ Ee te between b i leave genero ‘Wetlms Awstin,16 1-2 we 964 |Mitehell,J aoe acres ee ee 6.02 le of these h A puildings “us an,Jno W 2 meres 6 a4 |Mills.kK _™.1 ace ee 331 2.44 ‘nat ospitals .The cost 88 we Mo W.ates 7 ogy,Mate M. : ely $500,00 :will be ce;Oe Chambe bee 1.40|rrison,ROK (i-Qere 7.prom,& 44 tio $500,000 each Approxi-Beare C8,821 rebure 10.03|Morrises .bh ne mie ayhew,W.W. 1.66 nal Guard cam ,and at the N Beard.A.P..1-2 nerves .. Mayes ‘Mra.Brame ~ee :bee aoa,C w.'e a js not requi ps,where Na-Brown,Nk ie meres Mot.W.R.,182 ae 16 oe Oe Minted dy oe 766 lighter ~~S and re cae Guat,Wi ona ©18.98 |Mayhew 4 ieee oe Milter,We Be 9.90 000 '2 cost wi tion @6 1-2 acres and oy Me »WA.I 4 ake an:|Melk ow Bhat weer eeecces % 6 _each.Each =be about $400,Farm,Red Cr W.NN.Summers 7.68 se oar J.B.3 1-2 were.....1 Miller z Fo hg eee as heed equipment ospital ay ,-|Moore,F Crest,1,10 Ree &2 Preae ac... we os |Milbe a ne \touunder pg meee .MON —_—s equal will have Mec Lh.£49 eer 0 neres 10,56 le,M we,196 ovate ,.Mrs,KM ee, eaunder Dg.3 ee a DA cgpewoatoas m _—that of the vetlel ar Jd.W “abet 206.9%Southern r,LL,280 Laenodee wat —w —C,4 tb ......... Allison,r D.8.6 a a SEPTEMBER 3, ie e ¢ rest ,eCoy,T.FP :&acres e i.Tesaplcto ‘ower Ce cs :necres ian ‘organ,:tbh ee All .neres .... ,1027, will tea ae of the —...Mis 'D.eres 26 Wnchasn a oa rs oe va ia Settee 04 |Aliaon,a.IG gore...4.81 |for ‘ iledi nee,G.&.7 A ee foods Oe.As oe BA Oure,ive 65 |Alfiaun,1 1.05 ract of the Each much cheaper ildings Peteet 3B.70 1-u 3 1-2 we 9.07 ee.ee lace ;oy Bet bet eerie i -, teeth,a Ww.2 meres res j R.,Wh De iin Moowe,4 »1 bot 08 |Ben .M.,1 lot Aatleeeme wit :following have on in the quality.Shepherd,5.,190 ager 6.98 Bai “4 acres |«ey Mot oe M.,1 lot :Be nett, ieee t.tow ract-—Lying the equivalent new armies will 4 rd,C.F,88 ne oe oe ‘::Cu pln My ttt moeth,a %4 ea ag |tomnshin of wed tie examinati a of ;s will s,W.N.,23 acres davidso:.o neres sy)Mott,Mir .tna o Reanien.‘Walia eo 4a and begin a «in Palletown ions f six or Tucker,+»229 0 ome Mor ».Ora M.Ao 2 8 2-8 OA oe in wing at mate -to the >An gpa speai in addi._Fe ae acres “Weve,Lemuel!acres 16 neves "Murdock,rg -1 cL .60 i Mary,ny acres |...;hae See oth 2 und ge B.“mail nera eular exar -Arthurs,Mrs “2 wer juan he se =po,Murphy,”7 lots... Calqw 1 Iea ne ses |ennt devrees tot Leading Ts oes Soa cont @F |Gtr”mn ee 32 1-2 ne Gan Bao acres is i Socreyoem 1 tot lone.Seana,0 a ‘Se |north Me Ban Seat oun cast 188 sates 3; out oe are ee a oi ore Williams,J rn.eatate,13 pinoy [een i ,Cowan,ee ,in s3(Goe —Bong heyy 3.3 special nd person working Meni.Miss’M.J 23 aa Meese eget oe a <a 3]fasten,Andy.tot 71 ao san Ml ook 6 stake ar exam nel f 7 nis,JY.2 ,23 18 LTL Honeye ander,6 Hae -)Phifer,E lets Dieke ndy,1 Les ctoke 182 poh ; bos: ination or this Mille &»24 wer 2 wecres 4 yeutt,Mrs,G 65 neres :,Plot .BL.3 : Dickerson,w let... nm Kestler’s on to @ thence a —Every man work at each a.es meee a4 Ball So Go So es ee 2 Dye pen.ak a.wast it a $3 pele Vine:‘thence vine knot or or ul .will be e 2 Murdock 4.W.,135 -¢2'B lard,J.L..je Delinquents,ere Douse S.,1 lot : hone,4 gE.lot.res 2.86 |as acres:more »the =71 de heart, josis,affectio:xamin-Mela k,Austin,coos 20.13 oeai iW.28 acces i 4 8.OU ft .Guither,Alex...lit 2.69 |jan —in the a leas,and ing,sonia. nose trouble,ear av of the me!*Sa aconiee is.i3 Ree J a aeres ::;oe v.A.,ao Tees -_aeannn len. 4.06 |g J vision of the tot rl intesti ses,hook wo .roat and Smith.W.t.1-2 aere 14.06 Gabe ft Bob,ccm!S64 neres 2h 16 Salmons,C.,2 lot Hall’dim,2 te i 1-44 |townsh Traet Lyin nal infection rm and Whi L., 43.00 K riel,M acres rem. ‘ms,Mis a. ‘all,Jn acres Fiera 7.92 ip of the ”and oney and paratyphoi 3,and fo aah Aga oy ene,Ba of eo ee |lot 7 ae lane ees ale =nee being to Pultonsy.| carvers.id,and other typhoid Allis nto.0 neves pot Kelly,Mero.Bt $0 ners a aoe ri ie 7 or |6b Teerof oe d tract chews dusert fey this The staffs -er disease-pines.Aeees:o Coteend, lane a.IA ate,a one len Nhuping,Ges re bet at Hart.Peat’'lot :738 mer of let gana Sucuaet ae ribed,j :7 we e .ow * 360! . a e,1-2 Trees » eax work are being —Chains Arty ‘2 anak ee Praca.¢wae hin;ee ay a perten,Te 4.06 a re eee 2 ae ;=pote and vomning pine See nentl lected t thambers,M ur,1-2 ae 8.48 |Thomps:ei aaces hogs Sowers,1.entate,1 6.48 Howard de aa |a north 17 ke in 7 joe er ae +mer ism Carrie,25 ino let 63 Houpe,.A.2 ;:24 h 18 corner of west 30 Not a C pitals.Glover,The.1-4 aero v. i tawearly,‘T E oe “acres 8 "2 Neradley.J H.,1 bot ew Bawcs Detia,1-2 ——G fe vine ae cen went 182 lot No.6;olen te For the eee a loa aceere ve |<vauat Ai A.,36 4 Mitte. 2 ye |Starnes,J ~~1 lot eee Johnsen,>A.1 tot ’14.60 |teleleee —_oor =ote to a ie ae ida nox,it J 2 ed aeren eel Grate”vikarl 16 nores Npann,&..2 lots one de .Mandy,1 ;-taining 36 pale to >thence or The Washi Senate. Patterson ie 1-4 aeres 4.11)Dearm:Mrs.M.J acres 2 ogg Thomp uther,1 lot ak Mine Deller,i lot :ie ne oa amuaned the begi Faw 7? ,ash Pattecena,‘oyett ng|eee I .16 wer oa)4 mon,PH sae ow,Mar 1 bet 22 as allotted more or less;,on the Gre ington ¢c P erson,He:.1 aere Gs Everidge .BR.193 ner ea my |tu Ch ,1 tet 4 King,V vy.1 tot .1.86 Josey lands.ta the divi ;and nse correspond: eursot rman,\1-2 39 |_4 Ww neres how |Tur as.H 6.84.Lacks VAL? .Third Tra vision of lot thori ensboro Dail N.ndent of P¢n,Armps 1-2 ner Sas ee Ww .10 ner Mme Mra ,&lots i.‘Gig is 1 4.26 rd Tract the zed to de ews i arson,Richard i?ecrasie 1. Maiden .b.1 wer = Tu G Lula,1 ke 22)Lackey.Lae,1 dot .ae township Lying and »recent!den abs is au Roberta hard,1 ae ;)482 She ie wa re Wasscs 2 mB.pt wet Li “-.C.P c :22]and ,of the af heing in ¥,ly print :utely th Se ARB ig v.98 aha ek zz a on,J.ot ins witthe,J .1 bot 6.29 |Heginning orensid Steal Fallstown newspape ed ina N :e story nith,AL €1712 we v.28)Spann ;&&.6 eres Webb,Wo E,1 lot 0.54)Morrt ne.Ana .aq}mown as at @ stek te and ‘r tha North Caroli Stevenson,Jt 10 were. 616)Trivett ko Po eres cee ten arte |Meeclcces,Clea wa,1 bet .$Th|denrees _the |Park oon te ol Ue Clause Kiechin'wll ea es |e Tact so il Be ee Sacre dat et ib Bor we tee hierar See Ae as i me ac y to Nien.2 ware 6 8G Maer et, 4 ethan icin.Mores MOT :aon08 tate with the oid ©on the Senato nited Stat candidat Weatm jex.,2 ae ,64816 acres C White jet hae nics,Hi 1 bot e 79 |emet 7:on sald.line ota Une old ,r Sim es Senate tate Wh oreland,H ree 133 ‘arson,M , 5,|Comprens Pad 'Mel.Hand.larrictt,1 : 1.07 12 poles to »;thence 16 1-2 poles i eratie .mons,befor against ©ite,A.P.D.,4 ue =.Steele,alinda,106 2.8 Imperial F d &Saddle © 1.92 Mel »Henr .lot ...ta |net wit &stake we ¥ :“rimari ore th Chambe »40 ae res waz .Lonnie,)weres st do Furnite Co,1 an ee lem :83 |ginni hh said li a oe Kitchi P aries ne e Dem «ers,David,2 ren 1 mer atesville G are Mie.©lot h MeLeltond,Ff.4 3.36 mene,coe ne be 1-2 rker ‘'in has ext spr’o-|Chambers,id,2 acres Ae)sul Whi oe 66 Gee Light @ Poet<1 lot S417 Me loud.Rmma,1 tot 20!ntaining 7 2 poles to ; ‘United )sells —oring _Gray.Jno Sophia,9 1-2 neren uae Hayes,fae te Belinqnonte.ca9|Adains,Henry 42 Pett Co,1 int di eae 2:nS ae or Ad |Ave._3 017 4 nT WEATHER:— heis i »Li 7 an,22 3|Joyner o }Allison.B 4 5.84 Nis :Yo nere ..:.1 =2 : on m polities ae As lor .Mellente 1h 2 acres 2 1-2 acres 1.o%av:i.4,terse acres cease ae —n.Emma,1 = at bert,amet 1 ket @ :2.84 MORTG eee se e will ong as y.Lina,1 2.96 eolman,Hardi fers: 7)ay y.Walter ae &ichole,Fran 1 lot 3.79 A sioner. where |says the stay in th Ren 36 Smith,J.ardin,<0 “16.19|Salley.A ee *Ou he ei!GE SAL . sition,he occupies correspond t,oe bite Delinguents.,ss Hew acres 1.68 |Harsha,Andy Alfred,1 tot aes Petty,Marth i tot beg.Under and by E OF LAND, tha a muc :en wodm »106 ae Summer» "ele:ae 8.14!7 nett,+Andy.1 lot :‘84 |Petty,ba,1 46 thorit vlstan * i tain in oe cin.po-Vivier Mrs L..97 Ie were 'Campbell.eet:i ros i 04 |Deteon’pry 1 Sie:earn ae ‘se Pickens,8 W ,eves se ds pas aon in two ~!wer and a iv 8 : comm zs rn \. .2 i ..ce - or Mr =upper —=Feat dee..2 198 notes 'Rawat eh ma.Gi serves va ,su Daten”Nat 7 -:‘m Sankie,Mack,:1d were i.on taccuted rn fonits yet:ain enetiien i »Kitchin i of Smith,. ‘Sicws.t.4 allstown. a ae |Beeles.»Nannie,| 49 oaeet »Lew,| ‘|Nove -‘has.C iden and wi ; (tati is party is now le .Mrs 16 acre: rown,W )nere 2iz.Kride lot ,Ella,lot ‘vember,¢c. w {tative bod ty in the mov ead.Suvder,Mis 60 neve {j Clark,Lee,26 wener Feleneter,Melvin.1 86 Rhode 1 lot Ao"recorded i ‘ma in te oe a a aie k the co y in the ove represen:pres oper ears Carnet i meron.ua |Gray.dn vin.1 hot <3 ban Gee 1 ay |mort soll gyre sum of $145 ; rrespo wor,conti "NOPS eanediog:oe ormetius.weres,2) G no.H..| los Shereae oe cacee deed )at page :76,and “s ndent i,continu nes,Mrs.W ardian. jilteland,1h —03.|caress,Me bot 83 Sherrill ,1 hot 9)|November exwcuted 266;2d _ |peaker C »and furt ;wn WwW.RR.1 gere 4;ihe i,CN:3 ut 4.15 Ham Tearet,1 bo 4.79 Sm 'liam |basta r,1014,b on the 30t!»One 'ola!man and oma a a Arthura,&Coddte Crees as jae in 6 Oy iseee oe ices |me er int Se peg Hei lot :243 |cousty,Ne =Blisabet‘ee and~F j tire from ele ould tue eae be an —Brow pt 1 lot 16 |Hath c "aia 7.08 |eee Saenen :lot ne Smith.J 2.:lot :1 |corded in -_?.the Sr ae +an E phic hi er re tans,ae.,5%ates ..ee 11.09 |w .lo |Steelm ee, a 32 |Boe io, .and BE '—branch .or even oe Berson 3 i —329 eck.w A.an 1 bot 108 |hoon,—I tot 4 40 |Stevenson Mattie lot aT |Gawye to Chari were oe whieh an : ‘g,it is e gove ,rown,W .1 bet ang:dey,Stella,Mori 23 acres 1008|eee Hen umes,1 lot 27 |Steve ,dao.WI ine been me ries C.The by Eli $vent Cla contended rnment Brown,W D.,1 lot nap |losey,Stella,27 a bot »'gg |Rimbro rietta,|tot 10.9%!Stockton.David,1 {ke and 1}made in the pe,and def beth q 'Speak ude Kitchin f ,could pre Brown,A.,i2 ae se donee!Sallie,64 _— iaae |Marsh “an.Will,at 1248 Btoe ton,Ed,1 |1 bot :24°|mae ateven thereat papen af ‘fault hav.7 er of the rom becomi =|Casket »,James W rea,3S lots eeei2 ey,Mrs.8 4 acres Moore.Susan,|kr ot aor genes Tom.los ‘44|te 2s,the undersign secured by the note : eventuality House.|ccoming Ce m,AW.6 12 lowe peieO eee Mixa M J.,60 wer 1.68 ve,Richard “ aie Stokes,Annie,1 tot 3.85 |the highest b ened will y said “fl j Speak y he would .In such gr Cook,WoL .6 lute ohyo!Lane Ista Ci,is on 5.14 Moore,8.I .J tot ie Summers nie,1-2 acr Pee |in States vill ‘dikes.at Oho sell for mort er of d be th an Cranford,.2 bots 1o0.g9 |Lipps and Mills,¢acres 5.19 Murphy ow,1 bot 82)Sumy ,Mack,|. inde!M le,N.C.:court he cash 4 North ©the H ese Cr d,N.P seus?Sardd Mmcien el me Sellen JPL 623 mors,Sten,(lot 7 ef ie bay.‘sirrete oaks muse deor ; Carol oune the &and Cranford.A 1 let sox |Plott,J rhea 61 meoes 56)aeker.G.C lot ;Summer .0 lot Tag »follows ,SEPTEM wk m.,on p thaniel “ina has State of Craven,F re |a Pope,ff Mt kh acres 210 Meletia ,1 bot 6 11 |Wile s,Wes,1 | von |,Eivet T mg described br RER 3d,1917 4 ‘Macon is th ever had Hl Ccece are ei +4g |Pope,HOW tn .2.70 |Niehe nd,W.Pt 1601 |Gane i West Y trede Troet:Be tracts of la i,; the St yn is th ad.N awell,18 er ¢.Pope,M ,2)wer 1.00 pun,J .1 lot aft .1 let «il count ing in Rae land : 4 he State wh the only m Na-Deaton,3 M..adm eres |#86|Robines G.,3 bee = 4 Pearsor oaephine,| 7.46)Watt.‘jinee,1 ke follows :nty,and dese;le Mills to: : tien of SF o has ever he an from |Deaton,Sebo ae 66 uatea 46 |Robinson,— 1 |gperri:‘Sesion 1.lot a0 |a t,nad t coe Eight =aayaea ead sonata, : Speaker.”jer held the bed)bette 4 »Llot |Ukr)Wel cccacres 10.60 i te 6 ot 7 on =tee 6.30 ||of uy place,oat ——— p +e posi-eaton,-Wis :Robt +eat »1 det 7.Thomas,EB .4 low |Weave mest,1-2 ae 4.27|and ve,ad .on t Young G i Pairehilds,JF.ioe romee fF —aoa |White.|ee 1.43 |Weaver,Hillard,1-2 sven zon)went =ee me &‘tue’Gatton ‘ Coes hoe a 8 !man Ee ; 2 Ba |Woods evh,1 lot 15.64 |William Cale,1-4 acre 353)Meh &partly by Chas C.Thar ton f Back t ae RB lot»4 ot ‘routman,HL N.,1 lot 1.27 |Woods,Dave,|he 1 at Rica Mick 1 a 3.58|“S,ntaining §ca Cees enn the ; J 0 Adjutant’:Palin”LEC ,hot <froutman,R N.,60 acres 6.06 —_Vina,1 a arn aoe J ."ot lot ,ie 08 |att cond Tract:in tenmore or le pe on the f Effective Se ob .aes Me kG ee Mrs a 110 weres pa Gritiin &Carson,wr 4.88 aoe om,Mary Ja sats .:a ere ood én __Mills townsh I W.Yo ;sember 1 G cant eyed ce lots 16 rat neon,J.0..68 17 seres ;.89|Stevens Tom,1 lot ot esl nger,Emma,he,|lot .«sal ee ive acres an Hoary and defi ip,tre. eral ‘t will be the General |Gudaer,Min kW.\ne nore 1 23.06 |Mav [a te Webb,R dno,1 ke ‘24!Bickley,Mary,|let ”1 eis ‘be.ce place,pa we on the north aoe Gu of the North C.Adjutant Ge *iposbriont Ww.am acres,|lot 1 i947 Sn Charles ite Woods ee 1 lot ~ 6.84 |oan Btella,1 lot aa |morte oc and ata Charles C he or i —at —National Hurt,D *Tom,1 let |7 Rance,Hew,ae acres 56 |Woods.Sotact,;he &.62 Campbell,Malin “. #11 |south,cal was ola tes C."Tharve 7 jee $<o 8 tional,Suster Lt hot Vandabkara:L. 2 ,1 lot :9.29 |Cammy .linda 1.8 CH own land ;Ganae uesday by G commissi Caan Boo. aderbera,Pet 17 eres 2.041)pa —suic phe Mkt 1 hot 1 CHARLES C."an te al Y y Gover Hssion edell os lots ,Peter, 6.84 rnhart Fi ‘|Camphbe!.,1 bot 8 ELI,|THARPE E af em su efoO phate Bickett.ala si :Dishman ie”aes |parahert.cs a a hes |Gerseae Me te.h 1 hot CHARLES atte. ‘ yeurs of jutant Ge Johnsor «3 use,2 bo |Mil .Mrs.N jope.uM Barkle:2 J.EB,8 |Caress,We vie, ;WiA 8 C.TH .Morten 4 tration and he of the Craig hate enna ks JW me tn |Blane.WP ianey,74 neres 1.35 Sasstege H.A.6 ore 25.36 |Gl rson,Wood,|roe ::_.Bristol,Atty ARPE,Ass mee. eral and e came Brix adminis-Kenseriy,KPT Wt acren :a hk in ean A.1.64 eres piped p=omegd Tessie,1 “o NOTIC me ee Aca &seit i olina br ommanded th gadier Gen-Kerr,Ka J 0,611-2 'Pri aps,W.A Akg aeres 47 Bowles,A.E.,1 lot res 4.02 |Feimster,Luther,1 oe :tae CE TO NON " ;wrigade duri ve North ©atie,Volt wes OP ath gcsae .70 |Brown,Ro 7.70 |r,Nell, tag |NOR" -RESIDE.- the Mexic uring its s Car J fash,ties te 948 acres 1.80 |B nw lot 738 Feimater,wes 1 bot :wz ORTH CAROL NTS. ter,who ee Col =on Meteh aia aes mesard,1.a.BO eaves 2 ane Carl,au lots 6.65yma W oH.e 1 tot oe eH &the panetsne.sme ae and could d been Bri S.Roys-Ove!or,WOW,4d 1 Wot haces a.P +218 acres 82 |Carter’W..2 ae 12.89 |Hw ¥,Mollie,1 ce the ce Freneh,rt,Before the NTY. ‘not gadier G B-cash,J.¢1 lots Sprinkle,J.EB 97 nerer L4G er Bros.,6 neren 488 mpton,Mar.let ;the wih anaanus administ: Clerk. count of h goto Me seneral iatterson,R +2 mer Speake,Ro K.,56 -}Jashon,aT ,acres 19.on.tans 1 lot 6)|individuall xed of P.B.o do bon ‘ é Adjuta ealth cor Mexico on Pore,J.OC 1 Ihe en ‘aaa R D1 neren 568 Campbell )eres 9.69.¥,Lorena,| 36 *y,ve.Henr .Key..with ‘ nie ditions ac-Reid,C8 acres w 2 Ww feres ».06 |Cald dW Lk w = it rene,J.R.ry K.Klingender,,and ;Gener ieneral i »becom I tA ne iim:»Y ae cal oe ts 2 of ago lot 161 |Duingertield Frenen,M .PB al Yo in the ing Rebertas 1 test Willi s,Bob,16 res é Chamber a C.,1 lot 91 |Holtsela »1 Jot ogg ins.M .Henry J .Mra,Virgi .Be Now G oe:place of Stern!m.Tom,1 va 2 PT ideas Site Fe.1):ae |ieewetee,w.M 1 the vs,George C.J Key,Gee nia P. N we Ld.4 lot iNiame ,26 ae 6.02 er,F.a.1 bot ‘é a.OG.een °1 »children C.Jenkina,orge C.Jenk BY Adjutar ieneral Roy Shue,M 1 hot .&.b,67 eres Couper,J »116 we 11 |Kestler,©.M @.,3 o 44 |dohn MeG of Wm.T .Anna K “4 wy .it G yyster sre Sk Mrs Ellen ..67 ae 4.92 ;i,eres “51 ro CoM lots Ci,A .Key, ¥General Yau.te cive pines as!Stollis =Aer le :- 2 |Shaver,Mre ee climquent ie Day.T ‘.'‘o.ne 56.08 Keaton,Well ot cit uieemie cheve named Ol iit . e mustered s,who is lace to Tet we WP Be $00 F.,98 eres ‘eile tr i deed 1.22 |Kin,rlie,1-2 17 |Mrs.r PBK jendants War I into th is hot t Will.W.Tt,&tot 'pwles,Mrs.Olin —Dellin Hoy,1 le 62.40 eee Will,1 tot,here 1.0 |Virginia P.Dais Preneh,2.|Henry K depart e servic o be wee tS m merey rae ace :.ot—SS . 2.66 |iow,Wot,1h 2 44|Georme C.denki Daingertield,Hi R.French, era ment as e by |Warren 1.1 be Feimste Mrs.MC »entnte,.Dishenn ol ee 66 |Lyne,Doct 1 bat 14)|Anna .denkins,M eld,Hen: ae new Leo.cplp Five |yee 'a E ee |emenese 4 a ‘se i prin neres o Fox,Mrs.tickle acres oa ee.{le 2.06 |Kev,aa je ad wana re.Genres ”sewing '<ny bew oung,J lots 1}|Gate ..7 en 16.4 ,E "1 wer te eeleon,‘arrie,|ie 2a |8°above ce tha w te Soe ce:Pome Ste meh eet iste £3 Bata 1's 28 Bee iB ata ar oor ok cia al.Geor e the resi Sen Gakce rank,147 acre nt|Latten,Mea.Me 26 acres 6.80 vy Wii en :30.68 Addie,1 ‘gy |making sale of county fo Superior and di ge L.Pete esivnation ashiv M an hee acres 1A Money.rs.Lowan res ryt Mager.J.1 iM.6)8 selene \\«arr “gi |therein,pont coitaia r the purpune ®6 isbursin rson as of |Chrinty,F.Eo14 iv ae &ey LP..1 acre -Mosbie,J.i sd aan ores ..11.68 C..|het og |will of =gintte weal eatate of effeetiv g officer,this property |Davis 4 VG.watale,| mee A.4h.90 acres >oJ.F,28 36.86 ee ty |dete ae oy ae situate e Se ,this bei y is &Wiley tate,110 9g |Reid,B .90 ae 1.04 ;‘ae le 4 Lelland,FE jot “41|defendants will ilip BK the 4 Account of September |veing al Bearman Hey Bank acres »54}Bedm H.17 res on YG 1-2 weven |...53 Letland.BL.2 gg|are requir further ¢oy,and t >tween ©personal dif This is fem a 104 neren itelion ¥R.'Y.,ho net :3 14.44 |MeNeely,Y Guest kt Lug|clerk of ved to ageunr at notice that said 7 Col al diffe son Perr Moe 1 1 bet wh,V .50 ae 62 10.91 »Lau bot |at the Supe:r at the they Youn ol.Pete Werence wrrell,1 bot ix.og |Shar R.,63 =« ze MeNeely,J ra,|lot 4.66 his othee |perior Cou offiee of e H rson ar 8 be-Muthes Vid ‘ad|Meoet Mus.Gaevecia, 2 8. into]Giepan,Nancy.|-1g|day of og th mag al nek ceo named 18 success id General Pt on,Jam 7 cast!at ob.F merecia,26 4.46 . 6.14 )Naney ak eee 1 the Ausust,1917 ville,N.©county ' .., erry,jes '.F.,3 : not 22 |rant,197,.on 5 named until General Yun.«wi ak ae Mas Sie tin le were 7 ie eee oc:ae Se eat tian en ‘Soto YE Somer ar ca 2B Maren Ee ape ay Mabe.“a it)Fr:has ES Sai eS Must al ete a 1S aren 1.46]Walker,T g 16 eeren waa ippard,T.1,eee 6.62 |Seot Jno,1 ia 2a0).McLaughlin,At 4.A.HA Serve mther |eG 1 het ban Goforth ,84 ae +97 Lippard,J.J.,Wh 16.it,Magic ot 44)_duly 20,19 ,Atty.Clerk It is ar te End of W onal a 4,|meemaber,tw.=5.8 Si bee 109 |onhs Bh Dot ees rns |RE se ;roi «that nnouneed f ar.an.4 Ww tot Ls Lh.W.,20 wer 248 we.8.Y.1 ‘(aa 2.98 fipann,Jack,1b:1 bot 8 |SALE | every N rom W Geen 4 ae ‘4¢|Cam 20 aeren 2.42 |Mayberr .PT bot of lot 1.58 LE OF 3 the Uni y Nation :ashi dome ce <<»pbell,And 2.67 y 8 Rt bee rs there.1 ke vag |_By vi einen LAND | ’nited §al Guar veton om,Le 2 meres 9.92 |Wasson y.3 6.1 .Mins Ji WS oe cccceeeeee 6.97 yt bot |virtue of ‘ | ser Sta rdsm :©,1 bot 5.16 ,doe,8 eres »Julia esses aces ,07 |Stewart,J Rebecen,AEE digg |mde in an order | +Ben an oo eae Coe 17.68 |Beckham i. taht A.8 noves ...£19 |Stewnrt.Bam |et:4.48 oT ‘Tubithe.‘Trivett,va.af the Superior Court | io a will be ae ara”on the Campbeti a 1 bet wed I 4.62 |Bowles,‘a’HL,67 a re.Re oe 1 10 aeres epee o aa Stockton Fran :lot Zi “2 undersigned rivett,va,‘sony exeentor . 4 . .att be |.3 cre, . =e ibe ees Cee g °we,estate 1 ton *1 lands he a hostiliti until Nered cane Mek .Brown,L.,60 .€ 2.Stockton entate,1 q rather ,on rivett,the Ales oni,ireapective Crawford,dene "Foor,2.|Bowen,Mrs dune,ree a BOR TT,i ne 1a ear ea tar bs caer to | expi ©of Bnetl,Jim ia. 2.08 |owen Ree epee 6.60 |Ore,ad 28.06 2.05 |.vt house door the &numbe:pires.aoe dim,|mt aere ;.#8 |Clanton.ve,GO wer ve 16.06 Me COR we vax t MONDA in _hum ’.' » : c 1.29 *Y. ©Guard regiment -soldiers ir os |mma :|wise >£3 qeres 2s 1.96 1g Lt welock,,AUGUST 21,1917, .of compl rict.National badinue:Fee |$85]Sepeeeo Bb .3.om = on of Roving WD.Pe | lowed t ,they ont their ed |ao!ag _1.47 |Hetlard,ae ‘A.1 om.6 oer ‘2 2 ‘3 A situated fe: eal ye not ee tee 1 oe 6.10 hh a ee .% 28. 2.79 | i psy on ow saan ies wate,Witt ae |1.40]Sewer,i,tateFt net - 4 ‘ni conscript or »Fran ‘veoe :jordan,Marsh “— “a 6.17 “7a | Sie alenm the terms of \emec,3 eis,2 1 hap|forden,&C12 #16 Giest rome at te th oe ios,Fem,a"SOT <a.6 an aes wa 2.78 j til the end wie te nay 10,the Fas hes Oe AGERE ey tae “t ‘as ‘a ;the presen service |beet,&»2 bots ;10.59 a.WwW,7 ee 5 1.63 nee eater L ~.8 mate]Bers.WW.(0.de seren sat = 4 >voune.°>a nan ee :as .&, d i 1a c a" dno,Wesley,1 ff oe ,8 seres 1 & age given “a acre .... aeres ; is a ' 1 beet hot nee | S16au ‘ 12.68 * om na.”“esetot .*ape “ waa "a Uaioe ret covbemeene.ont Koen :SEER ir imonntal rf,STAY Bil “Dodaahie liver aque service—|head aches or th is s rou that esah spoorfal will start your some plain talking at Zebulon,take a spoonful harmless Dod-liver,clean your one and a ke county,last Sunday,as re-son's Liver Tone instead of using straighten you qt om yt ported by Mr.m Bost in the <ichening,salivating mmlomel.Dod-ret your money Chiles ade Greensboro News,son's Liver Tone is reel liver medi-|ly take Dedson’s Liver Tone becanse Mr.Pou adverted to conditions in.cine,You'll know it uext morning it is pleasant tasting and yee |Raleigh,where 40 or nN bocnuse you will wake up Ceeling gripe or cramp or make them fick: Pi ate ‘found physically fit for army service fine,your liver will be working,your T-am selling millions of bottles of jhad claimed exemption.He declar-|.dache and dicuiness gone,your Dedson's Liver Tone to people whe ‘ed that in many instasees these men)nach will be sweet and bowel,have found that this pleasant,vege-“with commitiee ..hre not ‘ear Many the net reruing,You will feel like work.ae,liver medicine takes thepiacewithreferencetoouene3:even them.elves,of them are ine You'll be cheerful;full of vig-,ef dangerous calomel.Buy one het-Bertie tae etaad itm th ne of oer:and min.any,ibe ann‘eo @ ;und sisters a or ve nelle -, gpewamee were instructed to han oppor —to take the Veer cae denier om m .Auk ror druggist cient =. committee at Shepherd's t paid by the government for the sol-2 7 pres a aces to building now Tdiers and them to the rt District No.2,Barringe‘cae thai fom ies.He told them’that y well at Farm ‘ife was inst OYtiedfromcarryingoutyourex- —desires when you have IN THE BANK. Your Bank Account depends on whatyousave, It is mot a matter OF GOOD FORTUNE. Acquire the saving habit while your in- comeis small:and it will be casier as your income increases to applied for new buildin the was there to tell the truth ‘and county superinteitoinvestigateneedof building.ions that are belwalkwasorderedthattheschoolresultofthedra’“eTake thematTrinity,erstrict No,1B,)wheres er you find them,”he said,“inGontownship,be located on ‘aid |:Revolutionary or in a Civil|site,the committee m_that distriet |War and the men who were untrue,being appointed to sell old building!to the government have raised boys and procure another acre of land for)who have become thieves and crimi-jsite.D.W.Lowrance,who recom-aks and girls who were mothers of ‘mended th:at colored school in dis-|ille gitimate children.That is the trict No.2,Coddle Creek township,family of ©the deserter,”he said.be located on public road,was in-|“Look about you here in Little RiverIncreaseYourBankAccount.eee,eee er aMMEEY Iaies come.We wecatecurelot.The committee of d in Johnston county.It’s the Lord’s + y achool house io be built near New anti-draft talk would see that theROCIOIOCAOOeATOreeooMNaAIeGHopepostoficeinNewHopetownsmenmakingobjectionswerelast orka ned No,2,Union Grove township,was,truth.” bat Now is theopportune time to open an ordered to add new room to the ‘Mr.Pou said that those who pro-ive euptionaneeitutine.Start right withthem,feed themas Q Account with us.schoo!building,the committee to fessed a willingness to fight on their irected,andyounever will go back to old-fashioned hulls.They procure more land for site,the o\i}but an unwillingness to have the roughage value—100 per cent—no lint.They are clean wn j ty to pay one-half the cost of ficht on foreign soil,were either and freeoftrash.They combine perfectly withotherfeed.They ee,’g an vings building.cowards or liars.He pointed tu do not flux or —estive tract.And they cost much less vd b.¥.Lowsanee =appointed France and Belgium as tke eations than old style hi “”take charve of the building of an ad-who might tell what it means to have eocure results ensilage oder,halls ine MONEY MAKES THE WAY EASY.RB Gition to second schoo putiding in German soldiers make a call upon a Ye agp anceha Paty&it is ee on G EO.H.BROWN .Preside t ER district No.3,Coddle Creek town-country before it is ready.He risked panga meBoyes for nest feeding.at time -e nt,ship;application was made for a an occasional prophecy.One was this cannot be dene,wet down at thirty iT pele te =‘OL Lohaderevtenc Cashier.new cistriet to be formed and a new thai any observer taking notes on feedthe CD eG ifedaak 4aey ship:apetenine,-any to -year abusing om because he i |ee solidate Fift ‘reek school in dig-)coul’do nething but write notes. Hy,oR eee ———<=trict No.2,Cool Spring townsh’Arnot cer was that those now running =7 ”and Vanee school in district No,for Governor on things that happen- >F R E E Chambersburg township.ed before April 7 would never land. old The following bills were ordered A!!before that time is ancient his- ee ye '_re ae a Wilke tory,he said.The people are not .son for feed,$14.80;Chas.Blackwel-piss to elect man who has done seed =:, )Halls Drug Store,to every man one der for shop work,$5.35;C.Cc.a t bet.otend inn o fener:aoe wn me nn ee _soee +meme on-Si .Tharpe for peas and corn seed,$10.-als of people he never knew and Cry-QaedaCOC ree”POL7e ase Co OERPOUL gaty JImp peop A 8 16;1.W.Bullard for labor and sup-(i.more than the kinsfolk.§ Sanitary.pies,$89.51;Statesville Printing Mr.Pou came out stronely for | wn Sharpe Company,$22.50 avditional =cor-taxation of excess ——and bia i ty,:;rec’errers in printing catalogue,ies.These are the men who i“ _Safety Razor.making”$72.50 in all.ay big ee of the war 4 vid The Ideal Army Razor.en ela —;_pr inclon}x sid.H signs stock =—mills ‘on %rove distric QO.»,&€a These are ng re r yr, eae rhe Economical Home Razor.district,be paid S50 per “a:;thon as ~crdreamed .their besst Any day —_—know WHEN; ;“he 'The chairman of the county board).They should pay for their _os Tie ne Gada ee wan and the county uapertntendent were veo!fortune,eeeee But “you know WH ERE you can get prompt and ®.‘authorized to sign iores for $2,000 Pp from ‘mer by roComeandgetyours.san"from State,‘Loan Fund te.‘That the sale of meat onhemaleofmeason Tue ways sure relief frem the ills that summer brings. Statesville Grae Schools;it was and Fridays be prohibited throug »Pp Tp > HALL’S D R U G STORE ordered that $500 be paid Statesville out the United States was a recom:Gur PRESCRI TION DEI ARTMENT affords.you, eu 9 Graded School for buildings on the mendation adopted by the United exclusive attention and eminently efficient service Phone No.20.ground that a like amount had been ‘Master Butchers of America Tues-at all times =ee a a ;—to Mooresville Graded day.ial of ‘Schoo!for same purpose. and ~The county board of education,in MOTHER!GIVE CHIL dD Leave your troubles “ON THE SQUARE”! ne ——-—er —“SYRUP OF FIGS”1 ife,l ?e same committee in dis-"cy’¢we,iriet No.2,New Hope township,ap-TONGUE IS COATED:’POLK GRAY DRUG co.‘pointing Roger Redmond attendance HC Keverish,Sick,Kilieus,!: eth licer.Ordered,that m:.::er of the Hf Cross,Feverisn,Sig COCWIOCHOI IO,JOOOOCOODOCOODIOIAALIO AAAI OREY re employment of stenographer be left Clean Little Liver and Bow-=-—————— ate .county superintendent until needs!gs! =I ial :::f ".ar tenes tee”ware ordered Children love this “fruit :peur |* s ersentially an institution for a paid:"and nothing else cleanses the tender ! >%.“>Ss Pet,ly...2 Farm Life School expenses,to Dr stomach.liver and bowels so nicch ©ne the ee :it _eagpon y —dis.A Geither,bucket and rope,$1.A child=imply will no cto le vine as _of t ‘it ee tai La ring 10;P.A.Laneaiee.lumber for do-ear Wiese ee ch oe yeti : wer an as well as the siness man mestic seience building,866.56;P.B.*npebbicsha Pee Ls e °* in .Kennedy,corn,$59.96;J.E.|Sloop,¥aste,liver gets sluggish,stomacl splendid =every a Sree <upplies,Bi;Crawtord ‘toe eeFe or te onesies he:gee We are offering some .values mm managed Bank may offer.ompany,trees and vines,$19.60;oo ;‘“4: +W.FE.Munday,piping I line,Sleep or act naturally,breath is b ad, _$8.28;py aaa ..hee.system full of cold,has sore throat,White Skirts. f ;e ;a =godze of special tax stomach-ih or diarrhoea,en election,$2;E.EB.Ervin,serving »<Mother!See if tone os conte,\=Merchants and Farmers’Bank,{icici tia tas ciection $3,1 then ive a soo pooniul of ton 1 fot $1.25 to $1.50 .98 OFS ile N.C A.Chandler,listing school tax,5°.-M8 Syrup of Figs.ard n ai few ve re re ° Statesv 9 INO Y.ho;D.P.Sartin,listing names,§2-hours ell the constinate!waote,sour 1 lot $1.75 to $2.25,.$1 48. nn »°42:.F.R.Mayes,serving as register bile and,undivest)d Sood passes out ».mt The Bank For Your Savings.te special tax election.$4;Iredell .le —and you have a well,Tlot $2.50 to #3 00,-$1.98. »clephone Company,uly service.,Playtal che agin,: ":>.:$2.60;Statesville Realty and favaat.Millions of mothers rive “Califor I lot $3.25 to $1.50,=$279. F 3unch-C.8.Tomlin,at i I .pees ,Cashier.ment Company,for insurance on tia Syrup of Vies”beeause it is per- .’.Le onb ice >'.~nox A 2 ;.building in district No.2,Shiloh feetly harmless;children love it,and .. vd L.K.Lazenby,a township,$22.77;Z.A.Dockery,use It never fails to act on the stomach,We still have some attractiye Shirt Waists B.DI R K¢"TORS.of room for ihe examination for liver.and bowels.a ps ‘“ :4 a —"—Statesville ;—your dee ae t fora *cent left im Voil and (repe de Chine,We are ;*rinting Company,>lies,ttle of “Califersian Syrup of Figs,”,‘j =c.§8 .Tomlin.W.S.Pagze.$1;Ries ‘Printing ‘ca peer which hee full ancien i babies,very anxious to close out this.jot before K.L.K.Lazenby.-E.G.Gaither:y rinting envelopes,817.10;county children of all ages and for grrown getting in our new.line.See us before 7 E.B.Watts..j.A.Knox uperintendent,postage,telegram,ups plainly printed en the bettie.Be-‘Oe,.“a J.AA.KNOX,expressaye,ete.$5.87;D.J.Kim’ware of counterfeits scid here.Get buying millinery and Ready-to-Wears,we ~~J.L.Stevenson.-J.R.Hill.bill,oil,40c,the genuine,made by “California Fig will gave you mor Ee" ted Clarence Stimpson -Herman Wallace Syrup Company.”Refuse any other save |none, rior ".In the War Zone.kind with contempt.of R.T.Weatherman.Fl ,:we landers,where the big guns have the heen booming imeessantly since rain |}_Ra)9 Oe ee ining Co.MRS.MARY SIMSamentcarlylastwall,he aoe hee The Brady Printing Co.|:He ’ ae.:BR the scene of infantry fighitng,tut }+r ~.oh :A only on a small seale.|Ihe Cash Store.‘ig ‘N neear,the const the British ha Has taken over from vcen successful ina Pa t \.|.,D German lines.Bertin officially (ic R.P.Allison the wr rorce,which ft enna,the Geman,|agency for various r —_—ee — Every good citizen at this time should beat off in tmebepeuna esa Magazines and Book r HE STATESVILLE wrt do his share toward strengthening the ee hee”||Pbilentl ante |’|=Federal Reserve Banking System which ol stealFeeGoes |||Publeationsandwants 1]REALTY &INVESTMENT COMPANY the Government has created with its a ee a A h liberal patronage of itsm4billiondollarsofresourcestostandbackCoommgwita,and kage Ctkepeed ou...|Spend te Moge-or =dee re EW and OLD. “of its member banks and all their de-Semeenof anle Oeticis,|xines of all kinds.Will Our office oa pi one,and we invite all our “=—contribute directly to the od came ues oF “Choir order any book —|customers and those who will become customers th strength of this system,and at the resulted in the capture of two vi!|All Magazines oncoun-|to use the same when they so desire.Asin the s time secure itsproteetne |by depositing ee ocrtiemene |oer Seeman ome.past,we will strive to give the same guns.The Teutonic effort near Bro.——_———_——_—HIGILGRADE SERYICE Sa g e t back byacounter-attack the Russian |Dr.S.W.Hoffmann.confidence of over seventeen hundred patrons. lines _——At other a,how PhSeonGrameedet.oe i “WE INSURE ANYTHING INSURABLE”and PAYALLever,fort Officehours 9 a.m.to 12.80 p. HONEST LOSSES IN CASH WITHOUT DISCOUNT.‘resses ott cae advance of m.2.80 to Pe we io >hae call at our office forany informinform or teaphone1 o.54 if our. wedo NOTARYPUIG wokshe Cordiallyyours,.Ld.F.CARL TOR, | a “onations te ean ines ——|that has won for this Company the will and ae |i . EP l ” 6s h a t e LANYD) + estes 10,1917. ExemptionaonExplained. ‘TotheBalter of The Landmark. There is considerable —criticixm“ine folks,concerning working board,Some rstanding and some a old-time “chronic kickeTtiptosetthefolksarightthat|per this article. lat.Some are kicking on the factthatweareallowingin.s to fix exemption,and to this I wish to say that we give the blanks to those asking for them and tnen tmey ca! them up,we have nothing to long as they do not app: 1 the board., 2d.Some are telling ¢ emption board is chai blanks sent by the gov: which to make claim fu and to this |wish not,and never ha.:i that has ever been 6 thing was when a fe "tu asked me.to fix them up atti vits befere the governn t 2 came in,which IT dit,a charpy them twenty-five cent same.This I wish tobymewithovtthenow board and after insist part of those desiring them wish t ite that since the ernment blanks have ces In,th the 2he.willbe or Teal ape mand The Governor ha viven the mombers of ‘utherity to adm this will be ck free of H.<.PRIVETI ( Seeks Knowledge of President Wi nitention to th and paid a per eral Trade Com: dition of investi the cost f pro!‘ quired by the pov !t \g President's dir has undertaxen Mine produ the basic suppli uses,including cou petroleum,tin,aluminum,v copper,lead,cement,a their delivers TRE MITCHELI.WESSEN The Alumnae A ateor Mitel el College met i the college Tucsdas sider ways and1 eto | Prices on pallicatie a A HITCHING 4 Witching :Wuilding and ott people who drive t t4havediffieult :hitehir plac MI : The Landmark to ow that |writ a ;fhe a hir won heforhitching y are w the use of th talls and the therein " venient DOG NOT Dr.TLE.Ande :ngressman 1)rhton’ dog .waonhisdo ayer on *y ivaner and thes t ’t take } deg off his oh Knowing the clas {the foetor Hh oy } more thar bE YIELD OF ONE GRAIN :Mr.N.P.A ter,who the edye of Ale:j ed one rrair ¢1 ) pred:iced 4)head fron he | hear th .‘viel! @rains,aces der’s count tience at The | WORPH TT terday THE MAYOR'S COU RT: i In the mt Boo for «)' tr or any (,ly fer iff | et a REP CROSS SEA A iW f t ! {4’ ve fa ny v} WITH Hosrrt at bt |’‘ fy iD bey ha a MERI Th of th ha t called off the } bows 'iconet) Dot rr wtowt f Fremdinernr conditions and t treatmen + wy F.4.f a ¢ Cometit nth me ‘arte throweh the W ‘'oe facet of the 5 m One Minded Pelt i offered for ake ener thet Bal ‘ Cote toe are Rem fer « %.CHEREY &CO,Totem,6> eat.or constipation oe “est -bearing out the affidavits for those who claim | either fix them themselves or et any one they wish to fix them for «' them.[f they get a lawyer == ‘DR."ALEX ANDER'S”SAND.|‘Thewrynotes,bonds:heen towhicharepaidforin‘bank credit’!oo Bautand,“aptieforthegovernmenttocheckagainst.|o¢the ere~In our country these bonds are ing to a tateshoughtlargelybythebigmoneyiitNows,Va,by kings who own all our munitions vteamer.There wale 6-cylinder,41 H.P.5-Passenger Touring Car. Thewonderfullittlecarthathas made such a reputation in Light Six Class and whichstandsalone in its price class.$945.OO Our first shipment of four cars has just arrivedandarenowondisplay. .O.B.FACTORY. 2-Passenger Roadster. of the Oakland Six. 5 Prices Still In Force wee A ee MILLS &POSTON’S. and Skirtings of the best quality will besold by us at last Season’s further notice.Now is the g saving in these staple lines. Yours truly, MILLS &POSTON. plants and other large manufactur-|.iuoers on the steamer, ing enterprises and our railroads.ny of the erew re‘he money trust will own the world jn ns was not stated 'S : when the war is over.w »of th r“One other thought,end this is in te <a (the Americanson bea’ chalf of the people and for the Were ore ee | ace and welfare of our State and a i ation.The people arc sorery tried Evidence of pinoy War and =conseriptio have both One focal retail merchant soli & en foreed upon them ai one fell within the past 60 days 500 dozer woop.Their sons are being‘snat h fre 1a 20)gross ee jar rub- ed away from the paternal home.4 _250 empty barrela,40,000 t many of them never to return.vevnds of sugar "This will give some even in a box Mothers’hearts.idea of local interest Mm can and rimost breaking now;what will preserving truits and wv when reports begin 4oming SSE =SS from France ef thousands be-GIRLS!LEMON JUSCE led?Father endings IS SKIN WHITENER'Spit hin Gna fall ‘ thi \How to Make a Creamy Beauty Lo- onic Ont holsltar rear enl!tien For a Few Cents, ;het aller!rhe juice of two fresh Jemon {‘bor tinued trnine |into a bottle centeinin:‘h than mil ounees of orchard white make he Nn I suld on whele quarter pint -the most rcneofthemforallidlicmarkeblelemonskinbeautifierath‘inition it the cost one must pay for a ifactur :out {omall r of the ordinary eok¥id roan Care shou'd be taken te H ;f t rf ‘lemon juice through a fin:ei Baik :rn ae ss th no lemon pulp gets inj the: th )t 1 will keop fresh forow|nalat months.Every woman kaews that (‘it wet mer 14a ised to bleach and re +}h efallen wh blemishe as fre¢kles}rt loyal citi Howness and t and is the idea '‘ner and beauti }They ‘;hf?Just tr Get ce ounces of nt sand ehard whit t any drug store an and j rom ne grocer an th {\Mime ake a quarter pint of thiwhotfwar‘t we weetlt fravrant lemon letion an t hay oT ‘t ‘i !”inily to the face,neck ver hey .ro a |hand ae |NOTICE £0 CREDITORS, me ed 'ninistrater of th t .ed,this in 1 =ayrninst aniropea5hitorbefor: tn t bic wi pleaded i ;tla oy tndebte:::q ts :immedia)t .ert t WE \THERMAN, t ats't y.Iministentor. H.Q,ALEXSANDER”os (6 nd Men should Not Be Misled.”-NOT -b TO (R Dt TORS.‘ W }t '\at 4 aced,batetitudyH1mm,this is ¢ the Pr ‘n ae the vhibit)the ttimely.Under ‘oald ae 6-eylinder 41 HL P. puver uy n duty ¢ "We \‘,teal iin bur ¢ :bted to th a 'f tte settlomen‘d th <,‘H HAG f eats }nalitv of tt \oM i ,Ww.At \t July 6,2917. ee ty ;z ,:oe Epry °°e e,ethatelSOa,Shee OF UY TEURRETA:We Will Be Delighted to Demonstrate theSuperior Qualities fany ef Amerson ert ‘aL ;sree ete eye ne “Samony the Beprosentets ‘the |t bidder at thI YOUNT &ALEXANDER.The ‘'bur the ur ent 'a vibesgritbtinttiemalityWwe’to-wit et ‘-=iin oe hee .;na “|—or moe “|Last Seasonhone|;an |,RED |o.the U%‘I .NS .‘| be vais ef a PINE SHINGLES!|WONIPER CEDAR SHINGLES!| RED CEYAR SHINGLES!| ;Ridve Rell,Valley T i Green Shingle Stain WATKINS,Shingle Ku °P IsCountyGinghams,Percals AALTC—O atte STER, PREGISTERED AKCHITE prices until Ame ,.“A fe *..- ——-Statesville,N.C."Phove 340 Green.time fora biountsandCityAttorneysto Take Appeals.=:ttt ‘ed PTI fa,HIR’S In Bottles Sc. :‘~las stood the test of time.—— a.AATLe be.PETERET I NEAG ae rp ’\4 ryLESTWEFORGET.|TRUNK:x )New is a good time ect that Monument for the i loved ones who hiv ne,We carry a larger and & oD vied assortment th Granite and Marble in? a ince to Drall. t Monuments,Tomb-!and Markers to scleet from.BPricesreasonal Barron &Conner.4 Phone 215.118 KE.Broad Street.4 DETPM Sapa +2c NRE Nod 'Need Glas C et UWhenYouNeed\ew Glasses Come to Us.: i aft od tt Aid A r Yay | y NEW vla honges.W othines {'ONT new via { A My ty R.F.HEN RY,Jeweler. Ml \:micuntent :sets hs Cnlcuur AG FOUNDED 1838 CHARTERED IN 1859 mont ry rrRINITY COLLEGEHomeNewStirling.Coming ot DURITAM,N.C. *.al t ” membre rN S tine t A College of Wheral arte with an eetahiiched ml reputation for high standards,noble Hote F t with *ony traditions and prhgressive policies It tar fund makes possible arofirst =‘:Sey .end large faewlty of well tontaall chosen teachers,'Ther vill be @ few,CGemifertatle,inexpensive roome in car Pyetente.’and a flernoon aerviee,Classica!and scienti ewurses lending te degree,Graduate courses in all dethdinnetheground.Please &Schools of Engineering.Baw and Low.n K aeine J B.PEARSON entaloger and HWlustrated bookie,« Poster,RL.FLOWERS,Secretary tothe Corporation | —THY LANDMARK’S ADVERTISERS ARE UP-TO-DATE. ive& BUILDING? »SUIT CASES AND HAND We have just received a large shipment of Trunks,Suit Cases and Hand Bags. Now if your vacation needs requires a Trunk, Suit Case or Hand Bag,it will be to your advantage to give us a look before making your purchase in this line Trunks,&5.00 to $18.50. Wardrobe Trunks,$20.00and $25.00. $5.00 to -$8.50, $1.25 to $8.50. £3.50 to $12.50. PHONE 83. SHERRILL-WHITESHOE CO. beeresees Those WhoKnowBetter Kiln Dried Flooring ,Than C.WATKING.say ee - won't be cheaperfor manygagre—eee acrn rt,©.WATKINS, Steamer Trunks, Suit Cases, 'Hand Bags, «Be di ailpore iT Z 32 7 at t P s t ;made no claim. Thompson,Strtesville,R-2esclaimeddependentfathermother.Melvin Feimster,colored,States-ville,accepted;made no claim.William Reid Combs,Statesville,R16,exempted;wife and child,Preston Stewart,Eufola,R-1,ac-cepted;claimed depend :t wife.J.Flake Howard,Statesville,ex-“+Lempted;wife and child. amesLioydClontz,James Coleman Galli-her.Charles Franklin Foster,Henry»Thomas William Swink,James Lackey,Melvin Feimster.One —Roy T.Troutman -—-was ex-empted because he is »ministerialstudentandone—Atlee Davis —was excused because he had joinedtheBlues.Following is the result of the workoftheboardyesterday:Carl Maston,colored,Statesville,accepted.Asked exemption ongroundsofhavingdependents.ohn P.Weatherman,Olin,ex-empted.Has wife and dependentchildren.David Franklin Kistler,States-ville,accepted.Asked exemption onaccountofdependentfamily.Henry Dotson Summers,States-ville,R-2;exempted by physical dis-ability.John Thomas Gillespie,R-4,ac- cepted.Asked exemption on groundofhavingdependentparenes.Atlee Davis,Mooresville,is amemberofCompanyEandwasex- cused, James Abner Guy,Stony Point,accepted.Asked exemption on ac- count of aged parents.dames Morrison Bustle,Loray,ac- cepted.Asked exemption on groundofhavingdependentwife.Frank Burette Freese,Moores-ville,accepted.Asked exemption onaccountofdependentmother. Jesse Locke Lippard,Statesville,accepted.Failed to respond to callfromboard.Walter Lindsay Woodward,States-ville,R-5,accepted.Asked exemp- tien on account ef aged parents. Bogle Kerr,colored,Statesvilie.Exempted on account of phsyicaldisability.James Arthur Sherrill,Moores- ville.Exempted on account of phys- ical disability. James Reid,colored,Mooresville,R-4,accepted.Asked exemption on account of dependent brother. Reuben Washington Johnson,Har-mony,R-2,accepted.esxee exemp-tien on account of dependent wife and mother. dames Lloyd R-1,accepted. emption.Clarence Espy Madison,Otin,ex empted;wife and children. Eugene Johnsen.Mooresville, empted;physical disability.Espy F.Benfield,Eufola, cepted.Failed to respond Rome George Lawson Christie,Da vidson,sccepted.Failed to respond. Horace Campbell,colored,States ville,R-7,accepted.Asked exemp- tion on account of dependent moth- er,brethers and.sisters. Otho Andrew Cledfelter,Moores- ville,accepted.Asked exemption on account of dependent wife. Henry Dalton McLain,Troutman exempted;wife and children. Thurman Ciecro Barrier,Stotes-ville,exempted;wife and child..kielding Chambers,Statesville,R-6 accepted.Failed to -vespond.William Stevenson,colored,States- ville,exempted:wife and child.Robert Flake Murdock,Statesville exempted;wife and childJohnSmall,Mooresville,exempted; wife and childSamuelCopeland Troutman,Statesville,aceepted.Asked exomption op account of wife.Thomas Arthur Millis,Harmony, R-1,accepted.Asked exemption oi account of wife. Robert Samuel Overeash,Moore:ville,aceepted.Asked exemption o: aceount of wife. Lonnie Hunsucker,Stetesville,R-2 accepted.Asked exemption accountofwife. Bruce Austin Waugh, exempted;wife and child.Richard Samuel Fraley,States ville,R-4,exempted;physical disa-bility. Thomas Lester Monree HobbsTroutman,exempted;wife and children. James Coleman Galliher,Harmonyaccepted;made no elnim for exemp- tion. Thomas Alexander Rumple,Stater-ville,exempted;wife and children.Charles Franklin Foster,Harmony. accepted;made no claim for exemp: Clontz Troutman, Did not ask for ex- ex R-1,ac- on Statesville ion.Randall DeWitte Bernette,Teur- nersburg,exempted;wife and child.Worley Ervin Smith,Statesville, ex 4;physical disvbility. leWitte Cloer,Statesville, empted;wife and child.dames Walter Sipes,Eufola,R-1accepted;claimed dependent father.Henry Smith,cok.red,Mooresville;made no claim.colored ,accepted;claimed depend. Augustus Aicxander,Mountaccepted;claimed dependent @x- Elmer Clyde Ervin,Scott's,aecept-ed;claimed dependent parents.Glenn Alexander Lazenby,States-ville,exempted;wife and child.Henry ranklin Moore,States-ville,accepted.Failed to respond.Clyde Erasmus Gaither,°wie accepted.Claimed dependentwife.Roy T.Troutman,Statesville,ex-empted;ministerial student.Herbert Parker Clampitt,States-ville,R-3,accepted;dependnet wife.Mack Brown Broom,exempted;wife and child.John Lee Sherrill,Harmony,empied;physical disability.Gaston Turner Henderson,nings,accepted;dependent wife.Dorman Stewart Smithson,Eufo-‘a,R-1,accepted;failed to respond.The tocal board's action on theaboveisfinalasfarasitisconcern-ed.Messrs.L.C.Caldwell and Dor-man Thompson,county and city at-torney,respectively,acting for thegovernment,appeal all the cases ex-empted by the local beard on accountfdependentstothedistrictboardEverymanacceptedbytheloca!board has a right to appeal to the listrict board. Of the 100 called before the ex- emption board Friday for examina- tion 75 appeared,14 of whom failed‘a pass the physical examination— Cleveland Wesley ‘oote,Bentlev Newman Bustle,Archie Leslie Wil- son,Walter Lee Bullin.Vernie V.Evans,William Hall Kistler,Robert Lester Auten,George Pinkney Jus-tice,Odell Overeash,John Andrew Sherrill,Sloan Cornelius Clarke,Tohn Lowe Brantley,Claude Hilton Forcum.Joseph Young Caldwell.The 61 who passed were:Oliver Baxter Mayberry,Collier Melzie Ost-walt,John Jo.Saunders,Neal Sin- vleton Brawley,James Cochrane, Roy Wade Troutman,William Ros- coe Wilson,Edward Franklin Har-mon,John Williams,Marvin OscarSikes,Silas Gregory,Roy Bratton Whisnant,Pearlie 6.Henderson,Clyde ©.Madison,Thomas Oliver, Thomas Fry.James Morris Givens, George Dallas Renegar,RichardLowery,Alfred James,Leroy Sharpe,Leazar Barker,Ernest Co- ble,Hazel Dawkins,James Walter Grover Brown,Burley sionroe My- ers,Walter Daniel Peacock,T.Ho-mer Menser,Henry Garland Mor- row,John Cress Murdock,George IveV Wooten,A.R.Miller,Robert McKinley Stafford,Cobb MonroeMiller,Jerry Mitchell,Alvin Hugh- ey Adkins.Ralph Teacue,Walter DeWitte Blackwelder.Henry Calvin Lee,Lemuel Russell Stikeleather, John Clavton Padgett.Mack Bass, Charles Bikas,Richard Mitchell An- lerson,Joseph William Beaver,Ran- dall A.Lowery,Ralph CC.Sloan, Clarence Franklin Patterson,Rufus Eugene Gabriel,William I.Castles. John Wesley Allison fury MaekOvercash,William McKinley Miteh- oll,Joseph Lewis Harrison,Harvey Walker,Lester Barron —siorrison, Robert Charles Deaton,James F Love,Jesse Ross Bell,Dallas Turner Holmes,James Logan Young.Sixteen.who had failed to respond to the call for examination,appeare+ Saturday and were examined,four of whom Coleman Anderson Deal, David Hampton Winecoff,William \.Darr and Gus.Ritchie —failed to pass. The 12 wno passed were Walter Fli Sherri'l,Napoleon Allison.Heze kiah Houston,Tobe Ellis Sherrill James P.Hayes,James Walter Hayes,George Patterson,William Themas Nantz,Charlie Esker Lew ic,Roy Eugene Gaither,Eneas Lu-Swann,William Durant Hu ex- Jen- ‘oney. TEN DROWNED —FIVEAMERICANS. Five American passengers when the American City of Athens struck a mine went down near Cape Town,South Africa,according to dispatches —to the State Departmyn:t.Ten other passengers and four others of thecrewweredrowned.The dispatches say that four oftheAmericansweremissionaries Maynard, WERE were lost steamer and and name Mr.and Mrs. Miss Robinson and another as fromtheSouthernMethodistChurch. MISS HAIR DEAD. Miss Bertha Hdit,daughter ofMr.and Mrs.W.W.Hair of Elm-wood,and sister of Mr.W.F.HairofStatesville,died Sunday in Green- ville,8.C.,awed about 35°years.Body will be brought to ElmwoodforintermentatSatemchurch.Be-tides her parents,several brothers and sisters curvive, CATAWBA CITIZENS OPPOSE. A meeti was held SatunightattGrovehouse,Catawba county,atresolutionswereasking Con- @rees to repeal thedraft act;and itwasstatedthatmoneyhacpeentoTomretotesttheconstitu-tionality act. Statesville andhavecomplet-d the coursefirstofficers’training campoe Cc ptain of infantry --Cieero G.Falls,Mooresville.Mr.Falls a son of Rev.L.A.Falls,odist pastor at Mooresville.:First lieutenant of infantry—<AllanR.Anderson,Statesville.:Second lieutenants of inGodfreyC.Kimball,William jsonGregory,Statesville.Second lieutenants,fieldJohnA.Scott,Statesville;BiA.White,Mooresville;W L.‘Taylor,Hickory.Lieu:.White went to camp from Greensboro but he isasonofMr.M.W.White ofMooresville.Lieut.Taylor’s heme is in Hickory but he went to PpfromStatesville.He washereforsometimeinthe Fi a-tional Bank.Second lieutenant of cavalryOwenW.Leonard,Statesville.Second lieutenant,quartermas-ters’corps Philip P.Dulin, Statesville.First lieutenant,ordnance depart-ment —Herman G.Baity of_Ire-dell,Lieut.Baity is a son of Mr.G.W.Baity of Eagle Miils town ship.Minor R.Adams and James HPresslyofStatesvillewerenotcom-missioned on account of their youth,but the fact that they give promiseofsuccessisattestedbytheirbeingcontinuedforthesecondtrainingschool,which begins on the 27th.All these young men are expectedhometomorrow.They will be given furloughs for 12 days,beginning to-morrow.Others known locally who receivedcommissionswere:William H.H.Cowles,formerly of Statesville,now of Wilkesboro,commissioned secondlieutenantofcoastartillery,fromhetrainingcampatFortMonroe, Va.Captains of infantry —James R.Stewart,Catawba;Rudolph D,Wa- vers,North Wilkesburo.James J.Britt,Jr.,son of ex-Congressman Britt of Asheville,wassommissionedfirstlieutenantofin- fantry.Mr.Quincy S.Mills,formerly ofStatesville,now in New vork,Whohadbeenintheofficers’g‘amp at Plattsburg,N.Y.,has:beensommissionedafirstlieutenant.»..From the training camp at Fort McPherson,Ga.,John K.Taylor of Yadkinville is appointed a captain of ‘nfantry.Statesville and Iredell people are‘ratified by the good showing of theclassfromthistownandcounty,Nine were commissioned,two failed and two are continued for further in- struction.Registration For City Extension Election It has been mentiened that a newregistrationisrequiredforthecity extension election September 4th.andamajorityoftheregisteredvotewill determine the result,not a mzxjority of the vote cast.The registrars and polling placesate:Ward 1,Moore's stables,T.N. Brown;ward 2,Ed.G.White Motor Co.,W.J.Matheson;ward 3%,court house,W.J.Lazenby;ward 4,officeFirstBuildingandLoanAssociation, J.H.Hall.The registrars are re- quired to be at the polling places Sat- urdays.At other times they wil!be found at their places of businessVotersiitheterritorywhich it is proposed to cmbrace in the extension will register as follows:All living For _— F.|north of Broad street and exst of Cen- ter street and the present Wilkesboro read,in the first ward;all south of Broad street and the road forming the extension of said strect.and cast of Center street and the A,T.and O. railroad,in the second ward;all living west of Center street and the A.,T and ©.railroad and south of theTaylorsvilleroad,in the third ward; all living north of the Taylorsville road and west of Center stre:t.the fourth ward The registration beoks will be«kept open until sundown Sa‘turdsy,Septem. ber Ist. Keep Drilling the Order—Sol- diers Vaccinated—One Shot. The only orders that the loca!mil- tary company have ate “to continughilling.”This the company is do- ing.The company now comprises159menandthreeofficers.About 50vfthemenareequwithuni-forms.The company is allowed on- 'y 100 uniforms.wisition has een made for as Many unttorms ashecompanyisallowed.‘Theretore,before the company leaves ror camp, 100 of the men will be clothed in cokhi.The others will be provided with uniforms later. Capt.R.A.Camvaccinated108mem! Ee,Iredell Blues, ind paraty bStameyCranford,ao member Company E,was the victim cident Friday morning,while visit-ing relatives in vie county.HewaswalkingalongtheroadfromhishometoMocksville,carrying his rifle.rifle al .was dis-charged and the ball went throughCranford’s right foot.©LieutenantMillswentafterCranfordabroughthimtoLong’s Sanatorium,where his injury is bei attended he will’be out into.It is expectedafewdays.. MEETING TONIGHT.° Social meeting of Commercial clubmembersattheclubroometonight.Re sure to attend, pell,Saturday, s of Company against typhoid of ae ndiney ‘bus. SERMON FOR SOLDIERS And Testament For Each ManChurchSundayBvesieg.Church Sunday , The union service at Broad Street Methodist church Suaday evening was especially for the Iredell Blues— Company E—and the members of the company attended in a body,fillingthemiddlebleckofpewsinthemainauditorium.The church was filledtheauditoriumandSundayschoolan-nex...Phe“national cofors were dis-played over and in the chanecl.The page 3 song was the national hymn,“My Country,"t's of thee,”and theYiclosing“Onward,Christain Soldiers.”The sermon was by Dr.Raynal,pas-tor of the First Presbyter’nn churchandwithhiminthepulpitwasRev.l..1D,Thompson,stor of Broad Street.Dr,Romi ciscourse was astirringwarsermon.The central thought was that this war is to maketheworldbetterandasafeplace—especially for women and children— and that in fighting Germany we are fighting the works of the devil.Thiscause,he contended,is the only causetakesprecedenceoveral!others—until it is settled right,and there isonlyoneman—the man who does hisbestforhiscountryandGodandhu- manity.At the close of the sermon 165pocketTestaments,provided by the ladics’aid societies and missionarysocietiesofthedifferentchurchesofthetown,which were displayed on atableinthechancel,were formally presented to the soldiers by Miss Ma-bel Poston,who said:“I just want to say to you,youngmenofCompanyE,that the ChristianwomenofStatesvilleareinterestedinyou,especially in your spiritual life As you go out from us to the trainingcamp,and if you must to the battle-fields of France,we will fallow youwithourprayers.We wanted you teknowofourinterest.So in the nameofthemissionaryandaidsocietiesof the various churches,I wish to pre-sent to you these Testaments.We have one request to make of you-—that you read them daily.In eachoneyouwillfindapledgecardwhichwetrusteachofyouwillsignand keep to strengthen your purpose.“There is just one supreme thing in life—to know Jesus Christ,whom tc know is life eternal.And He is re-vealed in God's Word only.It's 1 fine thing to be a good soldier of yourcountry.It’s a fine thing to be a oodsoldierofJesusChrist.You can’t do it without the Sword of the Spirit which is the Word of God.Take itanduseitandmayGodrichlybless each of your lives.” Capt.Westmoreland responded forthecompanyexpressingthanksofhimselfandhismenfortheTesta- ments and their appreciction for all the |:indness and courtesies showr them by Statesville people since they have mobilized. Farmers Embarrassed Renting. The Landmark is some of the Lredell drafted for the war want to rentlandforanotheryear,their land-lords want io know what they are going to do,and tenants are in aavandarybecausetheydon't knowwhethertheywillbeexempted. Nobody can tell them that until the exemption boards get through with them.The Iredell exemptionboardhasbeguntheconsideratid®ofexemptionclaimsandwilldoubtless push the work as rapidly as possible. One who fails of exemption beforethelocalboardmayappeal.If hisexemptionclaimisonaccountofoc- cupation that claim must be consid-ered by the district board.All this takes time.But as e&portion of the men drafted will be called Septem- her 1st to report for service,it isreasonabletosupposethatall,or most,of those in the draft should know their fate by that time. Meantime landlords should —exer- cise a little patience in the matter of renting should geve the drafted men time to find their status. Four-Minute Talks. “The Nation in Arms”is the sub- iect asigned by the government to the “Four -Minute Men”for this week's talks ut the motion picture theaters of the country.Talks will be made at the Crescent Theater luring the week as follows:Tonight xy Rev.Dr.H.M.Parker,Thursday night by Mr.Dorman Thompson and Friday night by Mr.G.FE.French. Rev.Dr.C.E.Raynal talked last nivht.The talks are made at the end of the picture,some time be- tween 8 and 9 o'clock. The national Committee on Public Information,which furnishes the subject matter for the four-minute alks,has requested that four talks he made regularly each week,andhelocalFour-Minute Men commit- ee is anxious to comply with this request.Persons who will volunteerasspeakersshouldenrolltheir names with the committee,which is‘amposed of Messrs.#.Yaul Leon-ard,chairman,L.B.Bristol and P. \.Bryant. Hurt in a Collision. Thursday night about 10.80 o'clock, on the road to the Iredell Test Farm, R.C.Kyles and O.Y.Bradshaw,rid- ing a motorcycle,collided with a jit-In the mix-up Kyles wasinjured—two ribs on the right sidewerefracturedandhewasotherwiseslightlyinjured.He was taken to Gibson's About informed that farm tenants road wasslick from a fresh rain anditisclaimedthecollisionwasuna- voidable. Pe¥ CHILD LABOR LAW. ber 1 —Sum- Provisions—Lo- Affected. -fourth Congress,Sep-tember 1,1916,passed an act “topreventinter-Sta.e commerce intheproductsofchildlabor,and fortherpur"The law becomeseffectiveptember1,next,twelvemonthsafteritsapproval.The law provides tha:nocer,manufacturer «or dealershipordeliverforshipmentin inter-State or foreign commerce any arti-cle or commodity the product of anymineorquarry,situated in the Unit-ed States,in which within 30 daysoriertothetimeoftheremovalofsuchucttherefromentidrenun-der 16 years have been empzoyed orpermittedtowork;or any article orcommoditytheproductofanymill,cannery,workshop,factory,or man-vfacturing establishment,situatedintheUnitedStates,in which within80dayspriortotheremovalofsuchproducttherefromchildrentheof14yearshavebeenem-plo:or permitted wo work,orchildrenbetweentheagesof14and16yearshavebeenemployedorper-mitted to work more than eighthoursinanyday,or mvre than sixdaysinoy,or after the hourof7o’clock post-meridian,or beforethehourof6o’clock ante-meridian:Provided,that a prosecution andconvictionofashipmentordeliveryforshipmentof THE EffectivecalMis The Sixt: The Civic League will meet the Commercial club this ae rd cleaning ate‘Crock Thursday,16th.ait iteinterestedareaskedtoc air ee,Vera —_has month's visit.Ps Nashville.—The band concert willnightinsteadofSpyreteg,"rrode night.The change is only for —~Mrs.S.A.Foster has offered.Courtwhorestaurantpulltinson the}years any article or commodity under the]andconditionshereinprohibitedshallbeabartoanyfurtherprosecutionagainstthesamedefendantforship-ments or deliveries for shipmentanysucharticleorcommodity be-fore the beginning ot sat@ prosecu- tion.For the purpose of eccurngerenforcementoftheacethe rtaryofLabor,or any one auhoriz-ed w him,shall have authority toenterinspectmills,eve.,to seeifthelawisbeingviolated.Nothing rockintheactappliestobonafideboysandgirls’canning clubs recognizedbytheStateornationalmentsofagriculture.The penalty for violation of theactisfixedatafineornotmorethan$200 for first offense,not morethan“a less on =for subsequent ences,W prison-ment of not morethan threemonthsifthecourtseesfit.A dealer is notsubjeettovrosecutionundertheactnrovidedhehasaguarantyfromthemanufacturerofthegoodsthattheyweremanufacturedmnwiththelaw.Also no ‘producer,manufacturer or deaser is liable forprosecutioniftheyhavecertificatesfromthoseemployedindicatingthemtobeofproperage.Any onevivingfalsecertificates{s liable tosamepenaltyasaviolatorofthe act. depart-|south Local manufacturing plants are af-|dellfectedtosomeextent.At the States-ville cotton mill 18 to 20 employesunder14willbe—and about30from14to16willbeworkedon the 8-hour day basis.The Bloomfieldmillhasbeenpreparingforthelawandonlysevenunder14aretobedropped;and only four remain to workeighthours.At the Paola mill asmallnumberwillbeaffectedandotherestablishmentswillbeaffectedtosomeextent,but not materially,itisunderstood. Mr.Julian Morrison Made Sec-ond Lieutenant. Mr.Julian Morrison of States-ville,with the American sield Serv-ice in France,writes home folks un-der date of July 24 that he was madefirstsergeantaweekafterhisarriv-al at the training camp in France,and the day he wrote 4 had been notified of his appointment as sec-ond lieutenant,He was to be sent toanotherpostfortwoweeksandthentotheofficers’training camp for sixweeks.This is wratifying news to States- ville people,but no surprise to those who know this young man.He ismeetingexpectations.The promo-tion,however,means that Mr.Mor- rison is to be separated from his nephew,Mr.Scarr Morrison,his as-sociate on the trip to France.This is of course regretted by both of them and by home folks,too,but it +a fortune of war. After six weeks in the officers’ training camp,Mr.Morrrson will go into active service in the feta as see- ond lieutenant. Mr.Morrison writes that they are pleasantly situated and content.Theworkishardbutinteresting.The food is good and the quarters com- fertable —both better tan expect- ed. Ordered to Training Camp. Messrs,J.W.Wallace,D.M.Eth-eridge,Raymond V.Allison,D.F.Wallace,D.F.Mayberry,Locke 8i-mons and H.C.Privette nave receiv-ed notice to report to Fort Ogle-thorpe,Ga.,at 9 a.m.,August 27th, to enter the officers’training camp.They recently passed the physica!examination,held in Charlotte.Oth-ers from here who passed the exam-ination but who have not received or-ders to report are Meesrs.John A.Barkley and John B.Glover,Jr. DON’T KNOW YET.Local flour mill people are inter-ested in the Federal food adminis-tration’s plan to stabilize the priceofgrain,flour and mill products,butjusthowtheywillbeaffectednoneofthemaresure.They are waiting natorium for medical at-|aheados.He was out next morning.w was slightly bruised.The ySeptember lst.Twoareaff.~-theateavilleandthe Flour arrived from LouisburgcupyingMr.W.E.Webb's on.east Broad street.str.©&:cently bought the businessSloanClothingCo.and vit jeechargeafterthe25thofthis ’and change the name to the Crow- oll Clothing Co.A sale is beingeepreliminaryyothetrans-er, MR.WOOTEN TO WASHINGTON. Mr.H.H.Wooten,son of Mr.andMrs.W.(©.Wooten oftownship,left Saturday for Wash- ington,D.C.,where he has an-ap-pointment in the War Department,under the civil .After a.month’s training there he will besenttoanarmycampforserviceinthequartermaster’s department. VOLUNTARY BANKRUPT. .Brown of -ville Saturday filed with DeptytheUnitedStatesCourtGillvoluntarypetitionin| giving his assets at $39,821 liabilities at $53,393.48.InSuperiorCourtlastweekClineappointedreceiverstochargeofMr,Brown's affair “ WITH THE DISTRICT PeALD, Mr.W.B.Gibson,chairman 6? f‘ ep ee Te ak => Many Exceptional Values. | 9BEGINNINGAT9:30 A.M.AUGUST 16TH., Stouffer’s Hand Painted China,Rich American Cut Glass, Japanese China,Leather Goods,German Silver,Grass Baskets,Sterling Silver Novelties. 33 1-3 Per Cent Off Regular Price For Cash Only. Come Look Them Over. Special One Lot Regular 50c.Initial Stationery at 30c.The Box. The Rexall Store.STATESVILLE DRUG CO.Quality Prese << THE LANDMARK —————————————————— TUESDAY,---August 14,1917, Ee NEWS OF CURRENT EVENTS Incidents Gathered From All Parts of the Country. A coroner’s jvry investigating the | Killing of four civilians,including 2 woman,during field artillery practice at Little Kennesaw Mountain,Ga.. found the tragedy was purely acci- dental. A strike of street car men in Li- ma,©..which has been in progres- since July 11,resulted in a riot on the night of the 9th,in which three men were shot.One was dangerou:- ly wounded. The Atlantic Coast Line railroad has raised the age limit for em- ployes of that company from 45 to 70 years until six mon-ns after the war.The company did not discharge men reaching the age of 45 but here tofore did not take on employes over 45,The bill increasing the Inter-State Commerce Commission from seven to nine members has been signed by President Wilson.There was vacancy on the commission and the President will have tnree appoint-| ments to make in the near future Several candidates are uneer consid- eration. The nomination of Westmoreland| Davis for Governor in the Democrat- i¢primaries in Virginia,is a rebuke to the activities of tne State Anti Saloon League,which endorsed —an- other candidate and called Davis a wet candidate because he resented the League's officiousness;and a re buke to the Virginia Democratic machine,which supported a Rich- mond man. Members of the Louisiana Cotton Seed Crushers’Association,in ses sion at New Orleans,adopted a res olution asking that the Federal foo! administrator make the substitution of cotton seed flour for wheat a na tional recommendation and that heurgeallStatestosetasidetwodays each week for special use of bread made from the substitute flour.Itwouldhelptheirbusiness Creation of a labor adjustment commission to have final jurispru dence during the war over labor dis putes in plants having contracts with the government,has been determin ed upon by the council of national defence.It is proposed to pive the commission full powers by awarding contracts only to those who wil! agree to abide by its findings andrequirepledgesoftheiremployesto do so. To Test Child Labor Law. Constitutionality of the Keating Qwen child labor bill,passed last vear by Congress and due to go intoeffectSortember1,is questioned in a vill of equity filed in the United Stetes District Court in Asheville and made returnable \efore Judge Jame:E.Boyd at Gr Au @uat 20. ve action is styled R.H hart,as next frmend,representing his two minor sons,avainst the Fi delity Manufacturing Company of “harlotte,in whose mills theboysareemployed,an@ William ©. Hammer,United States district attorney.The action seeks to enjoin the defendant company from dis-charging the two boys in compliancewiththetermsoftheKeating-Ow isboro Dayen- tton sm law,and te enjoin the United district attorney from en-forcing the provisions of the law. Appearing for the plaintiffs in thepetitionareClementManleyofWin- ston -Salem,who represents the R4d.Reynolds Tobacen Company of that city,and Junius Parker of New York,attorney for the American To-Company,both of which com- jes,it is stated,wit)be largely by the operation of the@-Owen law. Sammer Comptaint.During the hot weather of the summermemberofalmosteveryfamily troubled with an unnature! towels,and it ie of the erentthisbetrentedpromptiywhenthemedicineis.¥.»Reottavilie,Chambertain’smuchafive ®severe at.was sufferingOmerelievedfre=OtherBefamilyhovesincewedicwith ae1hedand one 1 en FIRST CALL SEPTEMBER 1}. Men Drafted Must Report Local Beard to He Sent Camp. Regulations 1o ‘ Marshal General Twe hundred 6st Hoo me w ber We we)before Senioember Th eine entrainn: beret bem fer ervis mer reach thbeincontact with uniferived it Theorwacdthrotirh eves nose at the ft.tow py ot the ml eiwilian tary camps wherdierawillhee annie within seun'!of the oy ie FY The netual call far men v 1} :™m to thethe h enern! of,etatir swonlied at ai snecified time Sta Beech Voc)beard will}romps emed of i anort in the call,end th “etapt mene will fix wher St the date te will «lmnedint wake ult v the n'a of ertrainment 9 felset tn redeemed dis tie the for the sem t the hoat Baal the men will he 1:neent will t hom.nersar niyemrene mate en thashequalityoffoodfurnishedshat! ard is held lial ! ments are adequate Military Ceremony. t the board head for AAO mn.me on the ne to the board,will be remonvy the draft throveh,The board ted to he present foom the mer r militars tat impressing them the fact that disohedience o \the grovest m Utary The lieht hand Lag co let artieles und a change of under- which the mes ‘ Fmph:fi Crrpe te gre for «e thet First Retreat real antl ne tare ¢ elo omer 1 mem)er are Vine ‘my ‘a their o ¢ etme Ve,taintne to perm'ttedwentare »with ‘hem to camp,will be ted bw the boara Boo each dist 5 will be all rnates ed to the heard hend wt,five yy anarters iddition te the men acty ally selected to fill tme board quota Thev will he held at the oeceombline noint until train-time te fill in va- cancies should onv of the men fail to report. Exeent for retreat roll-eall,the men will he i-en town liberty until 1 minute fore train time The hoard will,durine this interval,se from the leere wh j deems best quolifed to command and nlace him horge of the party for tx trip will name a second in command to aid him and the other will be told that the orders ofthesetwomustbeobeyedunderpain of military discinline.The man inchareeofthepartywillcalltherollattheboardheadewartersjustbe-fore train time.He will then line jup the draft and,accompanied byithehoardmembers,march them to i the station to entrain. There,final verification of the listwillbemadeandifanymanoftheselectednomberismirsing,an al- lect one ma He men jternate will be sent forward in his place.The tickets,with meal tick-ets,all papers relating to the party, including the copies of registration LEADS ALL REMEDIES cards,will be tucned over to the man : a command 1 the party will start (oi training camp.|conte ve cam.IN LX For NERVES mander of ench party to watch over | his men curieg the trip,to see that | ione ave left behind at any station,- that all are fed regularly and that IRON Kor BLOOD no liquor is furnished to them en | ite.Whe within six hours of the amp he will fle a telegram to the PAW:PAW . amp adiutant «eneral notifying him = of tho time of arrival Immediate-rm :.: wou th varture ef the train,For the STOMACH wo deen cart Will send ao similar ,.nage 3Powertul korces in 1. Varnd Up Stragelers.,,",cl Afte che departure of the levy :)ie Charlotte have found {eon nh loeal bear will turn r tel ram stemach t ruble,oe ne op stragvlers.Hf there!‘ess,Woithness and weneral | a iful violation of or-Treaized Paw Paw builds|> j %will le yeported rthe bot und strengthens —it, *.the aqiutant general of the army the blood impurities,stima-| j ‘or mil ithe local police pe liver into healthy action,| nohed to arrest him on sight an pation and steadies him oer to the nearest are (ee Nerves and hourly the yyotvint Where tnere w:s|bee reasing,giving univer- a sert anil the wm |satisfaction,Tronized Paw -Paw Hise oc sulk the Idoes ail atel more than is clammed mon fa the cam.GL vit expbina o nnd i feces if your Sout distresses you if you rust.his dopree of culj tre conscipaced,have headaches,diz Lilies vy speils,are ous and vet the ON crc 'nmp,the party iies.just taste of —tronized physical exami uw -Paw \tind all the dis voarmy joctor.If any are umreennle Tels passing away be “ihe Iocal hoard WIN benotie((Te vou leave the store,Lo xe an alter sont for each cores of your neehbers are doing The avota of a board w get a bottle of Tromvcd Paw -Paw t le}ps filled only when ind bad yous diver and stomach ail- Wo ream men caniec for }ments yood-hve.LT want every chron falls pted.ie dyspeptic to come in and try this er ree remed:}owant the man or woman Americons Taken Prisoner Bs who can't sleep and is despondent to ‘ent .:me in aid try this remedy.You'll Suomarine.never wo back ‘to the old fashioned iS of the America medicines,Lots of busine and pro- C:mpat Srandard Onl ssional men find fronized Paw with the p ible eapture oof her Paw enabls them to do more and wa ‘four members of the better worn It seems to eneryvize |acd by the attacking German every fil tissue and bone.Begin ©owas announced —§mn Tronived Paw -Paw today so you '‘it Department.The an join {ho army of converts next} parimet ied this stutement eek.Your druggist probably keeps]4 Phe starnderd OU tanker,¢t.but if he doesn't come to the Polk { pana.Ag an stexmer,Was Gray Drug Co.j hie imsrine on the morning fronized Piw -Paw,price 31.For i \&,13 miles weet of He De mula on every hottic Mail orders ie ‘urvivors reached —Is promptly attended to Interstate i"fety It is believed that ¢Drug Co.Inc.,New York re steamer i d fi ree “anis ore ones”CHEER WINE),(ierman hbmarine|A } Tho Campana was the 38th Ar . can merchant ship destrege s Sirough A |D k t FTealDring,a oun-nerations of Gert 4 Henarines and rales é ran, Thistes tI hips vere sunk before the | Stat entered the wa Ni 117,and 2)since that time.The onnnee of the shins to-t hou 112.000 tons,inelud 4h event k since April 6, ©CEE ene ee Call Fer More Money. While the Senate continue ebate wy the $2,000,000 000 th j th veck,initial steps will |tah n the House toward ra eo opart the additional S6,000,060 00 to carry on the war iis, More ready money,! 00,000,000 or $2,000.000 te, necessary to meet current expend ‘res before Conrre can appropr ite it at the next session,so Secrets y McAdoo has arranged a meeting vith Democratic Leacer Kitchin for carly in the week to discuss the sit uation.Members of the ways and means committee,both Democrn and Republicans,hive expressed willingness to pass without delay legislation for ary reasonable amount the government may re- quire.Senate leaders ato are reads to co-operate Sentiment for raising additional funds at thie tithe by a bond issue and certificates of indelt-ednes and not by taxation i rong in both houses aa-meena ee ee There more Catarrh in this tion of the eountry than all othe Himewes t and fer veare ft waa suppreed to be inet hie Doctors prevertbed loon!rede nied by erm. etantliy failing to core with tremtonernt proneuneed it inewrable Catarrch is a local disease,ereatly influenced by t titutional |conditions and therefore requires eon-\itutional treatment Bali's Catarrch Cor manufactured by F.3.Cheney &@ Co.Toledo,Obie,in a! constitutional remedy,is taken internally ana |gets,through the Blood on the Mucous Sup] faces of the Byetem One Hundred DoliarerewardisofferedforanyensethatHallsCa.! tarch Gure fails to cure,Bend for elrovtareandtestimonial»F.J.CHENEY &CO.,Toledo,Onin Boldby Pragyiets,i5eHall's Femily Pile for conrtipation,‘ a) Bas IRONIZED PAW-PAW | tains and in Botiles,5¢ Doors,Windows,Mantels, Locks,Buits,Sash Weights and Cords,Sash Locks and Lifts,Hinges, Pad-Locks and Hasps and Staples. C.WATKINS,N.Center Sstreet. WE ARE PREPARED | To repair that Casing you cut on your.last trip and took chanceswithablow-out patch to get inon.We can put it in as good condition as it was the day it was put on car. THE IREDEIL VULCANIZING&SUPPLY COMPANY. Phone 201 CourtStreet.{We eel!Miller Tire and Tubes! eePLUMBING.| His Wife With Helpers. No man wants his wife to work her fingers to the bone! He wants her to have everything that will make her work easier save her time -give her leisure--for this makeshomelifebrighter,happier,sweeter.No wife can do herself and her family justice,when she is all fagged out by needless work.Every woman who does not know the value of the McDougall Auto-Frent should visit this store without Jelay and learn how it cuts kitchen work in two. ecco Is your plumbing all right?Are you en- joying that bath that is so invigorating?If not see me. Some Pumpson hand. W.E.MUNDAY. Your Plumber.114 B.Bread St.Phone 55. | : Williams furnitureNR Le |eet <a Sr eS 2 oa The '| ns A bedspring that can’t sag because of the patented flex- ible hollow strand construction; that does not roli you toward the center because it cannot sag; that is absolutely noiseless,having nothing about it to creak or groan; that conforms to the shape of the body;that has no loose str+nds,open linksotsharpcornerstotearbedclothes. Quarter century guaranice.30 night’s freetrial, Try It 30 Nights to Prove it's SupremeComfort STATESVILLE HOUSE FURNISHING CO. ——_aa RS maaan oneao mE” at e : i Hi ! a iy i§ ti iH f if iiiitHy £g | il iI; i:iEf t i:iI: ! t t t | For a bag of Davis Bros. Graham Flour,fresh lot right from the mill’ Don’t forget that we have anything you want in the way of Spices,Vinegar, Extracts,Rubbers,Jars and Jar caps. Phone 89, Eagle&Milholland. FINE LOT COUNTRY MEAT. Miller-McLain SupplyCo. eeeeae A Farm Life School For Girls and Boys. --SPECIAL COURSES IN- Home Economies,Agriculture and the Manual Arts. Prepares for College and Universi- ty entrance. Fall term opens TUESDAY,Sep- tember 11,1017.Engage board now at Dormitories. For further information and new illustrated announcement write to R.H.LANKFORD,Principal, |ment. ft ! ' ! erty townRochford,but four bombs droppedMargate,in Kent,did little PUnfavorableweatheragain ng large scale coeneaiian in !but in southern M rate fighting bevween the a|Rumanians and the Teutons continneiwithincreasingferoct.y. ‘shal von Macheonsen is using §&forces in an cndcnvor to break thrvue: Two men- the Entente |i: least =temporsri raiders,says anConsiderabledwascausedatSouthbombsdrepped le junetion of [Tecutchin. and Rumaniens are resistinglythenumericallybuthavebeenforcedtogive ly, were . 1 Field r Tony the The aru ry puiar nt superior enem ‘thontheiralongtherailroadlinenerthofFo!shani. nians tookBerlinsays,tha troops withstood strong attocks @n.captured more thrn 6,700 prisoners as Flesh and White, Newest Fall Models. Some Embroidered, some Beaded and others Lace Trimmed. é In the lot there are fifteen or more styles to select Harmony,N.C. ,Paint. C.WATKINS,‘phone No.43. ~WANTED! SCRAP BRASS —Heavy Brass 7ic.per pound,Ligh.Brass 5c.per rd "FOR SALE: New 2nd second hand machineryforsaleandallkindsofboiler room supplies. Cc.H.TURNER.Sredell "Phone No.74,Bell Neo 7. U \Sizes 36 to 44. |Priced,$3.50,$4.00,$5.00] If you have Battery _trouble, bring us your Car.el locate the trouble.All work done by an expert! STATESVILLE MOTOR CO,. f accounts - oo ieee’!tore.Those indebt- ed to me can see a statementof their account or ‘rake settlement there. Coite L.Sherrill,M.D. C.WATKINS will fit the!Windows he sells,He sells and $6.00. |RAMSEY-BOWLES- |! HI MORRISON CO. well as guns. In counter-attacks precedi their retreat the Russians and Rum1,200 Germen prisene IX cannon and 61 ! i Mackense:yoru mach: During Saturday night and Sund=:morning the French recaptured all thremainingtrenchelementstakenbytheGermansWednesdaynight, |German attack south of allies on th:repulsed by Gener: Berlin reports the 1_pulse of French attacks in the |Aisne front was'Petain’s men. A jer of Cerny on the same front,Both the British and French armicjfacingtheGermansinFlandersBay:again struck hard blows at their an with further Field Marshal standing the cial says it was man aerial board, 000,000 given t that time will deering ships. teel and duced in the Follette.it weod, tagonists and have wains inCrownPrinceRupprecht of Bavaria Driving eastward from the sectofYpresintheearlydawnofFride Haig’s men took fortheir.own all the German first bine po sitions east of Hooge between Frege:berg and the Ypres-Menin road ir cluding the village of Westhoek,an: held them in their entirety,notwit! usuallnunchedbytheGermans under extremely heavy barrage fire.Two French avirters Sunday droppedbombsoaFrankfort-on-the-Mainoneofthemostimportantcitiesofth« German empire,having a_populaticofmorethan300,000,A French offi statement announcing the raid in retaliation for the Ger- bombardment and the region north of Paris. More Money For Ships. Another half billien dollar approp: ation for shipbuilding will be askedofCongressthisweekbytheshippin; Contracts already said,have absorbed all of the $600, he budget bill passed in Jane. tional $250,000,p00be The emergency flect corpo: approved contracts fer about placement of sbout 200,000 tons. cost of the vessels will be S25 Peace Resolution. A peace resolution he Senate provides th: ernment defiine definttely th rewarde: line of been the courm.er-attacks at of Nance let,it board in the waAnaddi appropriated nt used in comffipn- tent has 1)sr bps with a total dis-The 0 000 Leen intro. Senator La t this pgeov- ot porte by for which it shall continue to wage war and that allies also make j ublic a re-statement of the peac¢my which they will demand.The resolution sceks to put Con gress on record as opposi »por by the United States for anne tions or indemnities for other natu aneproposestheamassingof2mor fund by all the belligerent eto. ration of battle devasiated t ory CHARGES AGAINST COAL MEN, Charges that bituminous coal cieal- ers are exacting extortio «ate flts from consumers under the Ned Peabody ayvreement were ma be fore the Federal Trade Com:io: by Clifford Thorne,appeari:he half of various municipal “a: tions.The entire Peabody e- ment entered into by th ars and Chaiiman Peaboay of th ise couneil’s cool committee,wa ar ed by Mr.Thorne to ve unfai th consumer RUILD SHIPS AT MOREHE AD. Part of the yvovernme:t’ier- gency flect,which is to vort feed and ammunition to +for he American soldiers and t!ex, is to be built at Beaufort a re- head City.Admiral Capp the shipping beard has agprov:on- iract for two vessels to be «ut ed by the North Carolina S:ld- ing Company of Morenen ‘ity, which is capitalized under LwWs of North Carolina with $200)up- ital. Revels Captured. Rosco Revels,colored,ws rn ed here Friday from Win:sn lem to complete a term or ungangforlarceny.He eis! Thomas esenped'from —th:a few months ago amd had ud ed arrest.Revela was am in Winston -Salem for the !of some money and when the Ir fieers heard of it they asi mTheWinston-Salem oni ved him over to them,Thoma rot been taken. SENT ARM HOME Mre.Walker E.Conrad o/ne ton gazed upon an embalm raharmwhensheopenedane package thought to contai ive plants.The gruesome find no description te indicate fron ne body it had come,but Mr Ir Conrad at once thought of th:on,Raymond,a brakeman on a |vivaniarailroad.Later they ed their son's arm was cut off by ainandshiphomefromMerca,|'a To CureeCold tn One Daypt.GROVASs heViHOMOQuinine.It sor:the Root,May Apple Reot,Senna Leave Works off the CrHMfaitetocare,oe Geeb bow OH [NEWS OF TAYLORSVILLE,|Alexander Teachers Have Board, ect Correapeondenece of TheLandmark. ,county teochers’ "twe weeks sessionMr.A,T.Allen left Frid Hattie Parrott of Kinston left Satur: "pleased with the helpful and ifstraction given by Mr. thx to our county superintendent,the in- stituteState Department of Education,our thanks and a 3 Ae ,”&@i6e® ‘fableSession —Calls-Exemption ThePresident of Mitchell Collegehas issued«callforseveuty-live Boarding and one hundred Dey pupils. Earnest,ambitious young women from the age of twelve to twenty will be in the first call. The enlistment will take place at the Office of the College Wednesday,September 5th.The sacrifice will cost something but it will be worth the price and more. ‘Taylorsville,Aug,19.--Alexatiderinstituteclosedariday.ry evening‘or his home in Salisbury and Miss) lay morning.The teachers were well,practicalAllenandMissParrottandgaveexpressiontosamebyadoptingthefollowing olution:|“Resolved,That we,the undersigned |uchers of the county,hereby express| conductors and also to the preciation «f the very wtical oa successiul institute hich we have attended,It was ut pleasure to the teachers of th ty to have Mr.Allen,who wasiredintheRockySpringscommuni to instruct them.” Thursday evehing at Superior Officers will be in charge of the training. The advantages will be great for the development of aricher womanhood.Failure to enlist will be a reproach. a al 4 the =schoo viding Mr.Martin,representin s th i ‘tate Audubon Society,gave a ver ;‘:nstructive stervopticon—leeture uo!Bear in mind the date of enrollment,September 7 i Life,which was followed by v« ictical talks on school and commu ork by,Mr.Allen and Miss Pa: Mi T.LL.Henley and daughtvhohavebeenatAllHealingSpru 5,and the place. Mitchell College, a few days and are now visiting at th meof her brother-in-law,Mr.1D.¢SANS ATT nen OL es Te y,will return to their hon ,—*oe emer irinburg tomorrow Dr.and Mr |\.M.Herman of Cleveland,©.,are Visiting Dr.Herman's mother,Mrs dune Herman.Mr.A.M.Sample endnofFortPierce,Fla.,are spending1fewdaysatthehomeofMr.Sam.!father-in-law,Mr.J.W.Moore |Thursday Deputy Collector FE.LlivdrickandSheriffR.A.Adam found and destroyed a sheet iron stilthathadbeeninoperationinacorr «ld in Little River township.The: e making rye whiskey. Of the 160 men catled by the loc; semption board to appear for exam ition,five failed to come.One wa il,three were examined elsewhere ane «has not been heard from;75 pa ed the examination and the majorits of these will claim exemption.Fifty will be called for examinatior n the next day or two. Mr.George Bogle received a tele yram Saturday advising him of his vcceptanee at Fort Oglethorpe.He i:»report for duty August 27th The Chattanooga Dise Plow more This is the disc Plow that gives universal satis-..Mr.Thomas Watts is not expected |4 si nes coi‘live throughouttheday.aif]faction.It leaves the ground in splendid con-.. ivr yrandmother,Mrs.Jane Herman |})gition.Will break harder ground than othaeg.|, has returned to the home of her uncle iv.A.M.Herman,in Clevelond.©|]plows without leaving it cloddy.“Mics Elizabeth Lindsay has returned|i from an extended Visit to relative '.:* |Winston-Salem and Salisbury.Me |]We have a full line of Chattanooga Walking" George Bogle of MeColl,So ©C.,ir)g}7 }:—_ nding a few days with his mether Plows,also repairs.ah. Mis.Lelia Bogle.Mrs.J.J.Edward:|i eu }returned home from a visit to he , parents.Mr.and Mrs.¢C.W.Un +e aaMerarvitinattes|Tredell Hardware Co.*}and children have returned from {|“ tay in)Mocksville with relatives ie seccreeaninieeaestireninemimaiaietewiaes aceceeeetiy-nresip-teenrcicutierevatemuaemeny o-stitina eet fctcnimarsunmmanemiraamesmmptaint oamceweslahi Misses Hope Campbell and Nanni Tek Lea casedome enone - Frye of Newton,end Mamie Frye o | Rrve of Newton,sid Mamie Frye0’ saagmsamnasnsenasseensnsgssssrsser¥estctcteseeaeseesng230032040000220000008 1 yoman,Mrs.Ro M.Ineran M F .f *. 1 ovine i eee Fata Male ;«“isting of'wi's'soon T Served at the Fountain of Quality (ROM OVER THE COUNTRY.|eftorn? items of Interest About Various %°Matters.|Exclusively For 10 Cents. The Marine Cerps has been reeruit “to f :trength OOO wer re Si ath; The imi deaths in New!:‘orks ent ead by.the hot ae CHOCOLATE NUT FUDGE‘\K em iw AUprust 'ed stimated at (5%|Fie Aneta,Soci the ar MAPLE FUDGE weekly of t i nal Seo ist merty |asad he aan a ae CHOCOLATE FUDGE ‘ Preste “uppointe a .:..7BeavisbetesotSadetiBUTTERSCOTCHFUDGE. 'ine t sstcite dy .thle for the Soa trict se een ; Nine Portes hermen s Provi \x .°~“twhentoe«i Statesville Drug Comp’y +uo 2 +)ett 1 ute,t m 1 clear that F ,::oe —The Rexall Store— apie ace)C1 OF PUNO"|Sevrreeremnemmenenauraaesnersamanetertasatttig:pertienents: fom Ame Gorman ori :,~~anal aa Talnen i Duvino owurmeen ’the Rel W I. WW ith t?“]Re '\the ys tised te 1 ful?\OO ae re Napol "|eo mis 1 wen tv-three S uota 15 did the anf Ss ther qu he town Hay Ht .:age fr ‘1 to Leeh ie,1 have arr fin \rt rort | f the |’i hine if the ite '!r}Lore |pen geet a 5 '_.r .*'“Th entire ose a If You Want a Racer We Will Nias ;'~“a Y ren er :natives Su with Muvr toners |Get You The Best There Is, il 'the n Wa -:.pted antic hy Ih Wil |the present day demand,however,is sensibles, NG a ee ee with basting,satisfying qualities and afl he the s,ec you wilthever need,a Buick or a Dodge Rs :Re {Bingham.of 1 mui for inst.ce. he 'fo.mer|s Mr Ilaeg . ee ee ‘Lis.+isn’t arecsonable test .ee,me ae Tee that wo [event given.this ,Sr eee ee oa car and it has passed them a “the Kenan prof nor ship”memo all.New models unexcelled, i of her father are unete rs Bingham,bet he mare r te 58 oF ; Flagwhkr.w Mi Ke N h t bats a ‘a a eS B®ndCarolina,Paleqi a:&*DOD6E ROS.(OF CARS j What is LAX-FOS LAM-FOS 1S Al IMPROVED CASCAKA A Digestive Liquid Laxative,C ttle and Liver Tonic,Contains Cascara Park, Hive Fiag Root,Rhubarb Root,Diack' |Pepsin.Combines strength with pela.| table aromatictaste.Does not gripe We Nis % a Ta a | feOF ;ef |Ahae price ofvebeenboosted,purely as a result tion,The Washington cor- n t of the Greensboro News offers.explanation:—_‘ood hill sets up over-night a great system,the like of which this country has never seen.It first declares that it shall be a crime, punishable by severest measures, for any man to destyoy and waste foodstuffs. “The food purveyor,who buys acres upen acres of growing plants, only to let them remain unharvested and thus affect the market,will be in the same class with the thief who breaks into a house and robs the re- frigerator.The fellow who starts to buy all the ezes in the country that he may charge a big price for them all winter long,will find himself a criminal.It allows the President to hecome the leading ereen grocer of the land.Under the food bill he can he the center point for the distribu- tion of such essentenis as wheat, flour.meal,potatoes. Wherever he hoards of these and other necessities he may take them at a fair If it should be retessary to can them andbeans seus pr ce *pack them he may take over the canneries and the packing houses. “Wherever there are storage ware- houses,cold storage plants or main centers of foodstuff distribution,fhere also will be government agents watching the operation of such cen- ter.A Federal licease will be re- atircd to do business.No one who apecttates in food will have a chance ia vet Federal leense. “One of the features of the food bill is the minimum price of $2 a bushel set on whea,Yeople have why po maximum price is ipon bread as well as a min- 1 wheat.The food ex- ’iwelare that in to stimu- late wheat production in such timesaa,these a minimum price absolutelymoatbemade.In Europe the food administrators are said to siave plac- éd 2 maximum price on bread.Lateron,farmers found they could make more money with their wheat by feeding it (o hogs and cattle and thers was no wheat fer bread at any price,Consequently there was a bread famine.One of the—first thines the food administration under Mr.Hoover will do is to take up theWheatquestion.Mr Hoover will al- ev look into the milk siiuarten.Hewillendeavortosteptheslaughter of youne cows and Waby calves,Forvearslaw-makers have endeavoredtesteptheslaughteringofcalves withou Under the drasti fm!nutocratic war-time food dicta torship,this may be brought about.” SR ENENRCS BURNS WRONGED. That man Burns of Chatham coun- ty,charved with collecting funds for Watson of Georgia to test the con- Stitutionalitv of the draft act, should have damages from some- body.It was heralded over the country that Burns was _soliciting and collect(ng funds to be forwardedteWatson,and that as a result ofhisactivityandthatofothersse- Pious conditions threatencd in a sec- tion of Chatham.Burns was arrest-ed and vlaced under a bond of $5,- 600.When the case came up for ahearingthewitnessputonbythe gvovernment testified that while he had frequently discussed the war and the draft act with Burns he hadneverheardhimsayawordthat ,dieated he would advise resistance fo the law.Furthermore he had heard Burns say he had been asked to send monev to Watson for the ipurpose stated and had refused.So the charge fell down.Some over renlous citisen or official evidentlyRasdenetheChathammananevil ‘urn:and it does seem that some- lody should have found some evi len worth considering before the wart Burns and he war t unenvinhle and em- barre netormety The Noro Re 1 ~the fair name of Chatham ity has been landered by exaggerated reports of alleged resistance draft.act. It is admitted that some loose talksmemayhipeople who had ro ea of cong what they So they would do.‘This,proha- bly *fF "anole for ht tine re- tports of draft resistance en ine State, Ghurt ount of this)same Ik end the exagwerated North Carol ha hadbarraasingaful1 SA ur sph ad Taced tmum price order SNCCORS mn nt wns issued for yurkt into sing Pitt to the e hee d ee,bn loose reports, em- riety, some :i Whe stent hout oa mrt cont tion with the proseeution o t}war,the Charlotte O}roi;stomed to advise,“Leave it Wilson.”Prettywoodadvicespeakingyenerally; prnd why shouldn't the Observer takeitsownanentthepositionas- signed =Ger Wood?Tt natural for Ger Woed to he popular on Charlotte,but ot is je (0 fe home that che ment know more about matter in conneetion with Wood's service than the gener- 'al’a Charlotte admirer Seeeeeeee Speaking in Asheville at a war }meeting Sunday aciernoon,.G}Bickett predicted that “hy the time i the last leaves fall in the autumn of ,1918 the boys will come marching home crowned with victory.”Hope the Governor's a tree prophet,bet=simply jruessing,like the rest of ERENT well county Farmers’Unionaresolutionendorsing—thearnIgfortsora thre advice onat rover: end maintain an \ -and thisornoneatleastuntilpassesonthethosewhofavortotakewhatisoffered.While the new territory will takeinagooddealoftaxableproperty,itwillalsoaddmuchexpense.Notnearallofiteanhave,or should have,in near future,paved streets, lights and water—for which the old town waited long and some portions have not yet received these benefits these things will be excended from time to time.In the weginning,ac- cording to The Landmark's view,the new territory may add more expense than profit,considered as an invest-ment,but that in the end it will prove to be for the best interests ofallthispaperbelieves,wherefore it favors the proposed extension,While favoring the propositionTheLandmarkrecognizesthattherearetwosides.It wih rrom time to time enumerate both the advantagesasitseesthemandthedisadvan- tawes alleged by those who oppose extension;and the curtmns of theaperareopentoanybodywhomay have anything to say on either side,the only condition being that the dis- cussion is kept within proper bounds,|Seem *DR.ALEXANDER QUITS. Dr.Alexander,president of the State Farmers’Union,will stop talking about the draft.The Char- lotte Observer says:.“Dr.Alexander does not intend tomakefurtherrepresentationsofhis views and convictions,either through the papers or from the stump,during the progress of —the war.He has so signified in writing to both Senator Overman and toGovernorBickettInconversation with the editor of the Observer Saturday,Dr.Alexander admitted the impropriety of carrying the discus- sion further,and he had only to say in his own behalf that the-article which drew State criticism upon his head was necessitated by the incor- reet report of his Rowan county speech.” It is fortunate tur Dr.Alexan- der and those likely te be influenced vy him well that something happened to direct attention to hi remarks that resultea tn “is stopping that kind of talk,which could only result in harm Mecklenburg Farmers’Union. which.appointed a committee to in vestigate the charges of —seditious talk made against Dr.Alexander,adopted the following —resolution S:turday: “Resolved.That ‘at all have The the Mecklenburg unty division of the Farmers’ Union do hereby again pledge our loyulty to President Wilson and the government of the @#nited Statesandpledgeourselvestodowhatwe can to win the war.” Dr.Alexander was present at the meeting of the Union,watch was be- hind closed doors.What took place in the meeting was not disclosed,ex- cept that the foregoing resolution was passed. AAALSLNT The Landmark has called attentiontothefactthatmembersofthewarexemptionboardscannotlegallyex-empt men as a personal favor,and that individuals who make personal pleas to members of exemption boards for consideration on personal vrounds,offer insult to them—thatifmembersofexemptionboards have a proper conception of their du- ties.Members of some of the boards have not had that conception itseems,and as a result they are in trouble.Three members of a local exemption board in New York cityweresummarilyremovedFriday nicht.The formal order for their removal announced that the drasticstephadheendecideduponbyPresi- dent Wilson of the irregu lorities ree have occurred.” memoers of the have been improp- persons seeking Is, “hecause ted to that rd The charge Xe mrt oY Tae erly influenced lischaryes, He PVrVore ited it is added LL «+Oo government's plan to insure soldiers to war is a good one. It puts case of disabied soldiers and the families of those killed on a busine and will eliminate the fraudulent pension laims portion of the plan which soldiers to allot.a certain of ther pay for the dependents is especiallywholepropositionlooke Landmark. and “the charges are to to the fullest extent,” The the hasis chance of That requires amount support ofwisThesodtoThe Department Commanders May Re Kept at Home. Army department commanders,byWarDepartmentorders,are relieved of the national army cantonments and National Guard camps within their depar(ments and will devote themselves cntircly to the regular troops within their jurisdietions. The effect of this order,unless there are char in the high com- mands,will be to keep some of the best known American commanders, such as Muior General Wood,Major General J ranklin Bell and others,n departm ot commants at home, instead of sending them with the ar- mies to Europe.More than 200 newgeneralswillbeappointedwithinthenextfewdays.sible that some of these or othersmightbeassignedtotheregularde-partments to permit sending the highlineofficerswiththefightingarmy.nee Daniel O'Conner of Chatham coun-ty jumped into water 18 feet deep to It is of course pos) oe ed wee allies andtothegeneralpublicin tates.blishing ?buyingalltheprincipalteofplandmills,of apricetobeconsideredfair,|of the middlemen and of |changes,with the elimination med ing in futures,are the chiefoftheplan.The licensing mber 1.minimum price of $2 for wheat| fixed by Congress does not effective until next year,but the ad-| ministration proposes to exercise averythoroughcontroloverthisyear'scropthroughpowersconferredunder the food and export contre!bills, The announcement says:“First:In order to eliminate apee-|ulation in wheat and flour,all eleva- tors and mills over 100 barrels daily capacity will be required to take out a government license and the conditions of this license to he,“That only reasonanie and eustom- ary charges shall be made for ware-) house service;that no wheat shall bestoredformorethan30dayswithouttheapprovalofthefoodadministra- tion;that certain informetion ag toreceiptsandshipmentsshallbesup-plied regularly.The grein exchanges| are being asked to suspend all deal-| ings and quotations in future wheat.| These regulations will come inte foreeSeptember|and tho licenses will bepreparedthisweek,.“While farmers’co-operative eleva-tors are excepted by the food bill,this however,applies only to mutual con-| cerns and not to stock companies,and| in any event unde the sdvaniages of, joining the plan,none sre likely to stand out.| “In substitution of the broken-down marketing machinery,the food admin- istration proposes to open nygrencies forthepurchaseofallwheatattheprin- cipal terminals,carrying on its trans- actions with the usual dealers,and ispreparedtotakethewholeharvest~if necessary in order to maintain a fairprice,and will rescll wheat for exportinsuchquantitiesaswecanaffordto part with in protecting our own peopleononehandandtesellontheother to the millers for domestic consump-tion,The administration will make no charge except a nominal percent- nuge to.cover of the overation and arrangements will be made whieh will assure the yovernment against loss. “In order that nothine shall be hefttomischargewearesettingupalproperlyconstitutedcudindependent|auditing committee which will cheek all transactions at every point,Fix Pair Price For Harvest. “The food edministration under these irrangements Would fave 4 large influenes in affecting the pHtee of wheat.With a view to determining :fair price,the President hes appro. ed the appointment of a committee tc be selected from.representatives vo! the producing sections and censumi elements ins community.This een mittee will be assembled under chairmanship of President Garfield o/ Williams College,and it will be th duty of this committee to determine : fair price for the 191%hervest.Upo: the determination of this fair bas it is the intention of the food adm: istration to use every authorily teffecttheuniversalityofthisbas throughout the whole of the 1917 havestyearwithoutchangeorfluc: tion,It should thus be clear that: will not be to the advantage of an. producer to hold baek his grain in us ticipation of further advance,for hy will do se only at his own cost storage and interest,and if it is ne escery for the government to buy th entire wheat harvest in ordcr to matainthisfairpriceinprotection oftheproducer,we intend to do so “Furthermore,the holding of wie:or flour contracts by persons not «1 gayed in the trade,and even when i:trade,in larger quantities than is ne:essary for the ordinary course of theibusiness,is unlawful under the act and such cases will be prosecuted wit! viger.And we would advise uch holders to liquidate their contracts at once, “By the above arrangement.\ lieve that we shall stabilize ‘ of wheat throughout the year.oho: the hazards of operation due to fut ating prices which are imposed ' our milling and distributing comin) nity will be eliminated and therefey their business can return to thi mel lines and the normal margins profits,and that we shall not ont have stabilized the price of wheat hut stabilized the price of flour.and that it should enable us to arriv)ar a stnbilized price of bread.” It is further stated thet 2 con tee of millers,at the request offoodadministration,will try tonereeonapriceforflourandfeed Committees of bakers are nla co ‘dering the bread proposition (and pre expected to agree on a standardlonfandtheprice. House Wrecked By Spout. The home of Capt.Joseph S.Pig ott,eight miles from Beaufort,onaninlandwaterwayknownasThe Straits,and only four =mile fromtheAtlanticocean,was completelydestroyedSaturdaymorningalittlebeforeday,when it was struck by a waterspout.Capt.Pigott.wifeandsevenchildren,were asleep onthesecondand=notwithstand-ing the building was completely demolished,no one was seriously hurt,Mrs.Pigott’s shoulder blade wasbroken;a baby was found on aplank,unhurt,some distance from the site of the house;a young ladyoccupantofthehousewascarriedsomedistancebutwasnothurt.The hardly EnPeat of ‘tim >hoatimberbeinglefttogether, costs the pr of mit th Water- pricesaveapetpoodledogfromdrown-\ine and was drowned himself. ‘claim that partment‘payments,A ed todeposit,at 4 somedby thefamilyallotment and ar pay.Provision is made f of wrovernmentifainGeers < from to y.accordingheocnaaetatteat in|ddition to the sum allotted underhecomneeDallotmentfeature he bil.indemnities for partial and total |lisability would vary from a mini-mum of $40 a month for privates up|to $200 for higher officers.Theeduca-—ion of injured men in vocations’byubichtheycouldearna_livelihood|iso is provided 4Underthebillsoldiers,sailorsandnarineswouldbeenabledtoobtain nsuranee on their liver éuring the |war in sums from $1,000 to $10,000,|he government taking the risk and|he men paying the premiums.The.rate would be approximately $81,000 of insurance and the p imns would be payable by install-_nents out of pay.The cost of carrying out this planestimatedbySecretaryMcAdooutapproximately $176,000,000 forthefirstyearofthewar°00,000 for the second.The bill pro- ides no method of obtaining —this im and a bond issue to cover it may«determined upen tater, Here’s a Test For the Draft. \test of the constitutionality ofheconseriptionlawwillcome—be- "or the United States SupremeourtonorbeforeAugust24,with he docketing of a case which,prob-ly will be ealled for trial during court’s fall term.The case will come up on a writ ofrrorfromtheDistrictCourtofNerthernOhio,where Charles E. {utheLurg,recently Sociaiist mayorCleveland;Alfred Wagenknecht, Ibo State Senator of the Secialist riy,and Charles Baker,Ohio Statervanizerofthatparty,were =con- cied of having conspired te induce wrsons subject to the conseription ct to evade that law.They wererhtcercedtooneyearintheCanton, Ihie,workhouseEifortshavebeen made in severalonsofthecountrybypersons in aympathy with the conserip- law to raise funds with which »test the law,and it was decided te make this a test case, DATE SRI ena teRAE ELROD Drives Out Malaria,Builds Up System fon The question is not can you afford a Hoosier—butcanyouaffordtobewithouttheaidofaHoosier,The Hoosier supplies many work-saving inventions.It embodies the most valuable kitchen helps andshortcutsthatareknown. Crawford-Bunch Furniture Company. “The Store That Always Welcomes You.”‘PHONENO,400. a Saees =erGecialSeenionondSeaber at the Commercial Club. Every member is urged to be present at the clubroomsTonightat8:15 for the pleasant purpose ofaaboutanythingoranybodyhepleases.The principa!subject,though,will be business—your business,the other fellows business,anybodysbusiness.Nothing stilted or formal about this meet-ing—just a plain,profitable get-together,talk-it-over and help each other sort of experience meetingwithalittlefragranttobaccosmokemixedintoloosenupyourthoughts.Don’t miss it,something helpful will be sure tocomeyourway. Phe Old Standard general strengtheuing tonic, JROVE'S TASTELESS chill TONIC,drives outMalaria,enrichesthe!loot andbuilds upthe sys em.A teuc tonic.Kor atts cad children.Sux GERMANS BELITTLE AMERICAN TROOPS! Savy They Wil!Prove Small Factor in Great Struggle!—Claim Our Men Are Not Equal to Task! DON'T KNOW WHAT THEY'RE UP AGAINST!It appears from news which leak-‘d out of Germany,in spite of —the unusually close censorship,that the German officials are telling their men and women that the American -troops will cut little figure in the big war.IF THE GERMAN PEOPLEKNEWWHATTHEYWEREUPAGAINSTTHEYWOULDRE-FUSE TO LISTEN TO SUCHFOOLISHASSERTIONS!The funniest part of it is that they Americans can't think quick enough.What a joke!That's our reputation quick to think.The Germans will find that out svor enough.In the meantime,we at home should get ready for the big drive. Of course we all can't go to thefrontbutwecandoourbitinjust as important a manner right here athome.Let is keep fit to carry ontheindustriesofthenation,till thesoil,work the mines und keep the ammunition flowing to the front in a steady stream.Backaches must be gotten rid of; those stomach disorders such as in- digestion,constipation,ete.,must beeliminated;weak,anaemic bodies must be made strong and vigorous;weak kidneys and bladder must strengthened;in other words, must keep fit!Acid Iron Mineral will keep youfit.It is not a patent medicine.It)is a pure,natural iron preparation|obtained from the onlv natural me-dicinal iron mineral deposit of itskindknowntotheworld.It aids di-|gestion,increases weight,createsappetite,strengthens dormant mus-_ cles,brings a healthy color to the!skin,and builds up the bedy in gen-| eral;and is free from aleohol,willnotinjureorUKeolortheteeth. Old sores,ulcers, ete.,ogeebathedwithA-I-M will quickly dis-appear ani applied to cuts,wounds,or abrasions it stops blood almost instantly.At all druggists in 50¢c.and $1 sizes.elena DR.VANCE HASTY,DENTALSURGRON. Reams 5-7-9,Second Floor.FIRST NATIONAL.WANK BUILDING,al TRUNKS,SUIT CASES AND HAND BAGS. We have just received a large shipment of Trunks,Suit Cases and Hand Bags. Now if your vacation needs requires a Trunk, Suit Case or Hand Bag,it will be to your advantage to give us a look before making your purchase in this line, Trunks,$5.00 to $18.50. Wardrobe Trunks,$20.00and $25.00. Steamer Trunks,$5.00 to $8.50. Suit Cases,$1.25 to $8.50. Hand Bags,$3.50 ($12.50. PHONE 83.-SHERRILL-WHITESHOE CO. ‘Don't You Want Some Pretty Pins and Other Necessary Jewelry? Come to our JEWELRY store for the toilet jewelry you need.Then you will get the proper things. We have all sorts of useful jewelry for both ladies andgentlementhatis“popular”in price,yet the styles are correct. We have beautiful little things for every member of thenome—froma pin fer baby's tiny stockings to a handsomeshellcornbforgrandma's hair.R.F.HENRY,Jeweler. LEST WE FORGET. Now 8gust tens 0 ane Gee Monument forlovedonesvee‘aassortmentofbothGranite‘andTombstones .and Mrs.HardenA.DavisofVa.,motored totheweekwitnMr.andMrs.‘.Mr.Davis,who isarfintheUnitedStatesnuvy,is a ¢losely serutdentalwork willtheywilleither be enrolled and theworkdonebyarmydentiscs,or al-lowed time to have the work done ‘|for themselves, during the commg Win- ‘ood administration istostabilizeandnot tojitionsandtodefend .j brother of Mrs.Bunch.‘enterprise against illegitimateandsometospare:|Mriirs,ZV.Lang/and chitdren have petition.It has been devised 00 608 |ye ‘n!“harvion providing.thehearing not by hoarding|Teturned from a visit to Mra,Long's rect the abnormalities and is half sank oo Modifications 7 nd ourselves alone |-arents,Dy.and Mrs.J.A.Scott,at|that have crept into trade by i an Genubeaionts to those less for-|Brookneal,Va.of the world disturbance and to TE which will give the physician wider not hysterical or|Mrs,Sig Wallace and children and)store business as far a»may he latitude in ated can despite ]in this sec-Mrs.Sol.Simon,who have been|a reasonable basis.some defect of vision. war conditions,|spending some time at Wrightsville to |Beach,return home today.Miss -|Mary Jane Schloss of Wilmington|80 a8 to keep the sup-|wi!l accompany them and will spend demana —one of several days here with Mrs,Wallace of iwithMr.Mr.and Mrs.H.E.Buff Miss Alma'Point are spending a week*rs.L.L.Lanier.Holt of High Point,who visited Mr.|and Mts.Lanier,has returned home.||Miss Jessie Setzer is spending |week in Spartanburg,8.C. |Mr,and Mrs.Larry Lawrence and| jchildren of Henrietta,Rutherford| ‘county,and Mr.Boger Lawrence of Newport News,Va.,are guests atthehomeofMr.and Mrs.J,W..Bawrence in Olin township.i Miss Fanny Lou Gaither will leave|tomorrow for Asheville,where she a eyMr.and Mrs.Cnartie E,-|ae and of Cooleemee spent the week- ane to mention her name it is yet and with home folks in Statesville. unknown who he marred.|“Miss Lena Williams has _returned Mrs.B.A.Sherrill of Talyor,to Linwood after visiting Mr.andagEygLa-ee ;.Be NO.Mr.Georwe Osberne has returnecMrs.Minor Troutman of Asheville,..swoetwater,Tenn.,after spending and Mrs.Albert Johnson fo ~—-awhile with relatives here.ville are visiting their mother,Mrs.y;..Helen Cooper left last week U.A.Qstwalt,and are canning ¢,-Asheville,where she will be the peaches while they visit.;guest of the Misses Bowles,who re- Friends of Mrs.J.M.Ostwalt are tuned to Asheville with Miss Coop- diticr Ckieee a SON”er ie 0 ——1 heon¢=ae ;Mr.Bret Lomax of Lomax was the t |tins —a —"=ruest of Mr.Van Buren Jurney last a "*r “a 3 0,e week. has Bright's disease,is paralyzed on vis,Anna Phifer has returned from a visit to friends in Cleveland the for their benefit —-some with an alert,eager -to -learn ex- pression,while others seem bored. A brief letter from Mr.Jesse Locke Lippard of Philadelphia to his, father,Mr J.M.Lippard,a few ago,carried the announcement ' his left \side,and his recovery is bot expected.His son,Mr.Clyde Ost-and Mocksville. walt,was called home ———Miss Leslie James of Catawha was delphia on account of his father’s in Statesville recently to visit Miss) iliness..He arrived Saturday.Magyie Sherrill.She was on her Among the menus for threshing way from Charlotte to her home. dinners Miss Jettie Troutman serv-‘Mr.and Mrs.R.C.Gouger after ed pumpkin custard made from last visiting relatives here.have gone to|7"2 volunteer pledge to co-operate (OR SALE OR EXCHANGE—Por real estate year’s pumpkin..Pineville,Ky.,for a visit,with us in the undertaking and 80 or btocks,Overland Roadster in ood condi-| The protracted meeting begins at Mies Janie Love has returned to become as much members of t¥e{tion,with new set tires,1916 model.BG.) Bethel tomoirow,and this means an jendrum,8.C.,after a visit to rela-‘ood admimstration as we ourselves|GATHER.a Aon.it.\ impertant event in this part of the tives here.4 cats .\,fest WANTED-—Sey grateote of High Scheel >ar county.Miss Angie Caldwell s gone “There is no royal roac to one egite t.Good aner for pre motion.Apply = While our editor of ‘The Landmark oe visit ~~—*°|conservation.It can be accomplishs|2 ovr handwriting to X..<a is being overwhelmed with bumper Leets on account of his fondness for this particular edible,won't some- bedy remember him wtii some of the Mersrs.W.A.Thomas and Isidore Wallace were in Atlantie City for a]few days last week.Mr.Thomas re- turned Friday night and Mr.Wal-mammoth melons that are begin-lace Saturday.ning to ripen?It will help us to Miss Mollie Kimball of Roek Hill,publicity and vet our right,s (.is visiting her brother,Mr.Drin; ;Cas know what our left is doing,or 7 vice versa. Kimball,and other relatives in town and county. Notices of New Advertisements Mr.J.M.McKee left Saturday Parker guns —Parker —Bros.,night for Baltimore and the North- Meriden,Conn ern markets.Mra.MeKee,who has Hoosier cabinets,—Crawford.heer sick in Baltimore,will accom- Bunch Furniture Co.ee him ee or in Sanday Way sagless springs.—States."Glenn Morrison left SundayvilleHouseFurnishingtonightforNorfolk,Va.to enter the Country meat.—Milier -McLain United States Naval Service as an "Aprrentice seaman.Supply Co.,e es “ic . Ble “Daddy Rabbit”usaie.Sloan _,,Mr.and Mrs.W.E.Allison of St. Clothing Co.°oe os Ca visiting Mrsaaaa=Mite »_une rs..Allison.Elkin blankets.Mills &Poston a and Ge Ow Ain ae Pretty pins and other jewelry.— R.F.Henry.Dr.8.W.Hoffmann,osteopath. Annual mid -season clearance saie.-—Statesville Drug Co. Paroid roofing and all sorts of building material.Lazenby-Mont- gomery Hardware Co.Farm for sale.—S.L.Statesville,R-4. children spent the week-end in Hun-tersville,Miss Touecitle Blackwell has return-ed to Lenoir after p visit in States- ville,Mr.B.©.Dagerhart of Hopewell, |Va.,spent a few days recently withjhisparents.Mr.and Mrs.E.L.Da- wenhart,He will visit friends in Chase City,Va.,before returning to Tomlin, Stenographer wanted.—B,care hi i The Landmark.his WOrK..: Two-horse farm for sale.—J.4.Mrs.C,H,Richardson and Misses lloover Evelyn and Ruth Wilkins of Golds- Pocketbook lost,—Return to The bere visited Mrs.J.F.Bowles last Landmark.week.ee Overland roadster for sale.—F.)De James K.Hall of Richmond, G.Gaither.after visiting home folks in Betha- Automobile for sale.G.E.ny,went to Morganton for a visit. French.Mr.and Mrs.T.J.Conger are in Boy wanted.—X,care The Land-Avheville to spend several weeks. mark.Mr.and Mrs.Geo,H.Lentz and Building for sale.—Mrs.8.A.Mr.and Mrs.T.M.Dale and little Foster son returned last week from an au- Shop moved.—-E.A.Fry.tomobile trio to Hendersonville and Smoker at Commercial club Asheville.They found the roads Dr,Edwards,healer and preacher.good and the trip)was a pleasant »oneSecond-hand Ford wanted.—G. FE.DullHorse for sale—G.E.Dull. Social. Miss Lila Parker of Birmingham, Ala.,was om a when her en sheaae Bridge so Cineinnati and Cleveland,Ohio.Be- yed at five tables.Mrs.Aaron fore returning home Mr.and Mrs.Fox Rs won the hih-score :visited relatives in Kentucky. while the consolation went to Mra,’Mrs.R.F.Northey of Atlanta and Mr.and Mrs.Clinton B.Bost andMr.and Mrs.Luie Smith of High Point are visiting Mrs.M.I.Bost in Bloomfield and other relatives —in Statesville.Mr.and Mrs.N.W.Fox heve re turned from a trip to Detroit.Mich. FE.M.Yount.Miss Parker was ,Mr.Roy Chipley are visitine their sented with a pretty favor.An"ie father,Mr,8.1.Chipley. course was coved following the Mrs.F.A.Hampton and two daueh- games.Hydrangeas and iadiolii|ters of Roeky Mount are viciting Mr. were used effectively az decorations.|and Mrs,J.A.Hampton at Hampton- ville.They were guests of Mr.and, Mrs.J.E.Tharpe in Statesville last ‘ers free the great majority of ovr, ‘into disrepute the majority of hon- “T do not believe that drasticneedbeappliedtomaintainec -ie distribution and use of supplies bythetmajorityofthea.But if there be thoseexpecttoexploitthishouroffice,if there are men ortionsschemingtoincrease theofthiscougtry,we shall nottoapplytothefullthedrastie, ceive powers that Congress has con-ferred on us. Men.serving prison terms for mis- demeanor are not exempt by reasonofthatfact.If the Pony authori-ties will not release for mili- |tary service they will be required toM-'present themselves for examinationwhentheirprisontermshavebeen j completed ;Tee QuinineThat Gone tat Afect The Yost TIVE BRO!oOU setale bettrthen <<{ “In enforcing the measures of theSgn ih Weed the full-nameandact,it is not our intention to pro-for the signature :|—_See ee a eeaannlmMARKETREPORTS. Statesville Produce Market.The following prices were paid yesterday for produce on the local market:\ ceed with a host of punitive meas-vres,but rather by co-ordination,with the various trades to effectsuchconstructiveregulationsaswillrendergambling,extortion and other THE FIRST NATIONAL BANK, The man who has money in the bank will get ATTENTION when he goes to talk Business. To have money in the bank PUT it there;let it STAY:constantly ADD TO IT.When you get a big balance,BE CAREFUL.You may,in ONE DAY,by » some bad investment lose the savings ofa life time. We shall gladly give you our opinion on any invest- ment you are figuring on making. Make OUR bank YOUR bank We pay 4 per cent interest on time deposits. Spring Chickena,I7e.per tb.wasteful practices impossible.I am Hens,l4e.per Ib.convinced that while we must have::Exys,25¢c.dozen,ready in reserve the corrective POW-|Guinen Euus,200.per dozen. ers given us,we shall by these POW-|Roosters,7c.to Se.per Ib.\|Butter,25¢.per Ib. Beeswax,30¢.per Th,|Green Hides,18e,per Ib,|Hams,25¢.to 28e.per Ib. Sides,2he.to Zhe.per Tb. Shoulders,22e.to @he.per tb. New Red Honey,12 I-2e.to 6c.per tb.Sourwoed Honey Comb,20c.to J2e,per tb. Old Auto Rubber Casing,4c.Irish Potatoes (new)$1.50 business people from necessity to compete with operators whoseeffortistoinflatepricesand bring| -st traders.“Every ounce of waste is a contri-bution toward starvation.Our al-4lieshavereducedconsumptionbythe. most drastic measures,but it is HM-for grain on the 1 market: possible to reduce ——.—s.~oe per bushel. hose in war work and =enge orn,$1.96 to G2.00 per Suskel, other physical work.We have in our Cats,Spe,te Oe.pay Nene sbundanece and in our waste @n @Mf-On the local market yesterdny 26 cents 9 sle supply to carry them and O@F-ver pound was paid for best grade cotton.id selves over this next winter without Market,firm.; suffering If we fuil,it is because waNTEDp—asecond-handFord.Mustbein individual Ameriean —ertizens have good condition.Reasonable ip price.G.E failed to see ond do tmese —~DULL Aug.14 —-1t°. tional!duties.is is a service ;which every man,woman and child Gee —_om oe, in thie country may enter.We shall tice for quick «ale.G.5.DULL. invite all classes and all trades to Aug.14 2t° .mer ibperbushel. The following were paid yesterday mare.sneri- ed only through sineere and earnest| daily co-operation in the 20,000,000 kitchens and at the 20,000,000 dinner good tables of the United States.If we!f°hoover. ‘an reduce our consumption of wheat|——ee flour by'one pound,our meat by sev-|SHOR SHOP—E.A.en ounces,our fat by seven ounces,|jm"“me our suger by seven ounces per per-|: son per week,these quantities,mul- ed,geod buildings of all kinds:six miles!mile from sand-qlay road.]Aus.14 1t*. FRYE has moved his shoe|over Harrison's elothing |& Aug.14 2t. STENOGRAPHER WANTED Pleasant.sur- intied by 10,000,000,will iaumenaur.|SAdines.Urtown office.Write,stationbiolaidi:Ni }experience and speed Send references. ibly aid and encourage our alles anc Address B..care The Landmark.Aug.14, hely our own growing armies. “This co -operation and service Iaskofallin’full confidence that AUTOMOBILE FOR SALE—Overiand Road- ster in good condition A big bargain. FOR SAIL E—Good two-horse farm,well water-eS Statesville,N.C. wit sixteen years of ex- acting service Paroid:Roofing Lhe itself the most economical roof you can buy.Ask us for the proofs of this claim before \ you by roofing. . Doors,Windows,Sash,Wood and Tin Shingles,Lime,Cement,Nails,LocxsandHinges.Our stock ofthesegoodsislargeandwecanstillgiveyeureasonable prices. Lazenby-Montgomery Hardware Co. ""Sy rer ",Call and examine.G.E.FRENCH.America will render more for flag,Aug.4 \ nd freedom than king -readen PCO”LOBT—Peckethook containing $4 and rail-| ples surrender at compulsion.road pass to Asheville,Return to THEANDMARKAug.14 2t.,’v vmen.Visit to the Ca ary “g A MODERN BRICK BUILDING FOR SALE | Fourteen automobiles left State+-ene for revthurant or eonee ir=::‘meas.Excellent restaurant trade already ||ville early Friday morning for Li:Gabliabked.Terms if cesired.MBB B A.|'‘olnton.The oecupancs were rel FOSTER,Statesville,N.¢Aug.14.| tives and ‘friends ef Statesville i DR.WM.F EDWARDS,D.1),the World's Wonder,famous bealeconductingaseriesofpmeetines in Rankin- town,actuslly healing af!kinds of aches and Prepared to furnish any necessary|} voung men who are members of the lineolnton cavalry troop stationed at Lineginton.The party,with the Statesville cavalrymen and the offi- and preacher,is cers of the troop,spent the day pic-formation from some cf best white people,||) :2 ea -5 officers and judges of North Carolina,as =_—".—ee =as in Genre and South Contin.t H.B.WOODWARD Jeweler. wo miles from aneointon.ere reat crowds are flocking to him,oF mt dinner furnished the "aees,and say that he bk a mystery Al come —. was a picnic INGERSOL DOLLAR WATCH. War price $1.35,See me if you are in need of any kind of a Watch.I can supply that d need.In stock,Hamilton,South Bend,4 Waltham,Elgin,New York Standard,4 Reliance. Southern raised darkey.revered by some ofStatesvillepartyandanaltogetherbeatwhitepeopleofSouthHasStateli- delightful day was spent.The =re conse to practice.Office at Rev.Hender- mains of the dinner,two freezers of —son's in Rankintewn,effice hours:8.90 a, o .,>al m.to pom Servicers 8.30 te 9.30 p.mcreamandanumberofwatermRiecialseatsforwhiteDR.WM ons,were given to the company.|F.EDWARDS Aug.14. dance was given Lincolnton by the cavalrymen,«number of Statesville people ©‘naining for the dance.A number of the Statesville |« ‘he evening a thibiereeieoneceee . POR SALE—Large quantity clean cotton salt bawe.Just the thing dried fruit,ete.STATESVILLE COTTON MILI Aug.10 2t FOR RENT—Storeroom formerly occupied bywhoaremembersofthetroopsper’RP.Allison,Ro A.COOPER partments.of Engineering,ation and Law. Friday nicht with relatives Aue W Fer catalogue and illustrated booklet,address Statesville,returning to Linco!nto”MICKORY BLOCKS WANTED—Will pay R. good price per cord Write for further in-HICKORY HANDLE &MFG. Aug.16 3t Saturday morning.The troop |": Lincolnton Saturday for the tra ing camp at Greenville,8.C.Nu formantion. CO.,Conover,N.¢ WANTED—Tenant for three-horse farm nearteenStatesvilleboysare=mem!«rs 4 »Vv ring t!aray.Vienty of farming implements re-vf the troop,Statesvitte having |Leogay, Nlemty ot TSR MINNIE,MORRI- largest representation of any ott BON,Statesville,N.Aug.7 town in the State in the compan)itn ————‘Seer ees een ieee en eee ——WANTED—Knitting Mill Help.We are now ,7 j »}.vh operatiny our new mill cee,sanitary yout rdny for Blowing Rock,buildinw Street cara every tive minutes.they will spend a few weeks.Messrs.J.E.Boyd and W.C.!ston left yesterday for Wilson to a!tend the annual State meetiny county commissioners. Mr.Carey C.Boshamer of Ma ‘on,Ga.,is spending a few days wit)his parents,Mr.and Mrs.©WBoshamer.Later he will go to (5!“ago.Miss Dorothy Treece of Richmon’Va.,is visiting Miss Blanche |°° Good wages te toppers,knitters,Can also use bright young vwemen to learn Moat attract-ive city in the South.Forty thousand troops and many flying machines to be stationedhere.CHARLOTTE KNITTING COMPA-NY,Cherlotte,N.C Aug.7 @t. POPLAR WOOD—We are paying highest cash=for Yellow Poplar Blocks and Logs.tite or call STATESVILLE VENEER CO.duly 17.— LAND WANTED—To correpond with any onehavingrealextateanywheretheywishto Close at 12 o'clock Saturdaysloopere FOUNDED 1638 A College of liberal arts with an established national reputation for high standards, traditions and progressive policies.possible equipmentlow.Comfortable,inexpensive rooms in carefully superivined hy Classical —¢courses leadi CHARTERED IN 1659 TRINITY COLLEGE DURHAM,N.C. Its large endowment fund makes its firstchosenteachers.Studentsandlargefacultyofwelltrainedandcarefullygienicdormitories,Graduate courses in all de-te bachelor’s degree. L.FLOWERS,Secretary to the Corporation E RALEFortheEducationandCultureofYoung Women. Classical,Literary and Scientifte Courses leading to diplomas. Graduates credited by State Department Education for Teachers’ Certificates.Special diplomas awarded in Music,Voice,Art and Expression.Excellent Commercial Course,Domestics Science. Domestic Art.INSTRUCTION:Specialicts in all departments. SITUATION:Location in capital city gives special opportunities. Delightful social advantagesATHLETICS:Supervised indoors and outdoors by athletic diree- tor.Special attention,individual development.Climateout-door life all winter.For catalogue or further information,write at once toMISSMARYOWENGRAHAM, ae turn into quick cash.We believe we have|the best system to be found anywhere forhandlingquicksalesandgettingthemostgenour.rMr.and Mrs.Van Patterson The old ——eae Se week.a who visited relati :here d a wae —eo ae —s a hostelrywell known vel-Mr.and Mrs,Clyde FE.Gaither,who #t Troutman,returned Sunday (0 ¢cele ailing you whet wo thal ing public in former days,which |;the nash i aaa okPs their home in Durham.zs We on tormish ae ee et ah was closed some months ago,will be Gaither’s parents,left Friday fer|oe a leaves —for!ieee,ENGLAND Seat ESTATE jaa remodeled ane reopened Nowport hows,Va.,where they will Itimore.”visit e milli-|to e *oS he soon Mr.A.D.Brabble as woke their home.|"ory *._te Grecnsbore,F.©.uly = manager.Mr.Brabble was at one :’isses Bertie and Nellie Huitt of .:_time svi,Hotel,Trade,States wining Raith Alexanderof Matthew?Claremont ate visiting Miss Morgue:FOR SALE. inCharlotte,“He ellknown to!Lachey,yeaterday to visit atLo-|Sorings,“her at Boren|Ata ee —_~,mile from peuple.Mr.and Mes,Wr.of]Mr.Floyd Lippard of Charlotte tumhowe,good barn.granary,wagon,shed bond a ‘arevisiting Dr.and Mrs.L.|Spent theweek-end with his family |mite,shed Al ander fence,aud coer Tae ;46 nerves in cultivation,| REGISTERED AKkCHITECT, Statesville,N.C."Phone 340 Green.| C.H.LESTER,thoroughly 1S Santentne of Daneeln&acessories,STATESVILLE MOTOR CO, i Na . a sat Burke examined jon ures. of Greek,tawba College,Newton,was drafted ssed the :he Lincoln county ‘He did not claim exemption ‘Will Fox,who shct a man named and Lea of Timmo asville,8.C.been secured to give year. M.E.Bohleder,23 yeers old,living Sunday While hiswimminginthe)‘Catawha river.They made a killing of blind tigers ‘men,about all of them liquor law vio- lators,were sent to the chain gang. More than halfof the first 454 men pe ysically ‘ound qualified,171 avked for exemp tion.John D.Leonard,about old,was knocked down and run over iby a shifting engine at Thomasville. ath legs cut off and he died in two Prof.George C. ed acetate convention of the Feder-A. al met in Salisbury yes-|last week, will continue in session| !oymiany . Rev.E. of St. in Davidson College drown- rlotte,war court lact week.Eighteen |mark.He ,to rest. the Wilkes board were isqualified.Of the 212b 55 years | Warlick,teacher German and history In Ca-| examination before exemption beard.ty. the He ineral of Paul Alexander @hinn, of Mr.and Mrs.Tilden Shinn, death has been noted in Theexceptionally| bright and lovely child and has gone These dear youngaswellasthegrandparents, Mrs.P.A.Shinn,have the sympathy of the neighborhood sad bereavement. Mr.and Mrs.R.L.McLean visited the family of Newton last week. son will go to Richmond on the 28th was an m Mr.W.F. celebration and Mr. friends i re F E E 2 SE Shinsville,|auieey.Company last week he preached the fu- afr and this their Moore at Miss Sadie Ben- to enter Westbrook Sanatorium, Wife and ten children.where she will study nursing.Mr.and Mrs.A.W.Campbell of Ashe- ville were guests of Mr.J.F.Camp- bell last week. Next Friday,l7th,is Cook's birthday His kindred please bring the baskets. in the #0’s now,but able to go about A.W. at Ami- will He is up a The soldier boys enjoyingexercises ontowneveryday las @ |drillin |arou usnd-'alize that we are nearer War htbeen.“now than we haveTheFarmers’Union plenie at M'. Mourne last Wednesday was well «|-tended and a good time was InH.Q.Alexander and Mr.J,en,president and State »Reapeively,of the State Fa Y Union. were there and made speech.«. 0 AagyoatThecreamery picnic at rewhichwasalsoheldonmiteay,was well attended.Mr,yAAreyofElmwoodpresidedagma:er of ceremonies.Mr.W,.&Clon inger,dairy expert from ‘atl on,made an address in the "fore won on butter making.At noonhevbadabountifuldinner,after which Mr.G.8S.Robinson,assistant rector for extension .for North Carolina,spoke on what |! yeHugh Love,$2; Mra.tee,$1.50,We P.Mor ;Stimaon,81;Mrs,BR.L.Mrs.J.B F -iven at a rlaon,G@e,:J.A,Morrison,50e.;W.D.-ea!ae Mrs,Herbert |(ion,at:W.B Morehan,4,E lBatty, Sprinkle,82;$1:J.B Refty,S0e.;R.Rufty,five:J.T lobnaon,$1;oward,8 1 |Yearsin,82:W.BP.Bainkenship,S0e.;J.W. \wh,$1;Framk Neill,$1;Cash,$1;x |Lawrenee,S0e.;Ed Woods,S00.;Lee Long,|Morrison,$1:Dr.C.A.Puriner,86;$1.J.M.Stikeleather,$1;J.BR.Vickers,d0e,;| 1.J.Patterson,80¢.;J.N.Ghuford,Leonard,66;2 Bh toe :in ie”fan om Sharpe,bie.;Gua Campbell,0c.;Mine| E Will Brown,while working on t 4 ‘Je ::and glad to see his friends.The ‘akes to support a creamery,There ©Anderson,$10:Horace Yount,$15;H :tailroad at Catawba,about six weeks usual programme will be observed.|was a ball game between a team Yount,$10;EF.G.Gaither,@5;Miss Minnie|U ‘die Serowms,b0c.;Mine Sara Serowus,Sie.; —ng lasing RneR Satie Mr.Cook is the oldest person in the!from Mooresville and Oak Ridre ae €oF 06;Mies Pr fe amd —os a ec OER O68 Be “ers since,was captured at Hickory |con oe :ae fe.Gert alton,$5;J.Stephany,$5;J..Brvin,a Cavin,$i;BL. des eas i.in rl a:Newten.|jcommunity and enjoys the respect which resulted 18 to 7 in)favor of Hoffmann,$10;Andrew and Behan Sets Morrow,$2:W.HL Morrow,8&5;John |;Lazenby-Montgomery Hardware Co. Mis att eY -land esteem of everybody whe knows Oak Ridge $5:Gus Deaton,$1;G.RE Anderson,$2.50,|Mitchell,$5;R.L.Feimater,ue.;T.V.Hailey,|Statesville, :A.L.Westbrook,an overseer in a 4m Mr.and Mrs.Euge ,|M.Hit,85;W.N,White,Soe.;or P|Sts Miss Mary Bell,$1;Mies Prudie Lewis si,C. :4 .;Mr.and Mrs.Eugene Johnstom wil!jor,$5.Mes.$1.Misses Ina,Mattic and May Me ee :"ie :otton mill at Smithfield,charged Miss Johnsie,daughter or Mr.and ro to housekeeping in the yur i aewade bbe...os oe.:“wn.?L..Stevenson,$20;iM.en ":a e ith making threats against the |Mrs.S.B.Harris,gave a melon house,as soon as the carpenters fin,4 Lee Lazenby,$5;Mrs.4 Montgom.|4.Stevenson,#1;Mr.and Mrs.1 "C.Bte.|} esident and advising men to re-cast to about 40 young people at ish remodeling it.Mrs.Johnaton re.\)j Wei U.Shocrit,68;Mic.Bunch,81.)oor ow:Sire.bon eee , Fuse to appear before the exemption her home Saturday nnght.urned lust week from her old hom:hele i ‘ae i ee wet |M.Sherrill tbe.Mrs “t &Genes ow r ss =-x OT Ss a ra,5 -.“a .-.53 ?EP ,landed in jail in default of Miss Ruth Allison has been at,Mt.it Ruffin.oer,36;©.O MertngnBe:ae Aber’)Dagenhart,5@e.:RL.Guy,Bde,;G.G.Gant,|The expert sent to Atlant. :$5,000 bond._|Ula for three weeks with her sister Rev.J.©.Kennedy of Mt.Meurne Henninger,7he.;°Miss Henninger,$1;Mrs |f2:Mrs.G.G.Gant,§1;Mary Gant,$1:Mins|7 anta,Ga,f Houston Robinson,colored,of Ca-Mrs.C.J.Wilkinson,woo has been ‘ax been taken to the sanatorium at |G.Shelton and Mix.Benson,$2.Mrs,Melle|Laure Sides,a60.:A.a.Sides,$1:J.M./f to examine into the causes of the tawba county,shot at bis half-witted sick,but is now getting -ome better.Salisbury,where he is being nce tarhen,=F =.Meare,Sito;G.G preoggpha :Bink quae,&.Feim.|ans ive ton a ’ ,“ap?:.ae Say es?:dc Orven,$5;G.B.Hu ,82.00;WF Hey foe ower,$1:F.Mi Abe {L e there ‘ound § boy,net to hit him but to “skeer”|Miss Bessie Gibbs or Hot Springs,for a bad sore on his leg.WM McElwee PCs ee en 8 Teale?[1 :Mine Bertha Abernathy,$1;8.B.Soeun w a him and prevent his running away Ark.,is here visiting ver sescer,Mrs.The annual meeting of the stock °°:Dr.FA.Carpenter,$10;Miss Nanni:;¢!ee Ps Swann,2be:W.BE.Massey,that “the Atlanta disaster was — mm home.The father’s aim wa:Gilbert Ludwig.holders of the Moorenville GROBORETS ‘sch tare dbiry Cotinen Oty feeced Rien |Grose,i &.Sree LS T Gemes Bi:8 E ensentially «‘shi r con-F too good.The boy dicd and the,The Boy Scouts,abume 20 strong,will be held in the chamber of con S aeeede Beeee en meer,|e,mane Cle:Secveh Gh:we.ood Oe ,preteens ee 3 3 BS,alee WV 3 ’>P P¢rom ian ehureh,AO;3 ce .vie 3 “aewell,3 ee ee a father is in jail —by Seoutmaster Z V.Tur-merce rooms today.Mis.Clues Bows $1;Mrs..oe |r .or a=ge 85:A.M.Deal,$2.40:a |flagration of the familiar type.” ape ._lingten,will v wi ;ee ’on,$1;Mrs.Herbert Hoff ‘=4.M.Deal,ohe,;Mins Nettle 3 : .Remarks made hy negroes at Dur d nn an i mere oteit =io Mr.and Mrs.J.W.Mason of Ia "Mekauahiie,#1 :Mrs.rom yp s isura Bartlett,$1;Cash,tees dace |A word to the wise is sufficient. lington,to which members of the lo-|G@ys ca ping trip in the Blue Ridge |rinburg,who came across the coun-s)Orin Turner,$2.50:J.Bo Foster,$1,|0-85:Mrs.HL.Stevenson,$1;Mine Bula i éal military company toox exception,Mountains.No compwry of soldiers try in an automobile,arrived here &b.Serence,8:ALE Gcrea,.tee.lim MeLelland,85;A.L.Sides,$2;Mra,N.C.|See us for a tin reof. 4 caused a near race riot.Snots were look forward with any more interest Wednesday.Mrs.Mason will remain \""\W"#1;Caeb,51;aire.EB.Aliinen.$4.50;belted Mrs.Tillte Brown,abe.;G.P. }fired but no one hurt.Seven of the mee is manifested by these young here a few weeks with her parents.5.1 he a ac!oo big eel e |ered 7 ‘er —~¥STATESVILLE TIN :..>er .’:.oe A,NC.5 i.»;a eae 4 a y SOO... soldiers were placed uneer guard by or ’oe for them a good Mr.and Mrs.G.oO.Cornelius,Mr Moc.Ro Long,$6:Mr AL J Bailey 8!Geo Ervin,50 Mrs.MOS.Watts,$1:W.HL CO. their commander.|me a safe return, Hurran for Mason returned Friday.Mr,Doyt [ents $2.80;Mra COW.Stimpson $15 4,N Morrlion,ai.4.G Woodside,86;J.W.‘Phone 85,114 BE. .:.»,*a .OErT urker the errs a wifes:Oe {ere 2 ote:s :|BroadStreet, While making a balloon ascension ¢Ml ne yen .Cornelius,who was visiting there.jain,dhe;in aa Me Ww "G ae |aiheyti,Mine cay he Mra.8.La} at Cherryville,Gaston county,Mr.id oe t "he a of Amity,‘eturned home with them.$i.Dr Clouninger,$10;Mrs.x @ bush :Turnersburg.ae |—entemmcemnennnnsemsssoee =Seer arenes Bugbee of Greensboro was killed in-|WiGew oO puty Sheriff Jno.H.The fifteenth annual Sloop reun-*!.Mrs.Walter Sloan,50e.;T.J.Conse le Roy Stecl,$10;Mrs.Bla Steele,§10;|— Miller,ha:;Me ee wee’,:o p ,$10; stantly when the balloon fell on the seite a Cle =letter from So-on was held at Mr.8.M.Sloop’s,in be bee uous hae aie |hk ry e he *Sante |NEW SEED wires of the Southern Power Compa a =~~:Se Rowan,Wednesday There were ex Harrill,@t;Mis Gach Aa’de +Ay:Mee.beuchie Galiker,_’ ny.Bugbee was unmarried.His sh a ‘ec or $25,the oreises and speeches by Rev.B.S.WR Adams,$1;Miss Mamic ‘dams,6)./Ninder.See.Mes.ROH.Lankford,$1 |{ mother lives at Greensboro.:ount of his fee for prosecuting Brown and Rev.P.EF.Shealy,a re,Me G Lb.Albert.$1.Mrs Al Po Amaker,81 Wright Lankford.S00 Mrs.John Bagwarty Turni Seed ‘k The News says a Mt.Holly man edna ge of af —and vert of the last reunion by Mr,Sam Hh oe So ht ee mt ae me has sre Mire a —e om packages ::a :ing eg »2 ;8 .georetare:a ‘rawley,$1.Mrs.PC Bo $}AE Paalud heli tars rm.Sankey Gaither,Otte ; is engaged in breeding bloodhounds;|¢o,es ou —0 Iredell E.Slcop,the secretary;a long table vin.Maremret Brady,81;Miss Altic Caren Mir..Weat Baity,$1,Mtr.Dearman,$2.and in bulk,Also a that he recently shipped dogs to Cal-|4]ing the law take its course.‘n the grove on whice was an abun-'r¥.$1:Miss Angie Caldwell,$1:Mrs Do J |Bethany |:, evein.Maia,Mbtiaen and Goer.e expressed sympathy for her and jance of dinner;then there were |$1:Mrx.Albert Cooper,81°Mes ACT oh ©Cranford,$5.PM.Summers,$2 variety of other gerden i a tis eee te :her children.She has written him a songs and a social gathering,such ie whe Mrs.RoE.Clapp,81,Mes.Flake |He Mo Sumi ss,b0e..Miss Ole Summers,.xe ¥ gia,a pts for me beast:letter of thanks but wishes to thank they!kav 1;Mrs.F.AL Carpenter,$1.Mrs Miss [roy Summers.Phe Miss Surah and FieldSeed average $1,000 a year.Which is ev-him thr h Th I 'is thev have at such times.On the |MM Ciark.81;Mrs.J.M.Cunningham,$1.0 Sommers,fe 0 Mroand Mrs J)BE.Jenkins . idence that there is something in a \oug e andmark,too,same day the Overcash reunion was ™4 EK.DPeite,$1:Mes.Wm.Dellinger,$1 |$'0 BL Brye.81.Ed Wl Moore,Bae >Mire oaaae es ve _—to express her heart-held at)the Lutheran chureh at -ere.Milne Mary Bettie Feild Dun a ad ns Ce!eae All New. Mrs.Maggie Whileox,widow —of os eal ih soe ee kind friends Knochville,where a large crowd was «Ma WoL Gilbert,a1 Wr "a '“anit Catal.Moe Wn MOAR He e Mithet Wm.Wileox of Ashe eounty,vom pcah a :pitty :oo her ev vathered.,They had the Kannape!$1.Miss Minnie Hartley,#1:Mis Mi rarelvet Miiboiland.#1 M 8.f 's\Ot T N BROWN. mitted suicide by hanging Sunday,us dice Geka Pad pore and,a big dinner ane speeches —by ronal oe Sip Mies V0 A.Botand tts ty Ham vvioushy re oa” 3 a »re >»é ‘7.”chnaen,81:rs ,Conned vs vorted n ae 2 ith,mt the home of her brother,J.|\oq ihe children hove the _esred a a Horsey -—Rev.|ab Lony,81:Mrs.BL OF sabe 7 ae -Te gee een - A.McLean,cyWithes county.—od aut nnd it is geod,They expert VB.Mlickiv of Saver “Then.greet S.MacKeco.$1:MintMary Merkveann.ee eea 1.femerce ger .ane ’s i fi :™::es I asiathada ’.0.&a “uy ,>Miss ary Me >”y /7 old.The unfortunate woman left a ~”make their home there next year Kluttz of Salisbury and Rev,Bb.8.Dpegnid.61 |Mixa Maude Nichoinun,$1.Mian i 4)7 o:Sumimeis So EW denking,We Know Our ::-on the Q.M.¢2 ;Frances Nicholson $1:Bente :«o>WoL.Helland.81.\! hich Q.M.Goodman farm,near Brown I n Leinster,Se Wo tadeyd,81.J =—oe =pro pathet-phird creek,where Esq.J.A.White ‘There is tot a :Mrs.Bageeend Malden,BOc.:Mr.Currie W Lawrence,82:RE Lawrenes,$1:,8.R T be the BEST ’ words:“No place to stay.”as ,eae re is to be a home-coming at,Culley,2.50.Mis Zeb.Long,$2.50:Mines |durmey,S22 2 Cowan,82.GW.Stike- Cc Joh jer “k Ch was reared.he old home of Mr._FF.Freeze,|Grey,8 Re Me ni re —aie hees 2:Ww .‘Raregs <s.oo oe 0 e Pr)money ek af fiavent ile,.eee.H et 8S.A.Hoover,on astern near Centenary church Saturday,|oe OM Alice Morris,Ble:Myre Tenee 81.Gertrude Mack,|Carmite ‘Ta CaN buy.If you are Me ;Pe ween as-Heights,is feastir verbeari !m~Re C etna ali ia wimster,810 Mev.Wi BR Mundi tum.80.MM $8.Sharpe,Sts Benile shin a: signed to the second officers’train-aulervion sting on everbearing ~a ete ~~bring oe w Culbreth,Swe:Mrs.8 “O a Guawe:boa.W.|cTianiie,ge Cf i terested,come in and let ‘*f .’fi °Miss Nadine rawley eft -|By,>;Mrs RK.Taunstal «8.A.Vacdwett.#1...atum.#f ;-7 gy Reeder a en ~ite _Henry Campbell,col-nesday for New York ey aa Mont.|Brady.$8:1.RO Hew oC 7 mee =lurney,81,J 0 an :een A,oe us show you our stock, .:,8’Nest’ored,the village blacksmith,was lair,N E 181:Cush,86.WOH Kimball $158.G.Caudle,4 1 Austin,818.BB 81:ght Frices T Riflemen,the infantry company =at’Lurie sank:re vir,Nod.to be eene a month.|$i:Wo smith §10 HS Douvluss,85 SW imule i ‘ae rices moderate lerms Char’ee,but it is said oe Rta pha ee oe so owas the Misses Linda and Catherine Temple-|T.Steele,fa i arin Ae Falistown.easy . wie aaaeadk ak that coms :e Oo Martin ampbell,colored.tan spent last week at Mr.Vic Ed-|#2".$1:J.MM.Kamae e045 M N.B Contributed R070,deve dustir $?80 from oon ve +bel ccm dae :pany,Hoth well known colored people of miston's,at Mt.Ulla.Mrs.Gowan Mills,$1;Mr t FOoOM f1:Mrs.J.om |Pine Grove ebu List not cent on And ° ing on detached duty at Fort Ogle-he town.and held in esteem by the Puse ’Naa eee ats Moore,81.Mrs.Will MeBlwre Miss Mabel Shilton.rews IC thorpe.white folk )apenas of oo was here last)Poston,815 Mes Ho oF Ruseil st:Me.@ Abernathy school leuse @18.08,Klein aend-|| i j :,;5 :veek,visiting her son,Lieut.Gow KE.Raynal.$1:Me.Se!Sin eeuy Me)Tae st Gntcibuten le tbe . A.Dughi,a Raleigh fruit dealer,Misses Catherine and Mary Moore Prusenpurv.“che ‘eas Accompanied {Mabel Stiketeuths $1.Mie cues "vines Ospve,ae 105 oe Musical. attempted to shoot his wife and was Deaton,who were visiting their y Miss Kate Means ‘,Sti Minn Taek Stephane Be Mine teeny,|Contributed #24."Names hat furnished 'ast Broad Street. eno hy Pg a and others,‘randmother,Mrs.M.G.Deaton,in “Mr.D.E.Turner has been cls tobi k bck Me Mok.OR Phcenca a Contributed &ie ag tt }Phone 504. an s ”a .‘aes q :on Bes a OF CLEC j a Stephe wen,$1)t »=Thomas,‘antr ited Bee So Narmny ot fare ved S pg =page ao:pis ——have returned home.Mr.chief of the fire department.and Mr,|Mee.Costin Wood.810 Mis Rese Wirdes z Cool Spring "ae =:nt -i on is wits =is be:8.Boydattended ae meeting of the 1 1 Melellend aesietamt.“ir.2 |Mis.Hannan Wallace,810 Mr hha Witte |Contributed #8.Nurwex tet furnished STATESVILLE AND ELKIN -ye been separated for about trustees of the A.and E.College ¥ase vt tee,|SEE Mes.TD.Webb,81:ates WoW.Walto New Hope. a eck,Duck Gabe ke ee ee oe Ck it sd ollege in 1.Donald has been elected custodian|$1;Miss Anna Bell Walten,81.)Miss sath Contributed §oO Nera tak turniaeat man on the street and drew the pis-There ——a of the municipal building Mr.|trude Watton,$1:ALS)Sherrill,86;RO!JITNEY LINES por rar H e is warden truck in)abun-Frank B.Freeze is the driver ot the |a.85.Mrs.Privette Shins)ek Some whe sul Paredes Ce ke ah ° i tol,it is said that he had remarked dance now,with peaches,apples are :een $8:Mies Houck,at:J.TD 81:Mr Me have mot joid and their NK that he was going to kill some one scrapes,melons and lots ae nen fire truck ands Mr.D.EB.Turner)Weisner.soe Mrs.G kik oe,.included in the ahese ee SCHEDULE, and then commit suicide.Later re-good things thre :and Ue ;|Smithson.$10 Mrs.Mageto Summers,$1;Mis A Wee stated In the Mix lie Enterprice Car Leaving Statesville..8:00 a,m leased on $1,000 bond oe ;SoA gece neoUne ae h vr Fred.Gray Deaion +employ-|G Be lester.$12 Mrs.J.A.Knox,$1;Mire last week that sHoWd had bien suincrited to Cur Leaving Turne bt 8 .i ‘ad.rops you never saw!If it wasn't ct as foreman in some of the con-GW.Stevens,81:Miss Latonin Turner,81;the Red Cross fund there and of the amount (Cae 7,aving Turnersburg .° i or the war it ld cer Mrs.T.NN.Ri $$505.4 {i of Car Leavling Harmon & Strik var it would certainly be the truction werk at the camp iy Char-|Mes.Ma rie Vatts by Mire.GG.White,#4 os Rected”tht Bee Gee An eeerey ane ce oS?6-08 trikers Active.year of jubilee.lotte,and Mrs.D a |Ses.Marvie Patterson,$1:Mra.D.C.Sitehle,|@ collected thin,will Inerense the county Car Leaving Houstonville .9:05 a.m, :'AM the cklite 'lotte,and Mrs.Deaton is oal->fm}lee:Miss Ktta Patterson,§1.Mes.RK.|fetal to Sa4ant 4 Car Leaving Hasaptonvilie 9:509.@ More than 15,000)miners in’the :e children from 4 to 10 ure Charlotte for the pr-sent.Noor,$10:Mins Nannle Mills,81;Miss Ora|,it ie fair te say that just prier to the Red Arrive at Paki 10:30 a.m. southern Appalachian coal fields of ery a the story hour en Nine young men who failed to pass ayn Hie ~——TANI 8;Me hee oe oe en nema —ar Leave Elkin so.290 . Kentucky al Per eae Wrest ims resbyterian church lawn vw:i gives dincharme oo ch Pied *oat s A rm.DM.Furches,$5;Mes,|COTTE vuted about 82 for an ambulanes o wav s seen te p.m, ::"Tues y or Re tia ;t “d-ave,$1:Mrs.J.G.Powell,N ‘for the American Field Servier :France,Car Leaving H ,: strike ‘Saturday,demanding recogni teeny ats raeee at fh o'clock.mont Battery last week Sixteen |Tomlin,2.Me WOR Mille.¢o|alg eNieho would:brink ihe)total cont atianice Cer Leaving ana tego a D.oe tion of the United Mine Workers’or aepy Roger sing :le Pp =ao new pames were added since last.rec er A Tomiin,1 Miss Day ve te cxmimanity for war parpeses to move than Car Leaving secon sas .- ganization,an eight-hour |working Vee ae i eee ank vvort.Rieck fi.ce fa ee ee ee ————C envi 'mute 6:25 p.wm. !\.my 3 -,wi '‘olvert,2he va.Paskt ——ar Leavin t 32h ‘ day and other conditions.The threat Ca ee igned to join the Piedmont John,the 5-year-old on Mev.|son.Bi Rev.¢4 Sala oe ora ay MMe Any One Who Has Used It.te ic.6:00 .“ af the United Bratherkoud of Carpen Battery,is succeeded at the bank by ond Mrs.John Daucherts the |Prospert.$1.Mice Mo Newly.$1:Mine Ma i.There are families whe always aim to key Cap Jeaving States 3 p.m. carn J Mr.Fred.Brown,son of Mr.J.LL Dixi ill i r .A.Turner,8)Mrs COD M ¥9 bottle of Chamberlain's Calie and Dharrhoen U&t leaving Statesvrle in the morn- é “o tre up all govern y ‘sn me :un ir J 'pane otf OY .emedy in the bheuwse fer wee ine ing &1000 ¢ers and Joinersto te up all eae,'Mr.¢F a 8 died .typh fever DUC bo Me MR Meace —Remed 'ave it is ing at 8 a.m.Makes connection ment work on army and navy can.‘The Ore and Armet -ome iturday and was buried Si at |Mins Hunter.snc:Mire,Rone,20c.:Mine ide pond,ard fd that a is not anly wood with both North Wilkesboro and El- tonments and constructions contracts Kannapolis,}strong mecting at 10 a,m.Funeral service Row,|Geena.FN OM butler 8::Mee,Bm OMOMMC le Ae te Ne ich ie cr af ner kin-Ategheny trains. in the New York distric:,was with.Qumdo and.the large tent,started L.A.Falls,pastor of the Me hodist|#:Mise Muley,S0e.:B.S.Millxape,86;R ee net tats.ark anyone WhO FT oaving Elkin at 3:40 drawn when contract i mday and will continue two or hureh :ht or seeereest,sre:TD.Rae om ti ith "a ::i tractors agreed not three weet A nothe .Me :ee gs medy,$5.Misn Blanche Click,$1:Loui NLT 2!commection wi rains: te employ non-union sali .ee ne al el ~.Mr.G.G.Adams,at the M and Bowles,§Verey Anderson,S81 warren |No.12 going to Salisbury 6:45 p.m, With their hands held high over!y ioe pis a o weeks,fF.Bank,asks the publie to p thebr |Grier.81.Miss Hal Morrison,#2:Mrs J.8.No.16 going to Charlotte 6:50 m their heale amd.surrounded:ai Gl}saad neigh ey ag shen Mr.Red Cross subscriptions.Zz.AN Ms Cone a RR Clark,No.23 going to Tavloysville 8:10 ..m. 's :‘‘reoryve emmer,whe .'B ryan 4:C.B.Mocriaon,Me.;POWDER.lash .’SN :°i rhs :os ‘’sd o stuker.the mer meeting here last aeee The Rode Recklessly.Met Deatt if -re .Menry Purches,$1:W.p FACE f ‘No.‘NO SUNDAY BCEMGn p.m. Iported to brea the tie-up of the 1 s in nut ne cae oe §Cath,pwcrain.Fi Gitton,hfe.;T.CG.Dynart,|Th ¢ND:sc sDULE, parent car dees.ai Kaneas ae ae on ay outh Mooresvette,near the ase tren.of Winston ue he -J Kimball,Boe.;Dr.BP.8.Bastey,$1 ie secret of J arehed to.the.ctat y ¥ene grounds :’TBLO vlem,|Cash,6%Mrx Burwess,$1:J.Hugh Bryant,womenwho nowhow ITNEY TRANSFER co w station aid deported Two members of the Te ,_was instantly killed Sundi 8:Wer Vanee Hasty,85;A.BL Johnw B =ee ees er,;the Templeton antly killed Sunday,owt|few WWW Cociee ory ein eae:to take care e com-Statesville,N.C :ibams roller mil .,thr ;’|an.owles,$1;Mrs.J.C.:,& German Emperor Indicted.av died.this Bite iin oa gg hree miles north of Lexington,ioe:Mike Rarkarn MeCay,he:Mrs DM|plexion,Cannot ee renee ans aacamuaaceala ee This come inva fe patch from now advertised for sale This is one when motorcycle on which he WAS)P.Allivon $1 Mrx oh cee ee detected.Heals Sun- Meridian,Mo.:f the oldest business firms of —the 1 passenger plunged off the en!of a |Br ~4 Whitener,2he..Miss Frances Nich-|V4 burn,stops an.Soothing.DR.J.M.HOLLAND. “Upon th sworn te own and has enjoyed ¢anes :highway bridge and on to the tracks s tas 1 Harbin,$1:W.BR.Hofland,-)cooling,refreshing.- I the worn testimony of as enjoyed a large pa-of the §$2:KH Sherrill,5e.,George P i 4 -es DEN *Representative W wv Venable of fenave for many years The sur-;_Southbound railway,40 fe@t |3.D.Hari $10 J Tharpe,81;RP.Al.Y Poh weea oe.the FIA .ommressio::ei Vine dDUTl ne chia re wiht Gears .below.Green’s head struck one of {|titen.$1.JB Rodgers,st:W.W.Tharpe,¢ F5c.at TDruggintsorby maildirect,OFFIC myressiounl distriet,whe “oY ’are Messrs.S.A th ;od I ti;Wo W.Tharpe,|‘e MILLS BUILDING, was regularly summoner vo appear Lowrance and T.J Williams Mr.._=wae)pit UPS!OMG |karuson,mers eee Wee 81;Aj Sample(eithercolor)for 2c.Stamp.Over Mrs.Sims’Millinery Store. be fore that body,the Lauderdale Lowrance makes his home in Flori-7 oaealee a od aleo fe irful-shia Henninver,$1:OC.Catther.OL Tanke |Gouna,Dn.40South Filth St.,Brooklyn,N.Y.Statesville,N.C. county grand jury returned)an ine /#&eed part of tne time,where °een wee Creer:[@ Milhollwnd.$3.Frawk Doris,81;A.C.HOURS #to6."PHONE $1. dictment against Emper:he ha dluable sroperty Marvin Shore,who was ciriv ing |Jobneon,fo D Mankenship,b0e.;Clar-7 "yperor William Sarr property,and Mr h Snes Cabberii , of Germany,charginy —robbers a William desires to retire from the |the ak knocked off by wa Piha:33 t “Gea ei MAY R’s .Pash son,murder,plotting brit ry M mill business and devote his tim ¢impact wi a piece of timber |Sherrill,5 5 ;oan,;Cart »brabe and :'e to won Mi,M 1)Stinson,81;T.L Bailey conspiracy,‘all against.the.peace Dis farm and other interests,Neith-railing at the end of the bridge and {ts 3 Ro Hetlend,86:C.F.Rortner,$2;%Wonderful Remed F Sod ize of cena,the peace crix eine to quit work while We ta),ome,ie.We was verily Bake at We &,Rida a,Bee yee ie’‘:3 y°‘or .wt ,Y .>SR:—able Too energetic for that.They at se is Injuries May net l«fa-|1,A.Comper,85;Mire.BOR oe S!)It 8 good.NufSed. a &puty —Kennedy inform er nally to work..4 b a ‘5:Aum Mandy Cowles,85;) the court he would ye fte Mr.Floyd Smith of the W.M.Nee ,ETTEV .\€,BD.Bailey,so:J.B.Glover,85;B.M.:Sc :Kaiser if provided —with the,ae Co.grocery store,spent his ven G ee oe ee ‘en a oe W.Mac.|: ad at his home in Enochvi ,en.states that the artil-les i Vv _=;oe &|One Bot ed xclusi by ow what's it all about?Varner and wife al Mt geo lery range for the division 1.oo |aie ote May nt -.oH:“ane Dose Convinces teh ec vel Teun.whe ent a sent vie trained at Charlotte Will probably|Matte Strout.#1:Cart Alexander,85;Neil Statesville Mint Cola . isiting |e located F :Alexander,#1.1 N ,:StatesvilleMR.PIERCE friends and re ape jhe located at Fayetteville,aod the .Brown,$5;D.8.Thom-Co. Mr.1 :cE.:and relatives here,returned |division hiked there f .Che |as,$5:B.F.Russet,83;8.W.Calbreth,82; ten “4 A Hayes who has been liv were?as ee ;;\tlee wa win maa ~_re hl ne)Cus.>:N.W.Company. (@ for sme time «m orney T.G ‘ure,wife and nee vo:ere "eKlwee,$1;Mra,D, @ week With Iredell relativesasa ir Cds of Salisbury,—spent evant |ee?n Probability of nn be 1th:Mhgenes Kathe We ~—Phone 82. Saturday night for Washinyto:"i '‘nys here last week,visiting Mr |additional ca Cloer,25e.;Carlton haben :Paceee @uted to The le.“ton Mr.pure?vente,38 j ‘|site.General Wood stated =¢ander,$1;M ~2:wenty-four Bottles >Landmark th::.Mr.and Mrs,8.M.)»$1:Mrs.Beam,S0e.;Mise Bell one he expected an appointment ‘en pri F we ~M.C.Cochran of Clear:|4in en cee oe a loca en ts >.ee $3;Mrs.T : §quartermaster’s department |ater,Fla.,who was re visiting mH the first snow in,8 oe|in the he made ite Allinon,$i :Minn Iinn Dewh Ot;Roller Mill For Sale Gatien Gnd t be acciemed to ag tue eae a Harriet Goodman,North training impossible i)the Maomres.a én Flour . ,ete ©her homelast week io ;pene a ‘will visit relatives in Columbia .ti Men W.R Mille Ste Beatinines e Swe of tte Gem ete Gee,we oferty oo <ia on}The Southern railway has ter the |bee Kinewtd.fie:dutia ;‘_enle,privately,oneof thebest 100-barret per Same.Rev.W.E.Weat,|contractforanewstationat Now.|i 2 we ae i in one of thebeet towns in the 4 popular pastor of Prospect and Cen-|ton andwork will om ns Sie ;Menket-Crate iin,;WilliamsFurnitureGo.628;By ; tenn $name elia no Awe Ohl,a ae ~ovegeter® n. PR P PP rr SS Ts ~ . Phone 23. ands out your ex- when you have our HiArenottedfromcarying "IN THE BANK. Your Bank Account depends on what. you save, It is not a matter OF GOOD FORTUNE. Acquire the saving habit while your in- come is small and it wili be casicr as your income increases to Increase Your Bank Account. Now is the opportune time to open an Account with us. People’s Loan and Savings Bank. “MONEY MAKES THE WAY EASY.” GEO.H.BROWN -President. O.L.TURNER -Cashier. — FOR SALE -b.- Ye acres,Novel,prodactive.,rei land farm,fronting quartcr mile en the met trav ted,cubhe,niet ry read loading inte States- ville;miee two-story,frame seven-room dwelling,located ina beautiful erose;bern and ovt-uildings,fine well water,two of fruit; acrea in coltivation branehes;acunda quarter of mile from sehool and churches:8 ,30 acres in meadow,balance in ef which is inclesed in pas farm, An execpiional Will take in part woodland,part ture, epportunity te bay a fin payment,small farm if well located. ERNEST G.GAITHER. Insurance,stocks and Real Estate. Satesville,N.C, ‘rain and stock ES AR A RNR :|THIs BANK ee ~ B thirty hundred bomeet the at as:nt revenue could be rais-ed for extra war purposesLae Sy:or corporation,and without inSoapentfromioeare ‘taxes must come.e proposes,he said,to raise a larger pofwarrevenuebydirect taxationlandlessbybonds,distributing the ent generations. its alone,with|from_intoxicants.‘tor Simmons said: sonditions ;comes and war profits as $200,000,000 suggest \the expenses of the war. milliens of ac’ epg _ ypldston -—saiddiscussedthewar and the draft act ae Burns and had roportion particfn-jsend some money for them to thethechief!Jeffersonian for this purpose,but ‘and just source of revenue to defray)the defendant did not agree to do se, Apparent+'and two weeks later,in another con- HW the House did not take this view,|versation with the witness,the de- 'As the war profits for 1916 exeeed|fendant told him he had not accept- dollara,|ed any funds fer the purpose stated, “eae Burns was ttyvitating |tion 8 of the Sep saneatress,“rare saa heitxthathe’collectedigitedandwardedtoTomWatson of,Watson to bring a case to testconstitutionalityofthedraft t.The one witness exaniined for theProf.W.H.Liles ofhehadfrequently never heardBurnssayawordwhichwouldindi-gate that he entertained any idea ofivisinganyonetodisobeythelaw.urns is a subseriber to Watson's burden between the future and pres+|Paper,said the witness,but he had Nearly $1,400,000,-|neve 000 of the new war texes are to be/it fund ! obtained from incomes and war prof-|for the purpose of testing the consti- more|tutionality of the draft act. Continuing =n the defendant told him some known the defendant to solictopesenttheJeffersonian On one had osked him if he would the House levy of $200,000,000 from and so far as the witness knew the |war excess profits in the bill estimat+|defendant had always refused to ac- ‘ed to raise $1,860,000,000 manifest equities of situation required.At least should be drawn from incomes exrean profit ited :Senator Sunrmens ubmitted star the cose BR tats tid to be compiled by -F.) Morgan &Company showing that 44 rreat corporations alone will,payvadertheproposedcomm<tee revis- ivainst only &77,7386,000undertheHousebill.He said the e war profits and not an vrofits tax.The House standard isnsatisfactory,artificial and arbitrary.” 9)whol!) Reasons For Income Tax tnerease., Re:ns fer inereasing corpora- ion income taxes Senator Simmons 'as falloThenec iy for roused peve.— le of ue!)of th rere Cceficien-Let :'y estimat r the »presentedhythecretaryofcheTreasuryaf- hill w recvramitte|,at my t,o oa ait of Smoot ‘nt to the food cortrod bill "Asn onrtin)adjustmens af an al- lego!ani an apparent discrimination wainst partnershins,which dise - ination s avcentuated by the ac- tion of the committee in subjectine incividvals te the war provdts tax.” The propose!tux en co.poration . mitivided surplus,he declared, would more nearly balance the rela-tive conditions ns between eornora- “ons,partnership and individuals with respect ta income surtaxes.”‘ The House 5 per cent.gross sales eSamemento meena epee tiXCs,he sail,were “a very ques mmmnmee ionable metho!of raising revenue.” Is ec sentially an institution for allthePeople.tt places at the dis- posal of the Farmer and Laboring Man as well as the business man every facility that a conservatively managed Bank may offer. Merchants and Farmers’Bank. Of Statesville,N.C. “The Bank For Your Savings,” C.S.Tomlin,Pres..B.Bunch,Cashier, L.K.Lazenby,View L.J.A.Knox,Assis’t.C. DIRECTORS. C.S.Tomlin.7 W.S.Page.I.K.Lazenby.:Ii.G.Gaither. kK.B.Watts.:J.A.Knox.J.£.Stevenson.-J.R.Hill.Clarence Stimpson.-Herman Wallace.kh.T.Weatherman, SURE&“SEOEE i Every good citizen at this time should do his share toward strengthening the Federal Reserve Banking System whichourGovernmenthascreatedwithits billion dollars of resources to stand backofitsmemberbanksandalltheirde-positors.*You can contribute directly to thestrengthofthissystem,andatthe sametimesecureitsbydepositingyourmoneyus,since part of everydollaryoudepositwithusgoesdirectlyintothenewsystem,where it is alwaysmeyouwhenwanted.is a suggestion for prompt action. MemberFederal ReserveSystem. STATESVILLE,N.C. Send for Booklet,“HowDoesit Benefit Me?” PATRIOTISM BUSINESS 4 ‘t }Regarding climination of the HouseRex cereral 10 per cent,ad valorem tar iff levy.Mr.Simmons saat: “While the government would r- elize from those tariff jovies Sva0, ¢000,900,the domesitc proavucers 0thisecouncrywouldaeairesultcol- lect out of the peeple oan amount heee or four times greater than the amount which it is estimated the covernment vill reesive from —th:tne In the face of these faets the ontention of seme that the Senat mendments in these ec pects has nereaced the tax te ve paid hy the masces of the peopie is manifest!y withont foundation,Oh the ott hand,it seems lear oenat by the amendments the Senate has relies the nes ple of the country of several handred millions of dellars wh they would under the House prov ion have been compelled te pay eith er to the movernment or io privat: interests,Reduced Tobarco Taxes. The reduced tobaceoa taxe,he aid,would raise the same reveny the House rates without burdenineeitherproducerserconsume: Liquer taxes,he added,were ratse| because the food control laws previonsstoppingmanufaccuceofwhis key made it advisable to find other resonte WUFCES,Mr.Simmon< atement sezarding the publishers’ AX WAAR: “Your committee deetded to elim nate the House zone system because twas made cloar to them that it i 1 tax whieh would be not only bur 'ome,but,inca number of casedisastrous,to many valuable pub! cations,Representatives of —pract ealiy all the great publications this country appepred =bhefore =th committee against this tax.The tu ulstituicd by your committee | loytien!one,it-muse be confess: owas the best your cammitt was able t.devise tn view of the f piesent nditions of the publish: $busines Negro Troops Will Not to the South. None of the colored troops from Northern and Western States willbesenttoSouthernmobilization feenmps.The colored organization b the War Department is quote!i: fect as saying,although called into Federal service like other unit 0 their State organizations,wil!main at their regular home stat for the present to guard Federal: State property and other The policy against sending colored Guardsmen to the Southern StateswherethegreatmajorityofthFedoraltrainingcampsarelocate: was adopted,it was understood,the request of the cenaressional de!egations from the several State« All of which means that somebody has been wise enough to see the dan ger of sending negro t fromNorthandWesttouthern training .ial to f a)along Suhoieaii,me i NS = Come servi staness by taking Chamberlain's Tablet»« ow =f ef oirSenatecommitteeproposesaspectf-oexcess; (} fe ter from mon umount of meat. does naticept money to be sent the Jefferse- the nian for one-draft act B half of the sum proposed to he raisedand goo «witness for the defence that at the conelausion of his the purpose of testing the This government witness made so testimony was dismissed, rEOFOSANSOOOET Would Fix Corn Prices. Resolutions asking the Federal ::as an rovernment to fix minimum priceionwarprofitstaxesof$2239,077,000,;eu t *”7)cents and a maximum price ofproposed).jushel for corn for the purpose ring a sufficient acreage to weourage steeckmen,and also urg- cxemption from.the draft of fecder,,Were adopted by the cnvo Livestock Exchange. The effort te fix prices on eorn is !on the contention that the present priee ef eorn is abnormal 8 prohibitive and is deterringfatteningcattle,hogs |sheep and causing them to mar-rematurely thousands of —ani- not ready to yield the maxi- Mu v »ealtivatior GOOD NEWs.- Statesville Readers Have heard ti and Profited Thereby. “Good news travels fast,”and the ma.y D&d back sufferers in States- ©are lad to learn”where relief moy be found, ned @eHing back is fad no thanks,to Doan’s Many a tame,wenk more, Kidney Pills.Our citizens are telling the rood news of their cxperience with thy tested remedy.Hereis an example we reading: Mrs.¢.0.Keanerly,?48 Western Ave.,Statesville,ays:“M back J eaused me misery and after tahing of Doan's Kidney Pills 1 1!consider Donn’a a few dose was reheved. fire kidney medicine and den’t Irosi- tute to recommend them.” Price 600,at all +Jers’[event imply ask fora branes rene ds:ped Doan's Kidin \|aye the a that Mrs.Kennerly bac.|te Ma rm Co,,Props.,beiffale,N.Y Barium Springs Waiter. Will relicve when dru;fail Stomach,Kidney and Bladder Trouble,Rheumatiom,Bezema and other Skin disease).‘Phone W \ EVANS ani the POLK GRAY DPRUG CO. “FOR SALE. ‘Two high-cla f om healthful commun tie j 'nd nt necewsary outharldi ‘M exeetienthy adapted ¢‘Inte te markets;mails daiiy ©1 top hiwhwray of nenr 'hip oon both sides:about '' chading pasture reme ne 4-reom tenant house ard ttOtheralsoontop-sot e tuby half in wired for pn-t ! 0 aeres fertile,dredwed ««These properties ar:‘tate te ¢oCcupaney by owner:B ed sale and ne sacrifices,but prices en ‘nd sonable,If nterested.'{ see oor address Re I Aug.3 The Brady Printing (0. Has taken over from R.P.Allison the agency for various Magazines and Book | Publications and wants your orders for sub- scriptions to Maga- zines of all kinds.Will order any book wanted. All Mayazines on coun- tersoon as out. | —eo Se Compositioninone,two and ' ' _threeply. C.WATKINS.ne i leomplying with the pinin Qirrnctiw al———-.nw eae iaotneoumpanycohpaceeeeC.WATKINS, og me i" QS Meotronsced stillpaying toppricesfor old style cottonseedhullsbecausethey prefer e bulky filler. Others are paying muchless for UCKEYEHULLS LNTLESS and are making them as bulky as old style hulls by wetting them down a half hour or so before using. By adding an equal part of water to Buckeye Hulls and thoroughly they will swell and give you as bulky a as you want.Most important,the bulki- ness will be due to water which is of value to your cattle —not to lint which has no food value whatever. Other Advantages Buckeye Hulls go farther.Secked——-easy te handle. They allow better assimilationof “They mix well with other forage. other food.Take half es mvuch space in the No trash or dust.barn, Mr,Benjamin Thompson,Boldhnob,Ark., is feeding Buckeye Hulls to stock cattle,He says that he gets more food value per ton with less waste. He has bought five tons and hes them stored in bern. He says that they occupy less space than old style hulls. To securethehestresultsand to develop the onsilage odor,wet the hulle t twelve hours before Feeding.Mi is easy to do this by" downnight and morning for thenext feoding.lf ait anytime thiscannot be done,wet down at leastthirty tcinutes.If you preferto feed thehulls dry,useonly Aalf as muchby bulk asofoldstyle bulls.: Book of Mixed Feeds Free Gives the right formula for every combination of feeds used in the South.Tells how much to feed for maintenance,for milk,for fat- tening,for work.Describes Buckeye Hulls and givesdirections for using them properly.Send for your copy to the nearest mill. Den.k The Buckeye Cotton Oil Co.dem.« irmingh CG ood Little Pook =.Se"Jachean Macon .Seder aSe a s a i rf A eA A REE e eas =eames: eee eR EC COLO NCC OC OO AIT ae ae mene en a ee (QHQHOMOHOMTRORGE.BOBSHOHCEOODOC OHOLIONO CO ”“HOO sat 4 C LIABLE TO ATTACK you never know WHEN; Bat -you know WHERE you can get prompt and sure relief from the il!s that summer brings, Our PRESCRIPTION DEPARTMENT affords you i3 3 Any day exclusive attention and eminently efficient service at all times. Leave your troubles “ON THE SQUARE”! POLK GRAY DRUG CO. ORO III re HOODIE OLMIS OY HORIIPIO vd CLEARANCE SALE! We are offering some splendid values in White Skirts. 1 dot $1.25 to 91.59,°98ec., 1 lot $1.75 to $2.25,:$1 48. 1 lot $2.50 to #3 09,-$1.98. 1 lot $3.25 to $4.50,-$2.79. We still have some attractive Shirt Waists left in Voiland Crepe de Chine.We ave very anxious to close out this lot before vetting in our new line,See us before buying millinery and Ready-to-Wears,we will save you money. MRS.MARY SIMS. The Cash Store. THE STATESVILLE REALTY &INVESTMENT COMPANY Appreciates the very liberal patronage of itsfriendsandpolicyholders,both NEW and OLD.Our office is an open one,and we invite all our customers and those who will become customers to use the same when they so desire,As in the past,we will strive to give the same HIGH GRADE SERVICEthathaswonforthisCompanythegoodwill andconfidenceofoverseventeenhundredpatrons. “WE INSURE ANYTHING INSURABLE”and PAY ALLHONESTLOSSESINCASHWITHOUTDISCOUNT. We will be glad to have you call at our officeforanyinformation,or te e No,54 if our service in needed. Wedo NOTARYPULICworkalso.J.F.CARLTON,- Eom Men’s Suits Men’s Suits Such well-known manes as Griffon Opened with a rush,hundredsof people came—See Kool Kloth,in Suits to choose from.$20.00 Values,ae 7 avarietyof sizes styles,Daddy2eeeeeelotsofthemonlycametolook,but they went |Rabbit Price 15.03.away witha turn of packages because our prices $5.65. —es al >ec ical i inkinMen's Suits ippeal to the econom instinct of th g Men's Suim | This sr uranium people.Our $12.50 line of Suitsisourchoiceofcar$15.00 Worst —.|...of Cashmeresand Worsteds.DaddySuits,Daddy Rabbit Price,|This great Daddy Rabbit Sale will continue till |Rabbit Price,‘ ba)OQ |‘*s 85._ee ——|Saturday,August 25th,—a look is all we ask. Dress Shirts |We have everything for Men and Boys and at Felt Hats A beautitul ine of $1.50 Shirts to ]ae ek S ;;“Comeearly so you can get your size make \lection from.Daday !prices to suit you and =o pocket book.in a Hat to suit you.$3.00 values, Rabbit Price ;;Daddy Rabbit Price, S119.|82.45. ae Men’s Unde |Men’arrecechins|Aen’s Underwear |Men's Underwe Panamne Hats Jost pene tho.lmyecsioud une ;Union Suits und sinule-plece gar-Best grade,single-piece garments.In sizes to fit any kind of a head — conservative cones.31.000 values.ee =me $1.0 values.1 0¢,values.Daddy Rabbit Price,even a blockhead.—$3.50 values,Daddy |EPs !Haddy Rabbit Price,.Daddy Rabbit Price,|se |BC,|IBC.82.65, }i eyee ee ee This Sale Continues Day By Day Till Saturday,August 25th. eeeoe ee a eS A RT eee — THE LANDMARK >F*8S ©reer nenee emreern i fechimgs Cummities Vppoentes ay Ev tension +1 |Oty :of ae oe ey |WwW t|;“i ..PINE SHINGLES! weit os mat i «Those Who Know Better Kiln DriedFlooring,JUNIPER CEDAR SHINGLES! Whenever You Noed a General Tonle church.i)th }.Base Case RED CEDAR SHINGLES! comet Take drove's .|Than (WATKINS say Lumber Ceiling,’and Naile,Ridge Roll,Valley Tin,Brown A The O14 Standard Grove’s Tasteless MR.TAFT BETTER ’d Green Shingle Stains.‘Wen t chill Tonic is equally valuable as @ Ex-Prosident 7 'at Won't be cheaper for many years—Moulding.ws ©.WATKINS,Shingle King of Ire-Pies Cured in 6 to 14 Days .om ral Tonie because it contains the Clay Cer } .woll koe-ven bewewill)y .nd TRON ndition nnaRYfeteto'‘Ny ca om )ach |;a ieneorPitss,Ott Motaria,Frriches the Blood amd”that he ix believed fo be _|POR MENT—Two-harse teem,gent 11 ALP CEES omHesroiOSSeSule:OP |Sai!a a aRTEREO7,SEE ee a a .hi Id Here and es They Let the Gypales Ga =ew here..—The Loee!Courts. ‘iy Ai)who }i an Pie eit RC iS \S HIGHWAY ROBPERS oa,hurr :a —ALSO—“|WOOLNAP BLANKETS d Ready for eariy selling at prices that cannot be duplicated later in the season.- eo We hive them in White,Tan,Grey and a beautiful range of Plaids at ~2.00,$3,00 $3.50,$4.00,35.00,$5.50,6.00,$7.50 and *10.00 per pair.All fresh new goods, Yours truly, 7 “|Wear well because they are made of the best material by the most skillful craftmen. he |Shoot well because they hold the charge compactly together at-extreme ranges. Handie weil because the greatest attention has always been paid t6 the distribution Pent!of wood and metal,to insure perfect balance and the most symmetrical outline. _y |Twenty-bore Parkers have get the pace for small bores in America,and are grow- .‘|iny in popularity every year*with the most progressive sportsmen. For further information regarding guns in gauges ranging from 8 to 23,address,a |Shen!Sots,PARKER BROS,Master Gun Makers,Meriden,Conn,U.S.A. :73 wer ar |*y .nic properticaof QUININE|fering intestinal _el Raee.oF we ware,80 BUILD NOW!.C.WATKINS.sel)County. It acts on the Liver,Drives ‘ inceMonday:ann “Munday,Statesville;accept- i Harlee Anderson, man,R-2;exempted;wife ‘and chil.dren.AmosStatesville;children.Otho Eugene Sigmon,Statesville; Verne Brown,_colored,exempted;wife and Moores-ville,R-4;aceepted;son of aged pa- rents,Jom.Elisha Smith,Harmony;ex-aged,©wife and children. Compton,Ostwalt;exempt- NerthCarelineWhilenoex FF F give the tieal unit. These troops willa-at division of Harmony supervisor ofandMr.H.B.Overecach roffivies.;aa general meeting ofthedepartmentsisheldin the _. willbe toGuardand will be organized from= en forformingthiscompositeaieion,asfirsttacticalorganizationoftheGuardtobeperfectedtroopsweredraftedintoFederalarmy,it Sanee OeplanhasbeenendorsedSovernorsofvirtuallyalltheaThepresumablylidifytheNational80-towholecountryanterestinthedivisionwhichmignznotbesostrongifthetroopsfromanStatehadbeenusedtoformthistac-one The division will be composed of aed;pent et troop of cavalry,machine gun bat-William eeckee,Moores-|talion,two infantry brigades,an ar-ville;eg physical disability.|tillery brigade,an engineer train,Thompson Morrow,|ammunition train and sanitaryMooresville;enemnied;s,physical dis-/train.ability.The time and pee of mobilizationBarnettClydeCampbeii,Charles;|2re not made puexempted;wife and children.Nominations of nearly 200 gener-nie Pinkney Paine,Charles;}al officers in the national army,in-3.wife and child.;DeWitte Greene,States-ville;exempted;wife and child.Samuel Japtha WestmorelandMooresville;exempted;wife andchildren.John Pearl Rhinehardt,Moores- parents.ville;accepted;>»*_dames Baxter Minish,Statesville;exempted;wife and chjidren.wrens Carter —.mS navexempted;isabilitSmithJamesPoengStatesvilie;exempted;wife and children.William P.Blackwerfer,Dunlap;exempted;physical Msanility.Henry Ross Bunch,Statesville;accepted;is a licensed embalmer andhasvolunteeredinPurpleine exempted ;:John Crishaw,colored,Moores-ville;accepted;failed to respond.StonyFranklinBuretteWiison, i;made no claim.Point,R-1;J.A.Brotherton,Statesville;ac-cepted;father. Troy Garland Shoemaker,Eufola,R-1;sccepted;wife.John omer Morgan,Statesville;exempted;physical disability.Fred.Jasper Murdoch,Statesville, R-1;exempted;physical =. e, exemRa - Silas Smith,colored,MooresviiF.D.;exempted;physical disa-bility.Ernest Howard Graham,colored, Mooresville;exempted;wife andchildren.Frank Bratton Alexander,Moores- ville,R-3;exempted;wife and chil-ren. dohn Bell Glover,Jr.,Statesville;exempted;wife and child.James ‘Burley Wilcox,New Hope;—eneeea;physical disability—too tall,Fdgar Meter Renegar,Harmony;exempted;wife and children.James Daley Moose,Statesville; accepted;failed to respond.Benjamin Franklin Welman,StonyPoint;accepted;no claim.William Humphrey Johnson,Troutman,R-1;accepted;wife.DeWitte ‘Simonton,colored,Mooresville;accepted;vatied to re- spond,Lloyd LaFayette Deaton,States-ville,R-1;accepted;wife and moth- er.Rockwell Ingram,East Monbo;exempted;wife and children .Vance Hasty,Statesville;exempt-ed;ndent motherRtaHedrick,Statesville;ex-empted;member Company E (lIre-dell Blues).Raymond Thomas,colored,States.ville;"cued exem:Lackey Myers,Mooresville; ex-empted;wife and children.Avery Hi Harmo-ny;exempted;wife id,William Price,;.dead.Carey Orlander C Moores-ville;accepted;claimed dependenter,Frank Alexander Starrette,Statesville;exempted;in navy.Doctor taal colored,a R.F.D.;waived exemp-tion.James Fred.MeNeelyville,exempted;joined helda yo Felix Goodman,Moores-ville;exempted;wife and children,James Franklin Hunt,colored;Elmwood;exempted;wife and chil- William =Alexander Claywell,ae R-5;accepted;waived Jonah Harris,Turnersburg; ex-;wife and children.Bailey u cluding officers ofandtheNational regular army,will forces now being Similarly the tions govern the ing soldiers. virtuall Guard officers oferals tional Guard,with ice. rank. elude: Virginia; ficers mayofthefighting at Fort Benjaminmajorgeneral;Iver,of theneral;he 25th infantry, eral. ern district Troutman emption loce!board.TheandHt ls of were exTheboard convene at Gibson. made by the President.37 new major generals to be createdforthedurationofthewarandfromtheexistingmajorgeneralsofthe —and division ¢ommanders of all National Guard or and includes the only Col. infantry,toCol.Samuel emption were allowed.James P.Hayes waraministerialandwasexemptedbythelocal ‘board.Woodsides made no claimlocalsuppose’?the distrivthimonaccountofoccupation.The lo-cal boord refused to exempt Hun-sucker,who claimed dependent wife.Hayes*case has not been before the the reguidr armyGuard,have been come the From the ravsed,regulars,national army.brigade commanderswillbeselectedfromthelistofmorethan100newbrigadiers.The list ofgeneralofficersshowsthatthe se-niority has been followed closely,except where men in line for promo-tion were found wanting by —board of officers which gina theommiendationstot ThetulelaiddownbyfortheSeatofgeanesdirectedthattwomajorqualifica-board —evidenceduringtheirarmycareersofskillin leading troops in action -nd in train- The list of major generals takes in all of the army brigadiers two Nationalthatrank-——Gen- a General forces, Col. O’Ryan of New York andClementsofPennsylania. of brigadiers is made up from existing list of brigadiers of the Na-score or morecolonelsofthatservicewhoaread-vanced in rank and of regular armycolonelsfromeacharmoftheserv-To fill out the list of coast ar-tillery appointments,colonels were advancea toNationalGuardofficers nomi-nated to be brigadier generalsBrigadierGeneralRobertSteiner,Alabama;Brigadier Gener-al Walter A.Harris,Georgia;Brig-adier General Cecil C.Vaughan,BrigadierrenceO.Tyson,Tennessee,and Colo-nel Arthur H.Blanding,Florida.All of the commissions are for thedurationofthewaronlyandareinthenationalarmy,although the of- be assigned to any partregulars,Guardsmen or selective draft troops.Three North Caroiinians were onthelistofthosepromoted-win F.Glenn,of the 18th infantry, The iistthe two lieutenantbrigadier|° in-E. dr,Law- Ead- Harrison,Ind.,to George W. Faison to brigadier seazic n at That not for board.It woard excu W.R. J.oH. yesterdayboardadjournedthecallweChairman‘a the allow student Me-brigadier of wen- THE DISTRICT BOARD SITS. Passed on Eight Cases FromIredellYesterday. The exemption board for the west- was inFederalConnsei in Statesvillethe yesterday.B peeved on eight ap-neals from"hres Claims of RoyT,Troutman,Joseph Butler Wood-ides and Lonnie Hunrucker for ex- of ed. ex- is sed Hudspeth |Byers were not allowed.LJ.P.Rhinehardt and Gibbs to +|terday noon.Following the joint iz.the groups separate for ‘asions.Tuesday afternoon Missgavelessonsindrawing.Sheedtheteachersinblackboard Iing—the correct method of ethechalkandtheartoftraachildtoformsketchesoflanterns,trees,ete.,from their childish mark-ings on the blackboard.Highsmith eddressed theteachersonthesubjectoftheteach-ng of reading.Reading is the get-ting of thought from the printedpage.The child must be tone:that the story is an extheexperienceofthe author,athewordsaresymbolsofliens:then the child must be in- terpretation of the sym »&Vocalexpressionofthesymbols;pe Agtaughttosaythingstoan:There are four -essentials to asystemofreading.Themusthavefirstthechild's abasisofinterest—the t tinterestachildmustcome—thestory;ok there must be =story quality;third,the childreadbytheuseofthetem;fourth,there mustgoodmaterialtoread.Mr.smith said that we shall never haveaneducatedcitizenshipwhenthechildrenreadthefirstprimerinoneyear,and one book each followingr;each child should read sixkseachyear.The silent reading lesson is im-vortant as well as the oral Theysould urged 2.5soyadethi.Wereeda’«subject of “Common Speech.”ednesday afternoon Miss Ful-um gave a_lesson in landscape rawin,Follewing_this lessonHighsraithspokeonthesub-Prof. ject of composition,dealin ~tv with oral composition.lan- guage is spoken to a much erentialvercentagethanitiswrrtten.Les-sons in oral oe,should occu-‘vy an important place in the schoolwork,ae m the first threegrades.re must be a good mod-el in oral composition offered thechildrenbytheteacher;the chil-dren must be taught the habit of talking correctly.Games and drillsshouldbeemployedtogivethechild an —"*opportunit =the =of iy language.teach should emphasize to i €Risdon four forms of oral composition— narration,description,exposition and argumentation. Singing occupies the first twentyminutesoftheafternoonsessionoftheInstitute.Yesterday after the singing Miss Fulrehum gave a draw- ing lesson for half an hour.Prof. Highsmith then addressed the toach- ers on the subject of written composi-tien.First allow the pupil to make a rough draft,then require him to r-write the composition.There must befurnishedthepupilanabundanceof ideas from experience and material—the social letter,the business letter, letters of invitation,acceptance,con-graulation and sympathy.The teach- ers were then requ red to write an ad- vertisement for a lost article.Prof Highsmith urged that in the teaching of punctuation the teacher should rive the pupils only a few rules.Help the purils form correct habits in writingratherthanburdenthemwithmanyrules. Miss Hendley Goes to Greenviile Miss Daisy Hendley,who has beenengagedinnewspaperwork—inStatesvilleforsometime,and whohasbeenwithTheLandmarksincelastJanuary,has accepted a_posi-tion on the Piedmont,an afternoondailyatGreenville,3.»and willleaveforGreenvilleMissHendleyisacapenteandin- lustrious news -gatherer.In addi-tion to her work on The LandmarkshehasbeentheStavesvilierepre- sentative of a number of daily pa-pers.The Landmark regrets to partwithMissHendleyandwishesforherinhernewfieldthesuccessshe deserves,and the numerous friendsshehasmadeduringherstayinStatesvillewilljoinheartilyinthe wish.|Miss Hendley is a daughter of Mr,jand Mrs.A.F.Hendluy of Elmwoodcommunity. “™~—AT NEW STIRLING. oung People’s Chris‘ain =n-ion of the A.R.P.Chureh,in sessionataoeadjournedrs ar at New“horchrch nivel 1 Rev P.A. was electedvendsaeMesheone:offirstvicepresident. —Miss Bernice”Turher should irling credited with $1 to the Red Cro[ees oe been omitt .wastedafterahearingintheAsheville police court.Mrs.Thos.T.Browne,wife of thedirectoroftheNorthCaroiinacornclubs,died Wednesday in Raieign.Husband and three children one an infant —survive. At Smithfield peare church,Pine-ville township,Mecklenburg county,Sunday night,Dan Cathey was shotandkilledandanothernegrowaswounded.lialy Brown is held to an-swer for the killing. The Inter-State Commerce Com-mission has ordered a hearing to beheldatAshevilleSeptember21,on-|the complaints of the Graham Coun-ty Lumber Company and CarolinaWoodProductionCompanyagainstheSouthernrailway. Arthur Bailey,a young man liv-ing in North Brook,near Lincolnton,shot a part of his foot off with ashotgun,According to report he at-tempted to a enake and theloadtookeffectinhisroot.He hadbeendraftedforarmyservice. Henry Dobbins and _Luther Par-ker,boys of Yadkinviile,took a joyrideinaboFordandwhilecoingat35to40milesanhourthemachineturnedover.WDobdbins wasbruisedandcut.The Parker boy'sanklewasbrokenandhewasother-vise badly injured. With the establishment of acheesefactorybytheValleCrucisIndustrialSchgol,Miss Hefner,agraduateoftheschool,has been ap-pointed cheese maker and becomesthefirstintheSouth.Miss HefnertookacourseincheesemakingatagethePennsylvaniaStateCollege. New Officers at Home. Bronzed and physically fit by threemonths’train in the camp atFortOg’Statesville’s contin-gent of new officers for tne nationalarmyarrivedhomeWednesdayeve-ning and are receiving the glad handgjand—from friends and lesson.The child must have -|kin,thing definite to look for when he|_First Lieut.“Alan R.Anderson,studies silently.No child should be|Second Lieuts.Harry Gregory andpromotedonthebasisofreadingGodfreyKimball,eeservice;aloud successfully.Second Lieuts.John ott and Incidentally r.Highsmith in-|Weston Taylor,field artillery;Sec-quired of the teachers whether they |°"!Lieut.Owen W.rd,caval- had taken ae cmmgpat al|'y;Second Lieut.Philip "second¢|a'fartermaster oer:Hermanrtment,Mills weale” he youngBaie Mihave no ordersbutitisgenerallyunderstoodtheywillreportatColumbia,S.C.,about the 29th.Messrs.Minor R.Adams andJamesPressly,who will return to the second camp on the 27th,are athometoawaittheopeningofthecampJamesR.Stewart of Catawba,who was made a captain of infantry,wasformerlyasergeantinCompanyE,Statesville;and Lieuts.Gregory and Leonard were sent to the camp fromCompanyE.The officers came home on aspecialcarfurnishedbytheSouth-ern for the Fort Oglethorpe party. Busy at Canning Plant —Sav-ing Fruit and Vegetables. The Iredell Canning Companyisoperatingitscanningfactoryev-ery day,the amount of fruits andvegetablespresentedtorcanningne-cessitating running we piant at night at times.Last week morethan700cansoffruitandvegeta- bles —veyetables for the most part —were canned.Beans,tomatoes and corn are the principal productsofferedforcanning.Of the quanti-‘y canned last week,about two-thirds was for the company,one-third for custom.Tie ptant is prov- ing a success for the conserving of quantities of vegetables that wouldotherwisegotowaste.Mr.A.C.Younger has the super-vision of the plant,with Mr.J.M.wey on the scene much of thetime.Mr.Younger has personal su-pervision of the exhausting andcookingTwo,sometimes —three,others are employed in preparing the products for canning Mr.Ramsey canned several cansofhistomatoesonthefirstdaythe alant was in operation.This week he opened a can and found the toma- toes excellent in flavor.The com-Pany invites the puitic to visit thevanttoobserveitsoperations. Union Services —The Churches Rev.Dr.Chas.Anderson,theFirstBaptistpastor,has returnedfromDavisSulphurSprings,wherehespentamonth’s vacation.Rev.J.H.Pressly will preach attheunionserviceattheFirstPres- byterian church Sunday evening.T Western Avenue Baptistchurch,Race Street Methodistchurch,Fifth Street Methodist church and Pressly Memorial churchareholdingunionservicesduringthismonth,every Sunday evening. services will be held SundayeveningattheWesternAvenueBap-List ro and will be conducted byRev.M.White.Rashes at Trinity EpiscopalchurchSundayat11a.m.Annual Children’s Day exercises:Salem church,near County Line, county,Sunday,19th.Public|“cordially invited. SEASON or ABU NDANC E.fruits of the carth are abun-Home-grown watermelons——are now plentiful,ie Thedant. great variety ofWecanlivenowandofthecannersgives hopenextwinter. FUrivaes nE PLANT BURNS.| FireLoss at Cross BeweyDead—Moores-ville News. Special Correspondence of The Landmark. Mooresville,Aug.16 One of the most disastrous fires that has ever oeé¢urred here consumed the}j, tare Souniies oe of Mr.B.4ae5Sons,between 5 and 6 y evening.lossisestimatedat$66,000,with no in- “Thefifire was started by a hot boxneartheboilerroomandbeforethe}bealarmcouldbeturnedin“!—were 2reading rapidly.compa responded in ane quicktime,"tee the dry frame buildingswereamassofflames,and the in-tense heat made it impossible to saveanything.The boiler burst with aterrifieexplosionthatdrovethecrowdback,and for a time therewasimminentdangeroftheflamescatchingtheMooresvilleFlourandOilMillsandShimpockBros.’store,|The Lanearby.Heroic work on the pert ofthefiremenandmembersofPiedmontbattery,who rushed ==seene when the alarm wasFSwasallthatsavedtheseeeingsandseveralresidences.managed to save the ar Tintingandafewstacksoflumberinrearofthefurniturepran:.The loss is heavy on Mr.Trout-man and his sons,who have thesympathyoftheentiretown.Theybeganthemanufactureoffurnitureonasmallseale14yearsago,and»y thrift and integrity had built upathrivingcoInconwiththis,the a good lumberbusinessandvtrecentlypur-chased a new planing ine.It has not as yetwhethertheplantwill beThousandsofdollarsare duecompanyforlumberandfurniturealreadydelivered,and a large ac-count is due by the government forlumber.All accounts are reliable.Besides this,Mr.Troutmanstockinotherprominentbusinessconcernshereandownsvaluablerealestateinthetownandcommu- nitSeventy workmen were empinthefurnitureplantandoutthemajorityofwhomaeout ofemploymentforthepresenAsilverteafororbanebenefitoftheRedCrosswasgivenMondayeve-|RaoeinavacantstoreroomGoodmandrugstore.LittleMissesSarahandJuliaJohnston,stooddressedasRedCressnurses,at the door to receive the silver of-fering,and several youngwhoworetheRedCross uniform,dispensed tea and cake.Music wasfurnishedthroughouttheevening.The offering amounted to $22.Sewing machines and other neces-sary erticles have been placed in theRedCrossworkroom,and the roomwillbeopenonTuesdaymorningsandFridayafternoons,The large feed barn of Mr.Robt.Cline,near Mt.Ulla,was burnedlastweek.It is supposed that thefireoriginatedfroma_gasoline en-rine used in baling straw in the barnshed.The contents of the barn,which included 200 bales of hay,were lost,together with a largeamountoflumberwhichhadbeen‘ttored in the barn.Mr.and Mrs.C.H.Hamilton ofCoddleCreekwereMooresvillevisit-ors Monday,Mr.Hamilton attend-ing the meeting of the creamery stockholders.They were accompa-nied by their guests,Mr.and Mrs.C.A.Rippy of South Carolina.MissIdaHendersonreturnedthisweekfromLoray,where she visited rela-tives.Miss Henderson became illwhileatLorayandsinceherreturnhasbeenconfinedtoherroomattheCommercialhotel.Mrs.Crawford Johnston left Wednesday for Weav- erville,where she will spend amonthwithMrs.Margaret VanceandMissMaryJohnston.Miss Annie Johnston entertained a number of her friends,includingseveralyoungmenofthePiedmontbattery,at her home Monday eve-ing,from 8 to 11.After spendingsometimeingamesandmusicthe ‘oung folks were invited to the din- ing room,where cream,cake and| fruits were served.Mrs.Abner Flowers of Morven is} visiting her son,Mr.W.8S.Flowers, ti the Commercial hotel,and her daughter,Mrs.John V.Barger. Mr.Will Cornelius,who lived on nart of the Mrs.Belle Corneliusfarm,four miles west of Moores- ville,died of pneumonia Tuesday morning,after an illness of ten} invs,aged about 50 years.The fu- neral and burial were at Rocky Mount Methodist church Wednesday at lla.m.,service by Rev.JKeeverofTroutman,the te Mr.Cornelius leaves ai wife,who was the daughter of Mr.Jake Black welder,and one child about three}vears old;three brothers Clarence ©.of Troutman,Zeb.C.in the West A.©,at Winston -Salem;ters,Mrs.George Brown of”,Miss Hattie CC.of Asheville, Miss Flora,and one sister living inCharlotte.VERNIE GOODMAN. The News Pleased Them. Members of:Company mleased when the news came this week that the North Carona =. were included in a divisionwouldbesenttoFrancetnthe nearfotute,An officer of the companysaysthebéyswouldmuchprefergo-ime direct to France than to be senttothetrainingcamp.The military Mazen- man is usually s ween idle.He wants to busy.If he has tohewouldrathergotoitthan nection|I four si te | E were | iF ITEMS LOCAL , meets tonight at 8 o’cloek.-e" Mr.D.$.Morrisonbore.tire a gea ~=The tee ofMills,Incmainwale “willbe aue for theseptembertat —Mr.Earl Moser hasfromaprotractedstayHot"Sp Ark.,and Cleveland.“ospringsMr.Moser tookthsandiphysics!condition waspeimprovedbythetreatment. ~—Relatives here have received amessagestatingthatMr.JohngeasswasmarriedinCharlottenight.Thename of the bride wak notiven.Mr,Burgess is a rator at Camp Greene, —There is so much cornsomeofitisgrowingwithoutshuck.Master Glenn Wileyfromthehismother,Mrs.J.A.Wiley,aterfivesmallearseo Se g hae arrived at the lread een inarealreadypatlesonfront. partments had any Lior on the reported ; nouncement is promisedmationisrecei is net Charter and Blanks.’The Statesville Notional Me 4 charter and thecain “spplication “?blanks,and2 ;"mg .L.Gilbert is see- retary.The applications for loans temporary arrangement inwillbegrantedassoonas the pleted.It is expected theplicantswhoseloanswereba2 about two weeks, ANSWERING THE CALL. |Alexander are the latest StatesvilleperetiometothePiedmontBatteryat ithe company for Camp Sevier at|Greenville,8.C.Mr.Alexander has jness of M.P.Alexander &Co.to his father,Mr.J.R.Alexander.Mr, |Bank|Mr.Glenn Morrison,who has enter- has reported:for duty at Newport, ae & AMBULANCE CORPS.Mr.Thomas Harlee Anderson has|volunteered for service in Va.,and has —accepted,lerson was tur down on the phys. training camp at kort Oglethorpeandalsobythelocalexemption BOILER EXPLOSION,Boiler exploded at saw mill of Ff, was hurt and there was propertydamage. ville has been ordered tovier,Greenville,8.C., would indicate that NeithertheWare nor can troops. incompatible with Geary ede Loan Association business. fore made a approved “alae stracts of titles to land will begin receiving their ss Mr.Jack Rodgers and Mr.Carl Mooresvile.They leave today with sold his interest in the grocery busi- |Rodgers was with the First National jed the United States naval service, GOES TO |Guire’s ambulance corps, hee examination foc the |board on account of a defective eye, isBiggers,Cabarrus county,yesthat|ee pee GO TO CAMP SEVPiedmontBattery the companyieGreenville.oe | FI 2 F H G i f Fs =f : l y i :4;:: i tf b e i y u h i y in i z &*rE i:;i2 [ ae ils|Sane is the statement inman; ‘—don.“It a 4 —_known to that °order ed that about |statesmen ©a oo an»12,000 men otksenhh ent of the 16/continues the statemens,“that teme:-antonments soon after September Central powers are eager to a,§oe —_3.They will first be cnsenined physi-peace on terms of restoration Thompson ”eally by army doctors and finally ac-status quo.Therefore,tere is no! -the Sa ©Sante Se copeed “eo re .This will take need of any protracted ¥—-some time and the men wrt!have to before saying what the attitude of tionbetae a,—be furnished with temporary quar-the allies <be.A status quo i i z aii f t a i ¢+5 a !‘ae “or ste ! | i vest!;:oe , wded :ers and rationed while awaiting ex-we would distinctly a German —full en —ee amination.Hf the full quota =ous ana a —cee which i assembled at one time great contu-*resident lison and other Ameri-|‘ ant,ond a ee et acires-sion would result.Presumably the can statesmen have|been em-|‘Why don tyou get a .‘have any y oY first increment will have ween organ-|phasizing as impossible and u .alittle timeto yourself?”2,500000 A }k tions from the Navy Department It ¢;pppoe J .ed into skeleton companies,battal-able.All the sacrifices of this ter-r . been current rumor,he added,vee or regiments before the second rible war will have been vain if we found that the New Perfection keeps kitchens cooler and cuts hadthat the magazine was exploded by :{.. malic aced ti arrives.©not conclude a peace which will|° +ny at i eT en In farming commen ities,ont insure the world against a repeti-drudgery mhalf.. "‘+boards will atrange the lists of those tion.” - making any statement concerning ;.po No coal or wood tolug,no ashes to empty,no Ask yourdealerto show you this—alsothenew posseer-o to fill the first increment with local The Washington announcement heer ,y ¢ —*wae &von of the ht even conditions in mind.Men =says Pope Benedict's poe dirt.Aquick fre whenever you want it.reversible glassreservoir..: :tut y i yesti vork and who als were not unexpected to nit-bis The Navy League is »civilian or-caged in Parvee ith co :The new heat-retaining oven cooks while the ALADDIN SECURITY OIL :2y¥therwise would go with the first ed States nor to any of the Entente ;,: ganization formed some 12 years ago Hina NGe thedistrict quota will be allies.The possibility of a —peac cook's away.Savestimeandfuel both.for bestresults—asuperiorgrade of refined kerosene. to work for a bigger and better na-e vy.Among,its members are many eee cceasary —a STANDARD OIL COMPANY retired navel SS Restricting Dependents.Premier Viviani when the British (i the active list is connected with it.,hes ,F I ne a ; ALLTEL Reviewing the question of dis-and French official missions were in Washi D.c.Chart NC Pou Pledged ant charge for dependent relatives,Gen.Wash-ngton,and 1 was agreed that Vashington,L RALTIMORE arlotte,N.C, the Stay-at Homes Crowder issued a ruling holding that ali the allies,including the United —i Mb.—72 At a going -away celebration in persons should not be discharged States,should refuse to discuss honor of the military unzis stationed phecause of dependent residents peace terms while Germany oceupied in Raleigh,Mr.James H.Pou,the abroad.‘he territories she had taken by force principal speaker,concluded as fol-“That conscientious objectors to war und therely aveid what the allied lows:are not to be excused entirely from .tatesmen conside red a German trap. “I propose to this audience that serving the country,was made clear The Pontiff’s proposal —presents we here and now take upon ourselves jin another ruling by the provost the question in a somewhat different five simple but solemn pledges.I marshal,holding that such persons light,difficult perhaps to meet,be- have personally taken each and all,should be sent to the mobilization cause it offers to a war-weary world and God being my helper I will keep camps along with others drafted to 4 hope for peace.Germany and her all,Here they are:be assigned later to non-combatant allies are expected promptly to ac-\ 1.“We pledge ourselves not to say [ranches of the service It is pre-opt the Pope's proposals.a or do anything during this war .umed they will serve in the quar-American oilicials acknowledge which will weaken the hands of the termaster’s corps,the medical corps that the Vatican’proffer is of a na-NOT FMOUGH CHILDREN | government,or which could give aid,or other units not employed in actu-ture calling for #reply.Diplomats comfort wor encouragement &the 4!combat.:f the Entente circle voice nothing ever reccive the proper balance of food | enemy.Will you plecge tals .If 80,Only in rare cases are railway t a unanimous opinion that it will te sul nily nourish beth body and | raise your hands and say ‘yes.If mail clerks to be exempted.The be rejected.Americas:oticials real-been »growing period when :.”-:+:’ you will not,answer ‘no,and bow Postoffice Department announced ize that a convincing reply is re-M4 'det s are greater than in re your heads.”No heads were bowed.that it will certify exemptions for quired for the world’s page of histo-™:u ce.‘This is shown im so many :2.“We pledge ourselves during postoffice inspectors but not for ;y.That the proposals cannot®be Mh!,loom bodies,frequent colds,| this war to do promptly and cheer-postmasters.Postmasters of the accepted as they stand is certain,“f ambition,i fully all which our government shall frst,second and third classes,how-That ‘hey will not be accepted at all)touch echitdren we say with | ask us to do,the same being in our ever,are exempted specifically under \<probable.uni tanwie carnestme st They need power.the law.+eee:ceremnwessee sott Komlsion,and need it now.It} 3.“We pledge ourselves not to Renewed emphasis is laid by the Wilkes -Alexander Roads.posses in Concentrated form the very support any candidate for office who provost marshal upon the fact that ee food clements to enrich their blood,It does not whole-heartedly support Congress framed the army draft Alexander and Wilkes county g00d chanyos weakness to strength;it makes - our country’s cause in this war.law in the interest of ™e nation,not road forces are at work or soon them sturdy and stron:.No alcohol, «4 “We pledge oursetves not to let of the individual.For that reason wil be on the road between Tay-Seott #Nowne,Bioomfleld,N,J. the family of any soldier suffer for (he lines are being drawn tight in jorsyille and Wilkesboro.the road’——~~"S ot or LAND want of anything we can supply.—the matter of exemptions.Married commissioners of bot\counties hav-RE-SALE OF LAND. 5.“We pledge ourselves to give men will only be exempi in case it ine ordered the construction ef this py virtue of an order of the Bepertor Court preference in all things,where prac-appears the family wourt vecome a road.It now seems certain that it)made in the ca [J.K.Johnson,executor | tieable,to the soldier wno went and pyhlic burden.Industrial oceupa-will be only a few months before of Tobitha Triv-Jonathan Trivett,the did his duty,over the man of mili-tions will be granted only in case it there will be a way to the south ———,Ra ae ween te tary age and fitness who did not go.ippear that the men are indispensa-from Wilkes via Vuylorsville and the hglecst biddey.at ‘he oat eeu ‘pe ia =ayarg ge?ble to an industry necessary to the Statesville.The Wederal govern-Statesville, Quaker’s Part in War.public interest or the maintenance ment appropriated $10,000 to be ap-..,,i M GOST Je,Melt who will take advan-of military establishment.plied on a highway from Taylors tae baie tithe ve ae ;ce saance a ville to the Wilkes line,and Wilkes A tract of lund siturted in)Union Groge“A,the exemption and sit down .;. a dé nothing and will not do as Want $9,000,000,000 More.county expects to receive Federal township,Iredell county,Nerth Carolina,ad- much P neon He ‘.joining the lands of Nathan Trivett and oth- or more than the one who (Congressional leaders have been aid on this road from Kilby’s Gap to {2 "'0ha bounded as follows,to-wit: bears arms in the trenches,is a informed by Secretary McAdoo that Wilkesboro.Bewinning at a red oak on T stterow's land:| ‘Quaker Slacker."”This was the jt will be necessary for them to au Meantime Wilkes is constructing 1 thenee south 37 degrees east 21 poles to ay ..- 5 1 essary ;Oe:el ta connect :a 4 waq,]stake:thenee south 47 woter to stake in| statement of Walter C.Woodward thorize at this and the winter ses-Tos to coulne,with the Iredell road Wijtcm Mullis.line:thence west with Mul-‘The Thoughtful Husband Supplies His Wife With af Richmond,Ind.,secretary of the ion of Congress an additional 39,-the Lredell-Wilkes line.iu tse 1 palen,Gia sisne in nant Malte’|. Five -Year Meeting of the Friends 090,000,000 for war expenditures to CoG,TIFT A CORN line;thence north with stephen Mullis’line Helpe in America and acting editor of The June 30,1918,including further YES!LIFT A CORN 70 polesto 8 stone:thener cnet withDhi Modern Kitehen rs., aonetpan Pret,ear the loans to the allies.Five billions in OFF WITHOUT PAIN!containing 82 1-4 acres.more ov lens “(No man wants his wife to work her fingers to the bone! lurch,§ing before the ponds already have been authorized ,.,ee Terms of sale Cash 1.Ro JOHNSON,.’;i Yearly Meeting of Friends at Guil-and a $2,000,000,000 een authorize!Cincinnati Authority Tells How W,Pte ner Avy.Commissioner,‘He wants her to have ev erything that will make her work ford eng,Se reported by the penee now in the -ipaghta to Dry Up a Corn or Cal-Pieris dndPape _easier --save her time—give her leisure—for this makes .jithin an hour after the secreta-;::;a »,eS eNotes a ae noe eee ee OSTEOPAT HL.eerie poetio herselfand her family justoittraeswes“Loyalty”and he urged tive Kitchin,chairman of the House canoe Dy S.W.He :No wife can do herself and her family justice,when ers to speak out for democ-ways and means committee,plans ou corn-pestered Men and women i ..Z ace ner |, a With no little emphasis he wane aan we te rilaite the tl need suffer no longer.Wear the shoes “ow;trotimans.she is all fagged out by neediess w ork. OOP ach ahibe Whe povermmnant bedicr A’mecting of the ways and that nearly kifed you before,says]oo oo hers’Bank Every woman who does not know the value of the ,;..;‘inel ati ity “MLISC £its c prs s es :: ere ee ais ae ee ae tes Fe tN eeseabtiod direct.|Omen "Phone,mere’Bank.||McDougall Auto-Front should visit this store without jee,its having done se made the re-hy aoe wae taking eeeoaas re ly on a tend2:,aching —or ae ‘Phone,279 Green.delay and learn how it cuts kitchen work in two. sponsibility all the greater on them cesses he ;-net,Stops soreness at once and soon the °st H lig a much *than hae fel-ings,ST eae ia a teenie com ee —st 80 ~~@ EERW INE Williams ¥urniture ouse. carries gun,and to do financial legislation.can be lifted out,root and all,with-C H ——::LT lens he would be a _,slacker.”Scns at :‘ee $3,000,000,-CUt Pain, While the Quaker Church opposes 000 and $4,000,000,000 in bonds to A small bottle of freezone cost very A D °k ees war and the attitude of the denomi-meet new allied loans,authorization little at any drug store,but will pos-real rin 9 at oun- nation is so well recognized that its of an additional $50,000,000 in taxes ‘tively take .off every hard or soft,i The vasmbers are oxeused from military to he added to the iil.before the corn oF callus,This should be tried,tains and In Bottles 5c service,it should be understood that Senate,probably will be proposed by {*it is inexpensive and is said not ’ the real Quaker recognizes a duty to the committe and agreed to by the io ore the eurrounding skin.a a me 7 the country.While he may not hear House.No delay in either eter If your druggist hasn't any free-Doors Window:Man ro he can ga service equally zation is anticipated.The bond issue ——"J Aes a og for ’8,tels, as mt as the man in the will be agree rithi ;oe 8 OOHRS GUL Noise t ‘j 2 because thepatentedflex- wollen,Kite hin eae:aa canon.It is fine stuff and acts like a charm —a vor —A bedspring thatcan'tsag of ee 000 probably will be edged to the ‘verytime.eae aor orang oe and Lifts,Hinges,|1 ite hollow strand Mission From Sapan.revenue hill in conference with the SALE OF LAND.i-Lecks and Heaps end Staples.that docsnotroll you towardthe center because it cannot sag; A new day among nations,in _—-=dr rong ag Plan is ORTH CAROLINA,IREDELL COUNTY ee thatisabsolutelynoiseless,having nothing sbout itto creakorgrosn; hich J ri "to have the remainder of the $9,000,-ee "atea Alga okder Gt the lec).%ee “hereek a ak ae —000,000 authorized at the next ses-<a.ae Seon Tae a.ce MORTGAGE SALE OF LAND.thatconforms to the shape of the body;bed have ‘een exaggerated into moun-sion of Congress,be ginning in De-the special preceeding entitied “RT Weat!Under and by virtue of the power and au-thathasno loosestevnds,open links orsharpcosuere 00 tear clothes. tains to bar our good relations,”cember Whether it will be raised (reg reed daa ot 2S tae a a es Quarter ce ve * and “march together ‘work together bY bonds or additional taxation or in |Cmmiasoner Willon St cmvenand te 3 A.astonena etka,ele and fivht together as comrades,”|What proportion of both,is unde-MONDAY,SEPTEMBER %.191°.Maiden,to Chas.C.Tharpe,on het ‘any was pledged yy «Viscount K.Ishii,cided.ou a oe.ee aca on of Tre.peso %the sum of $145.76,and ;:;dell eo ."uction to the hieh-|eeeerded in wk 44,¢:id:ambanaador extragrdinary and pen’Another Ganoline Appeal,c'iaycu,the tines oo el Remon,edd nh to .:i :‘;pote r |tract ,to lovember,1914,by J.A.; from Japan,when he =arrived in Ww ohcaheges ~oT of dras-'First Tres —L vine ontbein in Fatctown |Basle Maiden.to lisbeth Se ot 'Veduie ‘‘c tie acetic ry othe Po,‘ern.|township «aforesaid State and «ty wee,&.C.,the »fi ee.oe mission,Vis-ig te as Uwe ees on \if aces lee,oe ae seme ae -corded,in vk to oe ie “ae,“ich aa count Ishii spoke for b.s government of automobiles during the war,in or-thence north 18 degrees east 182 poles to «|Guwyn to Caria C Tmspn ond ‘Secon new-| at a dinner tendered hem wy the mu-der that the gasoline needs of the ——=line ;—=aid old line fina =made in the payment of the note ro 2 ;.United States ;:a north 7 rees west 31 poles to toke or )ted interest thereen,secu id nicipalty,at the port at wich h nited States and its allies may be pine knot,corner of lot No.6:thenes south seme@m,the undveclgaed a wy a = len In conclusion he said:met,is given in a seatement issued|js degrees west 182 house door‘.,|2 poles to a pine bn vy |to the Highest bidder,at “We are here to say that in this by Director Van H.Hanning of the|stake in Kestler's line;thence paiaay .|in Statesville,x.C.at 2 w'stouk m.,on | tremendous struggle gor those rights bureau of mines,in wmren he asks|Frew cast it care)oe ee merreuine convene:t auntcoe SS ea *_ and liberties,America and Jepan are the co-operation of automobile own-on an ts ae Getue ot aon teins :hee qrocl :Beinn to teete Tale omen|bound together:that when the vieto.fs —in stopping —the _practice.|lands.mi’{°°Weedelt county,and described and defined at of the allied forces is secure,Enough —te care fey Ge vo t “1 we "then oid Sees oa tows |of oe inten aeaand|‘+quirements of America emma of the atergnnis Mate and county,my place,adjoining the Jimapanshouldselivebweisa,ike om a =S|adjoining the first tract above described,and,land on the south,Chas.C.Tharpe on the that your sons and our sons will have :ta a will be saved,in lhevinning at a small dogwood or pine knot,|west and partly by Chas.C.The on the a certainty of good neighborhood;Opinion of the officiais,“tf automo.|corner of lot No.4,and vunning north 1s de.|Cawt,containing 8 heres more or isolivethatnowordordeedofwith:bile owner of the country will stop|fre ie Mait"tr grass tie!"yitt |delleoupty.sind decried nddeine,fr er be _,absolutely extrava ge |See agg Faery sts cen oe SS eribed and &ae Nakedape aa ee nee ener (es,erate Sa Ne ee|ig er de Spee A ;wossip,i it ’thia fuel i N-|south 18 degwrees weet 182 poles to a etal or end of our place,adjoining Cc.sat ae slander,sinieter intrigue and infiv-‘le is fuel in a careful and eco-|pine knot in Kestler’s line;thence south 77)on the east and Charles C.=:- enée,of which we have both been the nomical manner to prevent excess-|deerees eat 90 poles to the bewinning,con.|orth and west,and our own land on the ‘.taint a5 or less,ane wecantfutareonyservetoMeyprcentofll”Se ar atid Se|gama o TaageR ence GERSOL DOLLAR WATC Mortragee.ws closer together &mutual aste of words,The only way|Josey lands.‘H and for the common we).they'll stop pleasure riding will ind wing and being in Pallstown :Rre,arprice $1.35.See meif are in need‘or }y p will be|Third Tract.1 c THA A of ofa W i you In stock,';Wi Elgin,ork oe =ic<z |to sto the sale of gasol .They township of the aforesaid Btate and county, A can’t oven make the ol peakhe.hy EON,EE.tine, persons were killed and 150 "Y-qq demu wen 10 pales too Wakeanthecit in wreck on the railroad and ta 1 oe Daeons Oe ord Hine 15 1-2 poles Moscow.to ond Gf aieere and eomenl wlaue W aie ©@ cuba.o te Pott tntro=os to pieces cuedbydinorders st he tne aad rer thence with said line 16 1-2 poles to the be:ean into 8 Kin"taakee"tine thes teak Peo en]ss kf WEAN H.OODWARD Jeweler. Sue.3,1017-4 w.mmiasioner. 4 Don’t forget that we have For a bag of Davis Bros, Graham Flour,fresh lot right from the mill: anything you want in the way of Spices,Vinegar, Extracts,Rubbers,Jars and Jar caps. Phone 89. Eagle&Milholland. FINE LOT COUNTRY MEAT. Miler-McLainSupply(o. mpeee lene “High ‘School. A Farm Life School For Girls and Boys. —SPECIAL COURSES IN— A ‘Home Economics,riculture and the Manual Arts. Prepares for College and Universi- ty entrance. Fall term opens TUESDAY, tember 11,1917.Engage now at Dormitories. For iustrated announcement write || R.H.LANKFORD,Principal,| Harmony,N.C.. Builders Hardware,ing Material, mber,Paint. “phone No.48. Sep- board further information and new | to Cc.W ATKINS, -WANTED! SCRAP BRASS—Heavy Brass74c.ei —Ligh,Brass 5c.per "FOR SALE: New 2nd second hand machineryfersaleandallkindsofboilerroomsupplies. Cc.H.TURNER.Tredell "Phone No,74,Bell No.7. _———a Battery Trouble Righted.[t If you have Battery trouble,bring us your Car.e’ll locatethetrouble.All work done byanexpert! ee MOTOR CO.. NO ICE -Have left m meate ‘at Stim-son’s Drug Store.Those itomecanseeastatementofaccountorrakesettlement there.Coite L.Sherrill,M.D.|,——- Made -C,WATKINS will fit the Doorsand Windowshe sells,He sella’ them because HE KEEPS. A SUPPL “STOCK -SIZES"! He makes these during epare time, z= Ay Crepe De Chine and “uae Georgette Crepe. Shirt Waists %, Flesh and White, Newest Fall Models. Some Embroidered, some Beaded and others Lace Trimmed. In the lot there are fifteen styles to selectormore from. Sizes 36 to 44. Priced,$3.50,$4.00,$5.00 and $6.00. |MORRISONCO. | whether the excuse is genuine.If it home,is not only most —*rb Ed.6.White Motor ipa ‘is not the local board,it is presumed,-<fairly sure to return in better Ss ey »cun reconsider:or the county atter rhysieal condition then wren he left tatesyv ille,N.C. ney can appeal cases of exempted !/)!course during the one or mor persons tu the district board;or the d&eys e@ month that tious his turn to‘district hoard,which sits in’State:harge he is subject to greai danger. ville,ean reopen all cases exempted t the rest of the time,with rens-ate vehylocalboardsifitfindsthereiso7ableprecautions,he is,statistical TRAPanyreasonfordoingso.Really it |Y-almost as well off aus in.the has (ts will he the fault of those who know “trects of New York.sree—the facts but refuse to tell them,if ..'persons are exempted who nave no 'onadians Get Into Lens—-In \eenenneenaitihenenijionliiiejustclaims.the War Zone.\9 aeeeallForWonien!:apply to persons who have just 6"{een a,front.‘Tho Cena |vielelaimsforexemption.If one feel ae have tnken Hill 70 demir atin M4thathehasajustclaimitisproper;tee feo ak 'Eee :ns Saiki a | for him to present the facts.:;.he un ota :.:—oo city itself,engaging the Germ |The President of Mitchel!College has issued“a’call.“Worried About theDog Tax.desperate fichting at close quer 4 ..:ee ae crs,after advancing on a bvo-mil for seventy-five Boarding and one hundred Diy This announced purpose of Con-‘rent to an extreme depth of ene mile “1 :a greseman Doughton to introduce -9,|Fer several weeks the Canadians |pupils.ealbillinCongressfixingawartaxof*:0%4)=been crosing Une sie ‘ $5 Nae dogs,fills ie with much a =cr es ne aun a ltt Eairnest,ambitious yo.ing women from the age ofprenlensionandsupportedthat:*GHW Teperattor fora supre riemanforCongress!Now,if added te fort to plare this center of the |twelve to twenty will!bein the first call.eeding and the genera tips a ele ©ime Pas Gels mine +a Thmyslow,I have to pay ce latest exe{Bossension.Hil 70,just east of Lam The enlistment will take place at the Office of the...action,must say e line between and north of Lens,wa !4 1autocracyinddemocracylooksex-,atambling.block.Early Wetnesd:College Wednesday,September 5th.Thesacrificeceedinglydimtome.Raised in the,the Canadia the hill,Phe ::thing 2 .6 tswheelisknelawsAre“Feactlehis pier’wae ucts and within a (will cost something but it will be worth the price*”ry.”I desire to say that I think this‘hours ti Vportant Pp '.'eincubusof85,which at this writing/|cleared of Germa The Ca and more.anwillpurchasetwobushelsofcorn,swept on toward |frem the : should be placed onlv on those whe,west.cant ral rt .Sw ..:.-¢vie oelhaoeaetaen,Siegel Can Superior Officers will be in charge of the training. Don't,TI say,rudely disrupt the The Geormiaos ke rately tell ;;ado a t i a strong ties of friendship,and oMni@heek the Cu .hut ft t The advantages will be great for the development ‘2 the dog’s part affection existin®eounter-nttac Ait Whil f —phar w ‘sal Ps ‘:aeeeeeOreeeatenaeonsofaricherwomanhood.Failure to enlist will aoe friend,for this cruel legislatior S|selves,(feted |q repr oach ” sure to result in our once beautifil:degses on the Gorma !post :t valleys and hillsides being strewn almost 200 pr .breswithextinctdogs,This bill,in my In Flande:urtittery |Bear in mind the date of enrollment,September...opinion,will not only be in dircet)fighting niia hee |oa contravention to that sacred hul-vigor.Fight t Mold 5 and the place..wark,“restraint of trade,”but will vin apparen inte |‘:\adeforeverdestroyallhopesThave¢o-sity.Th hae |™tertained of being able to give my the best of itt rt |“<|>|j x ]1 "dog away.”Feelinily,your's Sang |Mitche College .f —-The *suble Waker.ot j Social Evenings at the Club..The Trot ‘re ee reee cer as.‘Expressing —!weThesocialsessionattheConn:cial club Tuesday evening the omnes pe)’first of a series proposed for t <r male ond Tuesday evening of each n hy Root,Renu )was not rgely attended,mission to f broke the ies,so to speak.TI im New Yi :cussion was informal.It i hoped Ception to the vt th that club members will get the ha part playe |it of attending the meetings The tts time of ond social contact is worth while and out)ime to the 1 wow of these informal gatherings rm!socialists wed of community benefit whi grow Cn the German " such eecasion=subjeer of comn BUSC ty betterment ean be informal!s Col,Theodes R cussed and suggestions made thit spoke at the met i will bear fruit.Keep the social hall and the at thesionsinmindandbeevertomeree,bkowis: the next one izations |ett \\ a oe ly aiding GormaGERMANSTOHOTSPRINGSCountryA ; Two passnyrer cars,filled v these of th ‘7 i .e rternedGermans,were attached |hung traitor ]>©¢»4 1S Wednesday morning Thes “until th Uit |his a.a n A ge of Re :iprocity: en reute to the German int 5.000.000 mer —at Hot dag A eer pa will cap no right If we heed yvour interest when you come to us.said to number 105 and thi as standiny |:.:.oon ok %..osinehanesofCeomanebeltfordcrwebelieveyou‘will heed ours by continuing: Springs to about 700,the putting Ar yor *patronage at th shop.me mass on whichJUNIUSTURNERDEADak Mr.Junius Turner,former «;So ft is on this princiole that we of Alexander county,died i in Jail For Melon Siealing—23 \..;bury a few days ago and war hu Local Court Cases ss.Td to win or it your trade.7 in Hickory Wednesday.Son «Bn the \re Ellis Turner.Father,wife ar “i oe :ib ::e .children survive —taxed “If this logic is .iin your case,come ; ‘ere yr automo n :‘IN STATE PRISON Bahannon,colores.in and we will save you money 'a)undred and forty -sev veing drur k and and mak vou glad lered anti -draft aitators fr aif the fine wi t fh :.—rious sections of Oklahoma ar aa ae Alex :::in the State prison at McAll wm the cont :,;ery ey,await the action of the =Fi Wi a whipp (Ke 1 ele)vem,Petra t|MoTroR eSaerrr‘"ny.rand jury.__o &Gaitm ;.ried T ,ry Victor Werdeck.¢former Repreeer Justice Sloan Wed ine {’{2 rn tative from Kanaas and Progr:mitted to jail in de gyi ae m ,|j leader,has been nominated by P carrying =conce r \,' ident Wilson to AN the vacanc:Dalton,colored,we nil SensetheFederalTradeCommissioncafaultof850hondfe(ed hy the death of Will Parry.|Watermelon.|—en WUILDING? .WATKINS NG?—sC.WATKINS. emption Boarcs A eitizén of the county —4 farm-er —was expressing dina thewedayoverthe‘thatcaeslackers,aexemption,will getencboards.One case’he cited as anyoungmanis ioolonthegrow hisgrandparentsaredependen’whereas,it was asserted,‘en.|berhood knows that he does not sup-iport his grandparents. There wil!be cases of that sort of‘course;and the worst of it is some of Can ithem will go before exboardsbackedbyaffidavitspeoplewhoshouldknowthe fact|but who will not have the cou terefusetohelpthe|slackers.erthesesamefolkswillblametheexjemptionboardsifthecasesgetby.|It is not only the privilege but th:jduty of the neighbors to report suchcases.Reporting someting thatmaymeantroubleforsomebodyisn’‘pleasant.It is distinctly wu 8 jant and objectionable to most Ik.But there are times when the indi vidual fails in his duty as a eitizen ‘if he does not make the fuets knownInthiscaseitmustberememberedjthatifonegetsbywhoisn’t entitle: lto exemption another gets into ‘trouble.for another must take his|place,The dodger,therefore,is en titled to no consideration,for he notonlyshirkshisdutybutheimpose/it on another.TheLandmark is printing in each ixsue the names of these exemp! ‘ed by the Iredell board and the Peasonsfortheexemption.The neigh hors of cach one exempted will know whadanger -—warwnongthemenwhowillrepeinthearmywillnotitheopinionoforganization,_— statement ononthemost‘obtainable as since #he-war began.being drafted,says this}authority,stand =,one four of seemisitey aeaintconditionsare dificult toireer1,000 are being k ind about 150 x wounded, iter return te mal death ratemenwithintheliersnowfighting is only eight per, 00,but that he period of is for aTheloss aacs vhich has been one of -takers of lared to be in It is brought outtothemostreliabfe statistics,whic Alse | i zeissuedthesable,baad wymortalityThemennow 8 to heir favor and, obtain,about 60 men men per 1,000 are be- Most,of the wounded the front.The nor in ce times ofagelimitsofthesol-! is a yearly rate,whilefigureof60per1,000 covers theenlistmentandinsomeriodofthreeyears. life from disease the deadly other wars,is de large measure elim: ated, lhe mortality is said to be less to than it was at the start of the var, dled, ire exposed to charge is mac Gas attacks and with reasonable s men are not in very grea: from that form of attack. are being well precau- ian Mhey the most danger wher le.At cther times wounds are mostly the reated. quent, iy serious, Skull ho fliets. “Different bra different heavy }Wwjinthe shoulders or arms artillery and ensil, wounds are rather wever,and are natural But the mbs is less than in amputation of previous nehes of the service degrees of mortality the danger | corn ‘id to be about equal to the danger f railroading in civil life. among ¢ ers,including The mor ertain classes of offi- lieutenants,sergeant id corporals,is found to have been enter tical organize than among privates. beli ove,”says Babson'’s Sta ation,“that the draft d man who goes «7 an ordinary oldier,taking his jucgment with him and leaving his)enthusiasm at | an ee aoe || INed in the war! L The Maxwell is mechanically right. A All the world knows thet today. Why? A Maxwell stock car went 22,022 miles without stopping the motor —~1092 Maxwells in our May gasoline economy contest averaged 27.15 miics on one gallon each. 2040 Maxwells in our June contest averaged 29.04 miles on one gallon cach, If the standardized,one model Max- well were not mechanically right achievements would have been sible. Isn't that the kind of efficiency—the kind of economy—you want in YOUR car? SS SS S SS S these ixapos- age Touring Car $745 Roadater $746;Bertine $1098 Sedan £1095.All prices f.o 6.Detroit PS S SE E S EE S FS E T ELT. President Wil- i a place in.rs oe retar te aneloosevellforSecretaryofoftheNavyare ’The sug- %met some a val, by the admirers r Col, Democrats and Republi- cans,seem to think the country will never cet on without the cole- nel’s services,although it has man- aged te do fairly well without him for more than eight years. Col..Roosevelt's courage,sincerity and ability are not auestioned.but it seems to The Landmark that 4 moment's reflection should convince thinking people that he is not the man for Wilson's cabinet.His tem- perament and disposition,his colos sal egotiem,would not permit him te serve in a suberdinate position He would have to be the whole show or he would balk,and of course he cowldn't ran Mr Wilson's adminis tration.Et will be remembered that he selected his own c ‘wi he retired from the then beat his owt: election beeause he to please him.To The sooms abeure,to think f that Roosevelt could abinet offleet the iatration.He has xouneed the administr and the ~exident,his criticisne or the latter lesegndine to personal abuse Hard- Anything dore has pleased him.If Wilson’should overle ali this ind invite Col,Roosevelt into his ibinet,the colonel wou Uine the nyitation to mean that tis Temp Was Wetrary to run the wernment and the war and he would proceed to try &take charyve.H alle ' to do that ,then he would quit raise a row and the lasi be worse than the first no idea Mr.Wilson will Roosevelt his en remarks to thinking people should that Roosevelt is impossible Wiison cabinet officer. The idea that Mr.Wilso:hould take Republicans into pr<cabinet that during the war partisan polities thould be obliterated and all should Shand cLogethe:That te:so,it urged.it would be wise and proper to Wat Republicans into the cabinet Politic.should not figure during the rar,but unfortunately the Repubh @inrs do not negtect to try to make political capital However The Landmark offers no objection to the Coalition cabinet if the President fees fit to call Republicans to his enuncil beard.The pian nas advan tages,and Republicsns like Mr.Taft fpr instance,in whose honesty and incerity te country has confidence, who are patriots firct partis ”yl.it Tete ge"orally leamod by elt mast remembesed,however, that “Republicans have been called inte many positions of honor and triet in conn with the war,and sjimply because they may not be call- ed into the cabinet does not)mean that the war is being prosecuted a partisan affair.Of it not.Then,too,the Democrats as muty,will have to Dear responsibil ity for the conduct of the war,no matter how many Republicans are weet cn.office Furthermore,it is nat reeatled that President =MeKinley, daring the Spanish -american war, offered Democrats a p.nee in his cab- ipet or thet Democrats sugested Re he should.Otherwise Mr.Me- Kinley recognized Democrats just as My.Wilson has recoga:zed Republi- ean:durire this waree we uw presideney election for hid 't do th Landmark it roa moment ax of vdimin continually de- re- ws ee on Wils i atton ‘Mr rb ‘ would and would have Col The se awhiut rnive StH E We Hen inte He mre point out as a is &e 18 ed.be Hiogeracral ~wnrd,w “ he lior as cours is While are |in the drafted fer arm pas order in W t hin rton orde will pot observed ino sending then camp.They nb increments of Bo rer cent.September 5,30 Rentember 15 her 30,the remainin Whlater.Loral My consider tea |meni ¢' he passed over gorerd of Be all men s nt = met ng eon by which dul ic voards were it jrawn eom thet trie thy vo ner cent. }oper cent.Septem- peer uithorizedhoare pad mere? wo n th hee who tn} the: a home mee {' }te thet de and Ain ule ance folk wet to a thir oa r ib folklearr sever! me with rar must nter itd ce and afl that ous ith and wv muet bear i of our hit}eee The war exemptior narrowed wrth w - privileges are each announcement mse havir war,who fant en t!Ww 'iTAINst are exempted as a clasnuttoworkintbranchofthe Dependents must be real dependents and the oecupationalexemptionsaremuchre »are mi in eme wor service ‘ne |Better be careful abou ‘feed.Herbert Hoover wil-you don't watch out aae »Be Huyhes,late presidential te,is chairman ot the district exemption boar!in New York «ty. *attendance 17,1917.| .flour by the while not in.itself,will tend to encourage these who do not want io obey the law te refuse to comply with it,without awaiting the action of Congress or of the Supreme Court.Under ordinary =cirewn- tances,the action of the Catawbians mivht not be serious.In time of war eny act which encourages resistance to or obstructs the mimtary laws,is a very serious offence Moreover,The Landmark is satis- tied that those people who are send- ine money to Watsen are iWrowine their money away.He qeunttess pur- vores to do exactly weat he says, t a suit to test the law has al- eady been brought in tne West and will he before the Supreme Court at he fall term.It will he locided promptly m want the law tested in the r wait for that. and protesting against the draft act, iNeval loubtless e who courts had bet- to indicate proposal will While there is nothiny the Pope *s peac any effect)at present or hould have in sopping the war ery peace proposition brings come encouragement.It indicates that peace is being constdercd somewhere ind by and by it come in such form that we can all accept it. SS Ale promised and Jordan oath will nearly ° News And Pref.Horace Williams,evi- dently having friends at court,gets Ly without even a slap on the wrist. - hat have ‘ ty he takes he pretty Greensboro ander has when Prof the thing Unanimous, Tr vood the Belgium's Financial Loss. German occupation of Belgium thus far has cost in money wrungfromtheimpoverishedinthewayof so-called “war contributions”—and destruction more than $1,600,000,000 according to a compilation made by the American Committee of |Engin- eers in London In addition,the Belgian vovern- ment and the charitable world have contributed upwards of $250,000,000 to feed the Belgian population dur ing the three years of the war,“a charge,”the committee asserts, “which rightly should have fallen up on the invader.” The indirect to the German oecupation, toppage of industry and -annet be measured in committee add While exist for the systen nery from faetitefF awed Belyinm by through commerce, .the fierires of loss mone ne tie lootir the co of all payment 'aetet om oO frequently avainst ri or little value,and the wholesale destructim of —ferests, they certainly bring the total dam- ave to well over $2,000,000,000,"de- clares the committee.Thi property loss takes no account of the more terri- ble toll of human life,the outraving of women and the slaughter of chil iren ati kinds of none only Itis Medical Men to Meet. North Caroli received or applied for a commission in the Medical Re Corps,and ait other medica! men in the State who have the inter-est of the profession at heart during this trying time,are invited and hould be present,”declares Dr. Charles O'H. Laug®Wingsouse of Greenville,in a letter ro all the coun cilors of the Medieal Soctety of the North Carotina,urging their upon the North Carolina itary sacietie and the Stat National erence,Medi Greensboro Monday. According th the received by Dr.J.\ Gree Dy.Joseph of the South o itional Defenes BE.Noblecof the Wart are scheduled to spen’ lor The meeting will 'principal subject the i of the Medical Reserve Cory noard the perfee ion of pla “Every physician in na who has State of tue committee, cal Seet Nutust muonitent mm,an 2)com. on shore,Long of chairmancatBloodirroe12 ern committeeMR riment, wo Mus iad y f uty -ted For Sedition. Bb Wolf !' \rre i at Ral preact th ry aay a“ too charged ~a farmer of the of Mianty county thi wevk, of the recent act of }by making threats against President and government offi rdingg the draft law He released on $2,000 bond for a aring Aupust 24 Floyd Simpkins,son of Elder W.A Simpkins of the Primitive Baptist denomination,is under $500 bond in Raleigh to answer a charge of sedi tious talk.The testimony against him was that he rebelled at the draft ind said he hoped the first man he had a chance to shoot would be Pres- ident Wilson, Exemption Board Indicted. The Federal York h:ret charged Violatiot n grand jury in New :ned indictments againat Vr,Samuel J.Bernfield and Louie L Cher river be of local exemption hoard in New York city,who were re- cently removed,charging that bribery nfluenced them in deciding the claims of applicants for exemption in the na- tional army and conspiracy to violate the draft law.Abraham Gruher,a dentist,not a member of the board, but allewed to have acted for the twoindictedmembersinthefurtheranceoftheallevedconspiracy,was aleo indicted. to be taken to reducebread.Millers ab to put themselves w regulations and are with *_—‘ ferential o .Pevholeaslers of bread will beThehopeofthefoodtoestablisha baking next. tration ispricesfrom the farm to a store,elimmating undueondingspeculation, In announcing formation ef |the wheat corporation,the food adminis. tration also has made the personnel of committee whieh will fix a price to be paid for thiswheatyield,and the names teen men who will act as pu wrenis for the corporation at nals.The wheat corporation will be put under the administration's e fivision.Its chairman will be . hert Heover and its president Julian Barnes,a Duluth (Minn.)exporter, now serving as a voluntar in the food administration. fixing committee will be headed President Garfield of Williams loge,and will comprise twelve mem- bers,representing producers and onsumers,The wheat corporation will handle all allied grain purchases and will do the buying for the American gov- onment.The allies will be required to purchase flour instead of wheat on the theory that manufocturing costswillhereducedandAmericanindus- ry encouraged. All of the erain men who are tak- en into the food administration'swraindivisionswithdisassociate themselves from business —interests and give their entire time to the gov- ernment without remuneration. Authority (o license grain eleva- tors and milling concerns was given formally to the food administration in a proclamation by President Wil- Mr.Hoover hopes that opera- tion of the licensing eysterh will make unnecessary any extensive government purchases for the allies. He hetieves a stable export price and proper supervision of exchange deal- ings will de more than anything else to keep prices on a constant level. More than 100 representatives of boards of exchanges and elevator vatems came to Washington for a with officiats on the gov- ernment’s plans At the end of an all-dey meeting they issued a state- ment approving the food administra- ions)propesals. son, conference eo ESEeSe American Troops in Loadon, American troops marched through London Wednesday They were re- iewed by Ambassader Pave and lat-or by King George at Buckingham Great crowd lined —the which were decorated th Ameren Brit- Enthusiasm hown AX meewng the Brit- ish cabinet was in progress when the Ameri approach:!Whitehall,It was adjourned to permit the prem and hes ues pay their com- nliment Americans.The cv net wen body to the war palace the tre nndIelyow No bags Was eve herve ot ins colli ag to to the t{inia t rreatest crowd =gathered in of Buel thaw palace The accompanied by the queen,the staff and officers,took h acc at the gate.The America then filed past,eyes left,officer alute,while the bands played the cheering?and waving of A first “Star and =Strip: with the ranks the king his party raised their hands lute The flag was dipped ‘rowd roardl approval so that the king was forced to smil No mention has been mace i landing of American troop ish ports,but ittrooperesent to Fratice land Ce.The front ' aichold Une in sen aneVigorviggaro is supposed vw Ee ee ‘ilience Sound on War. The \ which ” State Farmers’ still in existences this week,adopted the resolution: “The State Farmers’ annual session at desives for itself and tt to be placed on recordnepeople,believing of the Alliance:‘Ponce nd good will toward men’ hour of our national to go or ra al te our peaple and oot.Therefore,be ito resol harsa,That we pledge t |upport to tie Pre the United States in the proce of the wer in which we are enywace intil hostilities have ceased honerable peace has been made dienting:our entrance inte the “Second.That we urge o in connection with our allie.t) nouncement be made of wi he regarded as uffierer on Germany's part to ration of terms of pre. T.B.Parker was elected tent It wae decided to sell th lianee headouarters property, ings and 146 acres of Hill here, cetiog lowing Ath er ment th il<o ree i ed lova tent owe it ' N ror ;f\ju vrour Biggest Potato Crop. The largest potato crop ¢ duced in this country is the promise of the monthly crop report just is- sued,Leon M.Estabroo!hief aff the bureau of crop estimates of the United States Departmest of ; culture,states that the avera duction for the pres «lon 1915)was 363,000,000 bust eis,which represents a This year the indications there will be a crop of 167 bushels,which is 100,00 the average. This is equal to one bushel extra for every man,woman and child iqthecountry. eeaee Former President Taft,i!l for ten days at Clay Center,Kans,has ren |covered and gone to his commer home at Murray Bay,Canada mn ive fair op. that (My above of a war submarine,aecording toreaching. 'WINSTON-SALEM ropreve| (000)OM | avainst the governmen in the Federal court at Va.The German Peoutschiand,which twice i United States,has been converted into man fleet gossip the “Associ- ated Press. Carivle,Mass...boasts a 100 per:draft record,dust one mandrawninthetown,He physies!examination and waiv-exemption,Ef he had failed itidhavebeen100percent,fail- Untess five apecifie demands aretedbyAugust20,the laduatrielWorkersoftheWorldwillcalla ul strike in Washington,Ore-Idaho and Montana,accordingastatementbyanvfflelalofthe 1 ranization, Sixty -eight indietments10>persons,the charges includingmurder,arson,consetrecy,riotingodassaulttomurder,have been re-tucned by the grand jury at Belle-ville,O.,whieh has been investigat- ny the race riots in Bast St.Louis duly 1-8.Washington men and the woman's cent wa ainst of about women bombarded pariy seadquartershorgsonddestroyedseveralnersaddeessedte“Kaiser Wil- ‘after similar banness nad been»away from women who at-tempied to parade them in.front of the White House. Former Emperor Nicholas of Ru:sia and his family have been transferre:! from the palace at Tearskoe-Selo t& another point.They were removed im an ordinary train.The former empe or appeared to be very much dep: ed.Former Empress Atexandra seo d to be pleased at the prgapect o®8a chan The change was made for politeal and military reasons, It first t in France iewed this Ly Major General William LL. the American commander.Thi ‘first time that the troops it >had been ati together.The wa.a splendid military dis- ind Gen.Sibert eatd he was tm ely prond of the mer ‘Trench pee welt ¥e a crowd Tate " re contingent of American were re ent y much ree ae eee Ser:eeeee omplaint. ate Summer ¢'te Pipeth)heeterbetrout ot oth howe! phen Che neds 'Seett,Scott tised =Chambe:! gt erty moch time To hadaand Vie ere “ od tee emotabnt {'re woe LADY PRAISESTRONIZEDPAW-PAW Could Not Eat or Steep With Any Comfort---Would WakeUpatNightWithShort- ness of Breath. HAS GAINED te t-t bb WEEKS. Mrs.Claud 8S.1+ 1514 Centreville Salem,cays: “Why,Fo didn't kKrow what a good night's sleen was for the post year er two until TP began uv Ironized Paw -Paw.I helieve had the worst case indigestion and slcep- lessness on record,with nervous headaches.had no ambition to do anything.beyan taking Tronized Paw Paw and within two week.,to my great surprise,Done /morn ing to realize that Phad slept the er- tire nivht throuvh without awake ing ance I have gamed lo |- pounds in three weck en and sleep as well av J “My ner:headanches spells are now past.diy retains all solids without any dis- comfort whatever.Lo am convincedthatIronizedPaw-Paw is the peer of all other tonics and Tam delight ed to be able to say so,” A system that overworked run-down requires harmless ulant.ALCOHOL ~~LIFTS BUT LETS YOU FALL!Irenized law- Paw lifts and holds you!Your crup- gist probably keeps it,but if he does not,it is sold in Statesville by the Potk G Drug Co fronized Paw Paw,pric:1.bor mutha ery bottle.Math order promptly attended —to Interstate Drug Co Inc.,New York. ng I of *Of 4 and en t ever dul and diany comach 5 or1s a on ¢ DR.VANCE HASTY, DENTAL SI'RUBON, Rooms 6-1-9,Second Floor. FIRST NATIONAL,BANK BUILDING,Statesville,N.C.TELEPHONE BNGAGEMENTS,"Phone 197 Hours &to 6SYBCIALATTENTIONTOREN'STEETH. i CHEER WINE ———‘In Bottles and at Foun | }} We are thoroughlytorechargeBatteries ainstockafulllineofBatteryac- cessories. Fe eeeee oe Fsetaceteiieiaseinanpiiiieaniidiietiaiiicinaaae ae NOW YOU CAN WHISTLE.| We are bottling the genuine Whis-tle in pure sterilized water avd it isonsalebyalldealerswhosellhighclassbottleddrinks.Se.buys a bottle of **Whistle,”whieh makes you whistle everytiraeyouaredry,The fruit saltsoftheorangeandpuresterilizedwateraremostwelcometoyoursystem.The Whistle bottling pro-cess makes a “Dry”drink.Menandwomenwhodon’t like carbona-ted drinks find ‘‘Whistle”delight-ful because ‘*Dry.”NOTTLED “DRY”BY The COCA COLA Bottling Co. CLEANLINESS is a much abused word.Look US over. stim CRORERTOOOO00 OBOOUOQIOOGIOOH?SFL OOOH Sb5O. G.00). ie S507 Crawferd-Bunch furniture Company. ‘The Store That Alwars Welcomes You.” PHON!re)4 *;Aue i}«>BE m4 a TERRE IOC YT,SEE.Ae CROREOCH.HOH OOH MO COD PD OO OH 0 OO CRD .I,;A Reguilar Picnic Por you if you carry cng of our new Thermos Bottles on your outin:: We have lary your beveraye refreshing when carried in these magic | Keep hot or cold indefinitely.indispensible to automobilists. We'll be vlad to show them to you. POLK GRAY DRUG CO.“On the Square. fa 0Y¥\v he e nilland medium,You can serve just the civht temperature,pure and yottles. 4 en eS ee Re RN ee nee Don’t You Want Some Pyetty Pins and (ther Necessary Jewelry? I welty you wid wroul. ivr of the randsome lad ime G' wi) i R.F.HENRY,Jeweler. aceere Jewe LEST WE FORGET. Now is a good time to select that Monument for the loved ones who have gone.We carry a larger varied assortment of both Granite and Marble in Monuments,Tombstones and Markers to select from. Prices reasonable. Barron &Conner. Phone 215.118 E,Broad Street. .sane,which wax enjoyed by ell beenSmithwShore. “Zelda Cathalone HowSharpeandMrs.and Laxenby entertained the Whyafternoon,CGyeats outclubwereMrs,Wm.White of Duke.land of Goldsboro,Miss lachue!Goldsboro,Mrs.Cariton AndrewsBOF.OLeng.ridge was played andputs. Tuesday evening Miss Mary Stearn enter-number of her friends with her houseCatherineBurkhendofCharlotte.Hearts dice war played at h Rowles was hostess to thecubWvedaynichtinofherguest,Miss Wilkins of Goldsboro,Ten couples were present.DifferentwereplayedduringtheeveningPunchandicecreamwereserved. Master Barnett Adams gave a party to »of his friends Wednesday evningEvelynWilkinsofGoldsborowasguertofhonor.There were games and refresh-ments were served. Mrs.B.F.Long entertained at bridwe yesterdayafternconinhenerofherdaughter. Mrs.BM,Land of Goldebors (Mise Resamond Clark,who iy now regularlywithTheLandmark,will give special at tention to seeinl items,Those who have item H ff this chareeter or news of any kind wilconferafavorbycallingNo.14 The Landmark,Any one who answers the phone wi he glad te teke #news item of any character.’ Family Reunion —Meeting —.Dinner For Convicts.Gerresponacnee of The Landmars Harmony,Ave.tt The retewillbeginatNewHopechurchthe day in Auris The people of this community are wong t give the comviets a good dinner fhext Saturday are encamped near Kennedy's bridy el meeting eurth Sun Cpreme ane os,Cotton Mil B havereturned | ipare| and .4.B.Glover.:Mre.M.P.Watts hue gone to Pineville towendaweekwithMrs.J.BR.Dmvis.iMissAlenaHunterhasreturnedtoDerita after visiting Misa Rache!Coadwin for a week.Mines Mary Sharpe ana Catherine Morrt-son uve at Blowing Rock for a few days.Mrs.&D.McPherson of Durham will are,rive today to be the gucet of Mys.Roxy Moe-Elwee.Mies Rachael Borden of Goidaboro isvithMre,MeRiweeMr.J.Poul Leonards secretary of the StateMerchants’Association,is in Charlotte in the!interest of the ‘Trade Magazine,the assoctation publieetion.Mixses Grace and !oa Anderson returnedWednesdaynightfromChautauqua,N.Y. They have been studying at the ChautauquaSummerSehool. 1 j Mies Helen Bailey of Woeodleaf,Rowancounty,is in tewn attending the teachers’institute.Miss Bailey ic visiting Miss Merga-|cot Deal,Mrs,T.4.Allison and Mrs,P.A.BryantbavereturnedfromanwutomobiletriptoAshesilleMr.Raymond Allison,who se- “omonanied them to Asheviile,went on to De-trot,and Mr.P.A.Bryant went to Achoville|Tuesacy evening and accompanied them homeWedn.oday 4 Mrs.A,W.Bunch,Master James Boneh,Mr,and Me.H motored tovilleforashortstaythinweekMrs.Ora Mitchell bes gone to Johnson CityTenn.,to visit friendsMr.and Mrs.Grier Waugh are spending a few days in Charlotte Anhe Mrs.M.K.Denton of Ronnoke,Va.,pessedthroughStatesvillethisweekonherwayto Tharlotte,Mrs.Denton formerly lived in Stuterville Miss Mamie Adams has gone te Henderson.tiie to visit Mro 4.8.Browse,Mins Adame brother,Mr W.G.Adame,wil join her thereMissAlticCorpeningaodMissTheoTerrilllefttheweekferastayotBhaeRidge. Mixes Glonn Macon ba spending her vneation it Trey and Tisorniasn villeMes.Eo BE.Arey and daughter,Miss AllieMuoArey,bave returned to Barium after atayatMontreat Mesars.Bdwar Holmes,Money Raid Grose,Wisses Therma Renegar Joyner made a visi to Charlotte returning Sunday wid Mave most enjoyable event tomk place wt th homme of Mra.Rettie Renewer Sunrtay 4 fam ily reunion dinner About bl o'clock the velatives,friends and neighbors began to ars Seen «a long table was constructed and about 12.20 the good hudies bewan te spread the tracmetdeliciousfoodthatbendscanprepareAt}e'elock all the people were catled around thetablebyMrH.Renewar,whe meade 2 very interesting tath,after which we were al!invited to partake and we all embraced Un oppertunity.There are 21 children,10001wiwerepresent.Those living eut of th: community are Mrs.Will Cook of Virginia and Mrs.Grover Joyner of Winston-SalemMr.Fdgar Renegar whe lives in Indiana wonetpresent.After dinner the youna peop! May the tin« ive come when thin family will rave a reunion a4allbepresentareunionwheretherewillbe | fo more parting Meeting at Snow (Creek—Per-sonal Items. Correspondence of The Lanamark. Statesville,R35,Aug Dh.Rev.SpurgeorNervilleofOldPorttvisitingrelativestt the community J.AL and PrGaither,whe ha working in)Peters burg,Va..on the cantonment,are at home fo a few daysTheprotracted meeting will begin at Snow Creek chureh Sunday ’Mr.and Mrs.Lo ©.Lawrenee end childven|ef Henrietta,and Mr |BO Le ofNewportNews,Va,have returned to ethemesaftervisitingtheirfather,M a Lawrence Mrs.ROL.Adkins bar been with her direst ter,Mes,Jesse Cowan.who ix at)Millinustehespitalrveoveringfromanporationfe appendicitisAboutforty five yours people enjoyedpienieatthemillrearMrRR! Saturday afternoon,given in hon Frank and Pro King,who areCompenyE.\bountiful supper which was efioyeod by all ve served Noticesot New Advertisement: Bargain in live ateck.bugwies,ete J.RK AlexanderAutemebile curtains lest Return to The Londmark Kernersville Furniture Manufacturing Co | wants ta contract with saw mill Warning against harboring wife Lothe KielYour interests are conserved Suates ‘ Motor Co. Orange whistle Coca-Cola Bottling Co Rice atraw perch rugs Crawford-Bunct Furniture Co Wig 2ie bat sale Mr faery SimmThermesbottles.Statesville Dour CoVatriatierecordsfortheVietreta|Vndrev Music StoreTobaccoflues.Statesville Tin CoMyerspumps.Wo EB.MondaySlacktiresrepaired.fredeli Vuleantone &Supply Cofasttwo days of clearance sale StatevilleDrugCo.Young lady wanted for otfiee werk FOF foknsen Boys wanted BR.care The Lathdmar :Protraged Meetings. Correspondence of ¢Landmark. Harmony,Aue.16.The Saracen and Mhil then claaees of Maeedonin church will we cream oon the lawn at the church Saturds evening,18th,bewinning at 6 6 choc!Pub lie cordially invitedMissDellSutesof Now Castle ig the guest of Me.GC.€Parts Mixes Ruth Dean of fivrernebore is visiting Miss Cleyee HunterAprotractedmeetingwillbewinattelly Springs Sunday 1th Also at)Macedonia eburech 065 the fourth Sundsy morning in thi month Children’s Day ecercters in the afterhoon,Rev.Mr.Foster and Mixes Grace Myers of Witkes ere belping Rev.Mr Wail in a se-rie of meetings at Harmony this week Drawn in Indiana. Mr.Francis C.MeAuley,who has pames of Iredell men who went to aco been living in“Wyoming and Indianaortwoyears,is at home on a_visittohisparents,Mr.ana Mrs. McAuley,in Bethany township.Mr. McAuley registered for the draft in Indiana and has been selected for army service.He wae working for a silo company at Anderson,Ind., and was the only one of his asso- ciates drawn.Yn consideration of thie fact,his associates presented him a ring when he tert. Mr.ey s.McAuley have five sons and of these three were subject to the draft-—one in Wyoming,one in and one at nh,colored,workinycounty,was af-while‘fal nck nd was Me Johnawellinfectedbydrawnout Saturday *ed. pang Mere.J.1.Kimball &visiting Mrs.C.W. Swink ino Cagronrd. Mrs.BOC.Griffin and littl daughter,Vir- tinta Davis Griffin,of Marthy ttle,and Master 1M.Davis,&of Rintesvitle,wre visitingfeisiter,Mr FY.Long,at Catawba Mr ‘W.Stimpson bas gene to Black Mountain to spend «a weel or two. Mr ¢FV.Sicelotf of Gatesville,Texas.is mite rebative in the eoanty Miss Vera Asbury hae eturned to “er- nton after visiting My H i.Woodward |Mro and Mere.S.Eo Lowrance and chtidren joat hee boon vieling intives in Statervt do viens,have returne@ to their bow{Cnester,S.¢Mis.TM.Mili and Mise MaryLoisDetteofStatesville,and Mine Qeta Bute f Pisval,accompanied thom homeMroandMbk.H DeCamp,Misses Nel! ands Ruih DeCamp and Mr.end Mrs.FO WJossarhanofGainey.8S.¢and Mr WO A Canter of New Yor >)fave arrived to visit Mr.and Mrs.G.W.Puyror Mes W.A.Hamlet and little daughter Gloraine,bave gone to Reek Hill,8S.C.,to wheat Liew’.BK.FB.Barnett of Laurens,8.C.,ispendingafewdaysherewithfriends My fr i.Younwer teft this week for .Wye...to join her buehand.The two! their home t will nia ke hereMissesJulianondBHanbeth Austin left:thir seek for Mare Hill Mts Elizabeth will at- end schoel there this fali Mixes Julia will eturn fo Siatesvile shortiy Mies Nell Gaynn is sperding two weeks at |her home in Hinton,W.Va Miss Fleasie Moore of Newport News,Va,has tone to Mooresville to vivit relatives,after a few days spent with Mrs.T.L.Steele Miss Jane Summerct!of Rowan is visiting her aunt.Mrs.A.M.Coit|Mr and Mrs.D.Ho Anderson and daughter, |Mix Naney Anderson,and Mr nnd Mrs |lawis Anderson of Charlotte spent yesterdayJerewithrelatives‘ Mr None MeCutehar of Sumt 8.¢ a owuest at AG J.8.MeRorie’s |*2FamilyReunions. }Mrs.Mary L.Simons went to Newton Wednesday nofternoon to at- jtend the veterans’reunion there yes- rday and also te attend a reunior f the McCorkle family,held at the home ef Mr.©.M.MeCorkle yester- lay.The members of the family ioresent at the reunion were:Mr.j Henry MeCorkle of Tyler,Texas: Mr.George MeCorkle of |Washing-jton,D.C.;Mrs.Berta Boylin of Wadesbore,Mrs.Mary L.Simons of Statesville,and Mr.C.M.MeCorkleffNewton.Mr.Henry MeCorkle of, ‘oxas,Who hac been visiting his sis- ‘ter,Mrs.Simons,accompanied her »Newton A reunion5 of the “entz va:held at Fulton Heights at Satis- wury Tuesday.About 200 people in attendance.Statesville peo- nie present were :Miss Julia Lentz, Mrs.|.J.Hoover,Mr.and Mrs.Geo.{TLentz,Mr.Frank Lentz,Mr.J.L. Lentz,Mr.and Mrs.V.C.Ellis,Mrs. tohn Barkley and Mrs.R.L.Braw- ley Viss Julia Lentz was elected ‘saintant seeretary and treasurer of ‘he meeting;Mr.J.C.Kestler of| Salixbury was made secretary.The uniey next year will be held at Al- pemarte, THIRD CREEK HOME-COMING. Home -coming at Third Creekhurch,Rowan county,next Friday, 4th All former members =and ‘riends of the congregation and thesublicgenerallycordially=invitedMrs.T A.Niblock,Mrs.R.N Moore,Messrs.H.E.Hoover and T A.Gaither compose the committee on |arrangements SAVE THE PAPERS. Copies of The Landmark printed fer the past month or two wil!be inwrentdemandforhistorecatpurpos- es in the coming vears,when the family 'were pthe war and other local facts in con- nection with the war,will be want-Better save copies with fact» that may be valuable for future ref- erence There is more Catarrh in thie section of thecountrythanallotherdiseasesputtogatter, and for yours it wae euppewed to be incurable Decters preverthed local remedies,and by constantlyfailinetocurewithlocaltrentmentpronounceditincurable,Catarrh is a local divense,erently influenced by constitutionalconditionsandtherefererequiresconstitutionaltrentraent,Hall's Catarth Cure,manufacturedF.J.Cheney @ Co,Toledo,Olmo,tv a constitutional .&taken Internally andhetethroughtheontheMucousSur-faces of the System,One Hundred DollarsrewardtofferedforanyensethatHall's Ca-terrh Cure foils to eure,Send for cirewiars teatimonia!and he.P,J,CHENEY @ €O.,Toledo,Obie.Sold hy »The.tur conotigation. Hall's Family Pile _'Yadkinville and a Mr.M.L.Watts of Taylorsville,Aiofthemwerewithhimwhenthecame.Mr.Watts was atheistchurchhereand his.L.P.Gwaltney,conductedfuneralservicefromtheTuesdayafternoonat5o'clock.interment was in the town cemetery.The floral tributes were beautiful.Mr.Ed,C.Campbell has thetracttobuild«$5,000 brick chy for the Baptist congregation.wae to be 46x60 feet with a basementtheroofwillbeslateandwillbesita-ated on their lot,where the present church now stands.Work will be be-gun soon.Wednesday afternoon from 4 to € 'o'clock Miss Ada Viele gave an en ° ble sewing party at the atthomeofherparents,Mr.and Mrs.C.G.Viele,in honor of Miss Ruby Deal,who is to marry Mr.Allan Bowler of Raleigh ear'y in October.The guestsweremetatthedoorbyMissesVigle and Deal.The hostess gave table napkins to hem and while theyweredoingthisworkMissMabel Coo read a story.After this the napkins were gathered up,arral in a dainty package,and little MissSaraVieleMillerandMaster“Sonny” Graham presented it to Miss Deal,the honored guest.The hostess war assisted by Mrs.Viele in serving de-ficious refreshments.The out-of-townguestspresentwereMissMildredMosesandhernephew,Master SonnyGraham,of Chapel Hill;Misses Laura Mae He!mstettler and Ruth Fitzger-ald of Lexington. The annual meeting of the stock-holders of the Taylorsville Cotton Mill Co.will be held at the mill office Sep-tember 4th for the purpose of eleet-ine directors and transacting any bus- iness.At the meeting of directorsTuesday10percentregulardividendand26percentextrawasdeclared. Mr.and Mrs.J.A.Miller and daugh- ter,little Miss Constance,went to Charlotte by automobile Tuesday andwillreturntoday.Mr.and Mrs.Fred Page and little son,Fred Page,of Aberdee:,arrived Monday afternoonbyautomobiletovisitMrs.Page’s aunt,Mrs.Lelia Bogle.Mr.Page re- turned home Monday cvening.Misses Laura Mae Helmstettler and Ruth Fitzgerald of Lexington,are guests of Mrs.J.C BYicks.Mrs.H.DY.Lind- sny will leave this morning for an ex- tended stay in Shamrock,Texas.andseveralpointsinNewMexico.Mitts Mildred Moses and nephew,Master Sonny Graham.of Chapel Hill,areestsofMrs.T.H.Miller.Mr.C.L Everhart,who was called here Satur- day by the illness of his father-in-law Mr.Thomas Watts.returned yester- day to Newton. Mr.Ernest A.Shaver of the county has been appointed rural letter carrier on route 2 to sueceed Mr.BE.C.Moose resigned Mr.Lee Burgess,son of Mr.ThomasBurgessofTaylorsvilletownship,and | Mi Loaf Miss Ransom Deal,daughter of and Mrs.Gaston Deal of Surat township,were married Sunday THE RECORDOF DEATHS. Mr.Price.Mrs.Houston =and Miss Hair. Mr.William Price died at Long's Sanitorium Tuesday atcernoon abo 7 o'clock.Mr.Price was taken \ lently ill Monday night with a testinal disorder that proved fatn}The dece wer,who was 28 years © ilivedinBloomfieldandissur by his wife,his moiner.Mrs.M.| Waechob of Winston-Salem:fern sisters,Mrs.H.M.Hooper of Stat ville,Mrs.Lee Whitlow of Davidson, Davidson of =Albe Talmags toot Mrs.Henry Edwards of and Mrs.Maurice Watts marle:and one brother,Mr Price of Statesville.Burial place Wednesday at Island Ford Miss Eleanor Long,who was se. ral years ago art teacher in States vile (now Mitchell)coilege,die! last week in Rock Hit.mr.CC.She was a native of Lexington.thi- State,and was 65 years old.3S! taught in Charlotte for some years after leaving Statesville. Mrs.Mary Ann Houston,wife he iate W.C.Houston,died Morndas afternoon at her home in Concur! township,aged about 70 years.| neral and interment Tuesday afte: ioon at Stony Point.Mrs.Hous: s survived by a son,Mr An Hhouston,and a daughter,Mrs.kK AnusSherrt'l brother and si also survive Mise Bertha Huir,whose death Greenville,8.€.,Sunday was ly mentioned in the las€issue of 1 landmark,was buried Wedne at Fifth Creek church.The funer service was conducted at the char at 11 a.m.by Rev.J.H.Press!Statesville.Miss Hair was 2 mem the First Associate Ref church of Statesville,Mies Hair lived in Stateaviile several years.About two she went to Greenville to training for a nurse.She wa about ten days,death resultins asthma and heart trouble Hair is survived by her fathe: mother.Mr.and Mrs.W.W.Hi Elmwood,and by four smstersthreebrothersMrs.A.A of Peachland,Anson county,Mr- E.Menius and Mra.H.S.Havthiscounty,Miss Sallie Ha.Elmwood;Messrs.R.O.Hai Winston -Salem,O.M.Hair Elmwood and W.F.Hair of State ville. quontt thh mtPhifer Yadkinville Ripple:Work is being sand-clay road |sushed on the newfromBrooksCrossRoads to the Ire ‘dell line.This will give the peop! of this section a road to Elkin witte, of wf ing garbage is indlarcallsaremade everylastWeetheemergency¢alanytime. anxious to interestfriendsinthesanitary work,hope soon to organize a Civic League for the colored people.During the summer months thestoresinStatesvillecloseat6 o'clock and the members of the Civ-c League have been impressed withthefactthatsomethoughtlesswo- men delay their shopping until lateintheafternoon,‘They rush in the iores just at closing hours and keephetiredclerksworkingafter6o'clock.The merchants and clerkswreduesomeconsideration,and themembersoftheCivieLeaguehavelecidedtodotheirshoppingbefore time for the stores to close. Next Tuesday eveningleaguehasengagedtheband toplayatthepark,and light refreshmentswillbesoldonthegrounds. China the Seventeenth.At last China has officially declar- ed war against Germany and Aus- tria -Hungary,the war dating from 10 o'clock on the 14th.China is the 17th nation to arrayherselfwiththeEntentecountrieswainsttheCentralpowers.The de- ision of the Chinese cabinet to de- cl war on Germany and Austria- Hungary was reached August 2 and the action of the members of —theministrywasapprovedbyFeng Kwo-Chang,the acting President of the republic. The 17 countries now in ine war on | the side of the Entente follow: Great Britain,France,Russia,Unit- ed States,Belgium,Italy,Japan, Reumania,Serbia,Montenegro, Greece,Cuba,Portugal,San Marino, Siem,Liberia and China. NEW HEATING PLANT. \n entire new heating plant is be- installed in the Federal building. ihe contract for the job has been let to Wm.Wilby of Alabama.The plant,which fs thezoughly modern ind an imprevement upon the old lant,will cost about $6,000. MARKET REPORTS.T Statesville Preduce Market.The following prices were paid yesterday for produce on the local market: inv Chiekens,Iie.per tb Hens,léc,per tb, bews ‘ie.per doaen Roemters,ic.to Se Tub.Butter perThiButier,30¢.per Beeswax,3c.per tbGreenHides,1%c,per Ib te 2Ne.»Ste per th. ibthe y ,cbc Sides,€Shoulders.to 2te New Red Honey,15e Sourwood Honey Comb,lic.te ¢ E acted Honey.2le.wo 22c.per Ib Old Avto Rubber Casing,4c.peor IbTrixhPotatoes(new)$1.50 per bushel. bald yesterday per Ib per tb he rain.The following prives were|for grain on the local marketbushelWheat,#255 per : |Gorn,$1.95 to $2.00 per bushel j.Outs,Sic.per bushel. i Statesville Cotton Market.. On the ocal market yesterday 26.25cotton.pound was paid for best Market firm. WANTED—Y oung lady for general office work. Knowledse of double entry book-keeping more ewsentio!thar aphy Apply in persen tenog F.L.JOHNSON.Coca-Cola Bottling Co \use WANTED—Two beys whe will work,Must be nent “4 runes t «f pleasant ad dress bitw Sct boy eferred Addres P.,ewre THE LE ANDPMARL Aux.17 WANTED—To contract with good saw miil te eut mills tre more of oak and poplar Humber Vn ’job must | have weer aT «able te mat. facture Sumber 4 \KERNERSVILLE FURNITURE Mi CO.Kernersville.N.¢ Aux.|eee =eres a ernemieeligonee LOST—Twe automobile curtains.Reward forreturntoTHELANDMARK,Aus.1 It FORBIDDEN—My wile,Magic Eccles,hav- warned net ing left hore he he are te barber o i LUTHER ECCLES Aug FOR SALE—An extra geod driving mare. Strong enous f Will aneri flee for quict Bb tt Aus.14 Jt WANTED—Boey graduate of High School to eolieet.Geed cb ‘notion N\ppl in own hands tHE LAND MARK \14 at SHOE SHOP—F.A.FRVE has moved hin shoe repair ostey {H ,clothin store +ut LOST—Pockethook containing $4 and rail- rod pie ©Nabe Heta THE LANDMARK ‘thiiipaittinmenemeninntenacnea— A MUDERA BRICK PUILDING FOR SALE Suitab!:eaten mereantibe busines:Exeell ‘addy established Tern MR s \ FOSTER,Sate t i FOR RENT—Storeroom formerly cecupied by R #.Allivon,RV COOTER Aug.iv . MICKORY BLOCKS WANTER—Will pay geod price mm ord Write fy rther is formantion.HICKORY HANDLE &MF¢ CO.,Come N.¢\t .>’_FOR SALE. At a bares Cush «hn time ' of horses,two 1 y dt 4.8.ALEXANDER N Aug.!t WANTED—Knitting Will Help.We are now operatiny our news ni ~sanitary |Wutlding Btreet ct t minutes Clase at 12 e'cloek Saturdays.Good wages to teppers,knttiers me Can a Ve bright youn:women to learn Most attract ive city in the Sout?}peated troops and many “ying machine to be that berrverd here.CHARLOTTE KNITTING COMPA NY,Charlotte,N.«Aus at LAND WANTED—To correpond with any One having real estate anywhere they with to turn inte quick cash We believe we hitve the bert system to be found anywhere handling auick «sles and vetting the most money,Ne trouble to look your property over and give you the benefit of years of experience in telling you what we think j shout it.We can furnteh the very bert of references.ENGLAND REAL ESTATE |AND PUBLIC AUCTIONERRS thane ’1584,Greensbere,N.C duly "St |eet‘WUILDING?.©.WATKINS. oi codey fom o hig y “ The man who has money in the bank will get ~ ATTENTION when he goes to talk Business. To have money in the bank PUT it there;let it STAY;constantly ADD TO IT.When you get a big balance,BE CAREFUL.You may,in ONE DAY,by some bad investment,lose the savings of a life time. We shail gladly give you our opinion on any invest- ment you are figuring on making. Make OUR bank YOUR bank We pay 4 per cent interest on time deposits.THE FIRST NATIONAL BANK; Statesville,N.C. Today -Tomorrow. Last two days of our Clearance j Sale.4 Real Classy Merchandise ‘ At a Price That Will Interest You. ~~Statesville Drug Comp’y. —The Rexall Store.—i ITH sixteen years of ex-. acting service NEPoneeT Paroid R iwreldRoofing|g shows itself th roof you can buy.Ask us for the proofs of this claim before you buy roofing. Doors,Windows,Sash,Wood and Tin Shingles, Lime,Cement,Nails,Locxs and Hinges.Our stock of these goods is large and we ‘an still give you reasonable prices, Lazenby-Montgomery Hardware Co. a‘ FOUNDED 1838 CHARTERED IN 1859 TRINITY COLLEGEDURITAM,N.C. A College of liberal arts with an extoblished national reputation for high standards, traditions and progressive policies,it«large endowment fund makes ponsible ite frst equipment and large faculty of well trained and carefully chosen teachers.Students low.Comfortable,Inexpensive rooms in carefalty superivised hygienic Classical and scientifie courses leading to bachelor’s degree.Graduate courses in all de- partments,Schools of Engineering, For catalogue and Ulustrated booklet,address R.L.FLOWERS,cRNA A OL OL CCC AC PEACK INSTITUTE,RALEIG For the Education and Culture of Young Women. ientifie Courses leading to diplomas. Education and Law, Secretary to the Corporafiion Classical,Literary and 8 1 ; Graduates credited by State Department Education for Teachers Certificates,Special diplomas awarded in Music,Voice,Art and Expre ssi Excellent Commercial Course,Domestic Seienee, Domestic Art INSTRUC TION:Specialists in all departments,—; SITUATION:Location in capital city gives special opportunities, Delightful social advantages ' ATHLETICS:Supervised indoors and outdoors by ethletie direc. tor.Special attention,individual development.Climate out-door life all —.‘.natn ot “~ For catalogue or further information e at onceMISSMARYOWENGRAHAM, ' _— er e fe te r t in ill be needed in place of ts. Here is where the housewife and the boys and girls may do their “bit toward feeding our nation,as it 's usually in their charge that the pou! try is placed,By proper selection, care and housing they can greatly in- crease the egg supply for this winter. No flock can do well without prop- er shelter and this is cheaper thar Yood for keeping up the body temper- ature.A hen must be comfortable if e is to lay and this she cannot be if required to roost in a house that is open on five sides.The house need not be expensive but it must furnish air and protection from the cold wind. One with a good roof,three tight walls'and opening to the south,an- swers these requirements very well. A variety of feeds are necessary to supply the tissue building materials ‘and keep the body warm.Growth and ege production require feeds rich in protein,Bran,shorts,oats,clover and alfalfa hay and milk are excel- nt for this purpose.Green feeds Rr be supplied at all times by sowing clover,oats,wheat,rye and ‘pape where they may pasture on it. The lack of green feed in the winter is one of the principal factors that reduces the egg supply at that season The selection of the flock for erg production is of importance from thefesttwooffinancialreturns.Hens is z : st two years old should have been isposed of this spring Pullets to be layers the coming winter should selected from those hatched before f first of April,if of the larger ‘breeds,while those of the smaller -breeds should be of the April hatchLatehatchedpulletsofthelarger wreeds are not so well developed and do not lay until eggs are becoming low in price again. The egg is the most palatable and nutritious meat obtainable,and usually in the summer time is the cheapest. What is needed is a better regulationofthesupplytemorenearlymeetthedemand.Besids the bird selectionprocessgivenabove,the preservation of eggs laid during a period of over-supply will aid during a shortage This may be easily accomplished by the water-glass method described be- low Select fresh,clean eves free from eracks or flaws and place them=in stone jars then cove:them to a depth of two inches with ua solution of wa- ter glass and water.Use nine quarts of water that has been _previ- ously boiled and again cooled —toonequartofthewater-glass.Have the jar in a cool place and add more of the solution as more eggs areplacedinit,or as the water evapo- rates.The water-glass may be secur- ed at any drug store.Eggs placed in this solution in the qummer wil]be suitable for cooking Purposes in the home through the winter.Their sale is prohibited un- less the purchaser is first made awareeftheirclassification,The use of water-glass eggs in the home would release more fresh cygs for the trade during the period of shortage.In this way it would be well worth trying,as eges will likely be a great deal high er in price this winter then at present Eggs are necessary in the hospital and a priee of from $1 to:$1.50 per dozen in England and France is said not to have stopped their use there.A price of from 50 to 75 cents”per dozen is already predicted for cold storage eggs for this winter.and fresh eggs are always much highe: According to government reports the supply of eggs in cold storage May 1, 1917,was only about two-thirds that of May 1,1916 Begin ear:y to prenare for this win ter by providing the neccessary feed and shelter for the form flock and s« Jeet those individua’s that will makethebestlayers.[spose of or kill alleullsurplusstockandreestersthat sill be ao hindrance to the best care of the davers and save eggs during tne period of low price and aver up ply f vour home use this winte 1.B.AULL,County Avent Mobilizing the Cars. To frecilitate the prompt move Ment of yvrain and food produet aus well as munitions,the na?ervice comm),sien of the railway war board has ordered the ommedinte distrilu- tron et nearty 21,000 additional emp- tv cars among the li operating the South,the Middie Westeand theSouthwest lh makes a total «f more thar 1A)oe empty cars oa.ceres moved in the last two month,from.one railroad to another,evardles.of ownership,to mobilise in arious warts of the country a <afficient num- ber to handle che awnormal goverr @ent and commercial raffle produced by war condition a GEN.MIVER THE MAN. Gen.Geo W.Melver,a native ofMoorecountyandagraduateofWestPoint,will be appointed com- mande:of the North Carot:na brig- ade,says Washington report.Gov.Bickett recommended Coi.Ferguson,a.Waynesvilie man,when the War Department stood aside Gen.Young.but it is stated that Gen Melve:will be the man The first three bales of (oi gia’ new cotton «to arrive in NewYorkwasnectlonedfromthesepaofthecottonexchangefor700,nearly 50 cents a pounc.The moneywangiventoRedCrosswarfund,©' i te r Fa t 2? < Aus. |soo @Arthurs,H.|Arthurs,J,Brown,J.W..|Brown,4.L.,Coon,2.He SE poss pers aensesDavia,De|Dewia,x 60 geres ......--->acres Allen,Comer,14 acres .Byers,Wade,4 eres ......-Falls,Perey,4 acres ......- Benton,Mra.C.E.,77 acres .Combs,Felix,6 acres ...... Houpe,J.F.H.,26 aeres ..Houpe,J.B.,82 acres .Hayes,Mrs.P.A.,175 aeres Moore,W.A.,89 acresMoore,J.W..43 1-2 acres ...Nicholson,Miss R.F.,06 1-4 acresNicholson,C.R.,50 acres : Pressly,D.J.H.25 acresScott,L.F.,58 acresSowers,dno.,341 acresSowers,Mias Jane,192 acres . :Colored.Allison,Jno,5 acresBailey,Devid,2 acresBailey,Victoria,15 acresBrocher,Ellen,5 acresColvert,Wiley,1 1-4 acre Cowan,Juliys,1}acre Chipley,Anderson,|acreDavidson,Will,45 acresLyneh,Dock,18 1-2 acresSummers,E.E.,25 acres Wellman,Jno.W.,38 acresChambersburg.Rass,C.8.,+2 acres.Beard,A..77 aeres Brown,N.E.,222 acresChester,W.L.and W.NN.Summers 63 1-2 acresFarm,Red Crest,1.100 acres Moore,F.L.,245 acres MeCoy,J.W..Lis acresMeCoy,T.F.,108 acres Overcash,Mrs,D.W.,88 1-2 acres Page,G.8.,70 1-2 acres Poteet,W.8...100 acres .®S acres Tucke .Webb,J.W.,160 1-2 acresArthurs,Mrs.J.S.,32 1-2 acres Christy,M.A.,104 acresGibaon,A.A.,32 acres Maddin,Miss M.J.,23 1-2 acres Menis,J.Y.,24 acresMills&Moose,219 acresMitchell,J.W.,135 acres Murdock.Austin,82.1-2 acresMeLain.J.A.LIL acresVhifer,J.P.,1 acreSmith,W.L.,97 acres Whiting,Mrs.Annie,60 acres Allison,Abner,57 acresAvery,Hordy,4 1-2 acres Chambers,Arthur,1-2 acreChambers,Mack,1-4 acre Glover,Dora,1-4 acreGlover,Thos.,1-4 aereHaynes,Lauri,2 1-2 acresKrex,Ro J.13 1-4 acres Patterson,Foyett,1 acre Patterson,Herman,|1-2 acre Pearson,Armps,12 acresPearson,Richard,1 acre Robertson,E.D..7 1-2 acres Smith,A.C.,16 seresStevenson,Jule,7 1-2 acres ‘Tucker,Patsy,5 acres Waddell,Alex...2 acres Westmoreland,Ho D.,4 acres White,A.P.,40 acres Chambers,David,2 acres Chambers,Sophia,3 1-2 acres Gray,Jno and Guess,22 1-2 acresHall.Lasate.2 acres MeHenry,Lina,i acreWhiteDelinquents.Brown Heirs,105 acresGoodman,J.L.,#7 1-2 acres Plyler,Mrs.8.R.,130 acres Gray,Jdno.,22 1-2 acresLentz,Mrs.Jerry,36 acresSmith,Mrs,Ro M..60 acres Snyder,Miss Annie,§acres Watt,N.P.,guardian,i acre Coddie Creek.Arthurs,K.W.,1 lot Barwer Bros.,204 acres Bass,L.CC,2 lote Benson,J.F.,1)lot Brown,W.D..1 lot Brown,W.A...72 Hrown,James W Coison,AL W,¢ Cook,WOOLCranford,N.oP.1 let Cranford,At 1 det Craven,FLOM.289 1-2 acres Deaton,Zeb.1 lotDeaton,Mrs.J.W.,6 Lote Deaton,ae , Fairchiids,J.Fleming,R.B.1 jetFollett,J...1 lotFollett,Mra.Jo)2 lots Goodman,Po Jo.25 weres,|lot Hambright,Tom otHart,DB.1 tetHunter,BJ.3IredellFarmers’Wieehounse,2 lote Tackson,JO oH 4 lots Johnsen,J.Wo oH.288 acres Kennerly,X.Ft lot Renneriy.JOP.61 1-2 acresKerr,Katie,1 lot Levar N vert Linder,Mis.W.OW 1 lot Meltchor,WOW ots Overenasin SI;4 ,acres Hattersen,KooF Wo ReTeSHopeodet Re ect \ Retest fom t s t t Shue,M Bille t H \' |fot |‘M eres Wis tou t Wa Ww Wi et t Younw,J 4 tomers bet Krows M howe 14,acres (antior M sf terChrinty,F 6G.inte,110 poresDavis&Wley Bonk,104 aeres Dearmar biank 1 feet Pe t ‘t be \ot M hare A.1 tot Is Wi dent s las acres Templeton Grover (acres Vani 'Mira,lot Ws }let Wileo ‘W wt Rrown,JW s acres bortne 1 ners Mudsot Live lot (olored. Brown,Stokes hot (amypbe Mattie +let Campbell,Hen R..1 jot Crawford.Jenme :Duff,dr Enell,Jim Faulkner ty bh 1 dot Paulkine hove jot Knox,W .ACTOR Knex,Jno et Milla,Will jet Marry,Pranei«lots Murry,Jot t Neil,Allen,rts Phifer,Wii Jr i beet Ramaey,Wm,hot Torrence,Charlie,1 jot , Williams,Jn Wesley,1-2 acreWhite,Leroy het Campbell,Macrtir 1 let Cowan,Tom,1 lot Knell,Myrtle 1 bet tintne,Capins 1 bet Moore,Arthur,|JotMoore,Charles hevt Newby,A.L.,1 bot Orhorn,¢A 1 letPinksten,Walter,1 lot Reid.Wm,2 lotsTilimen,Jame,1 lot Knox,Jay,1 lot Jetton,Stl,1 Little HB.C..56 eer ,Seengehen eereee HOR eeewennneeee aeeeeeeene |.7”eee oo ‘-m .:f j seer ee eee renee os |eee eeneeee serene tennne acres .. vastLi|Ward,J2:08|ite,Me.BH5.54,Moone,J.O,22 serene os ay vs seneneerebes Guy,Mre.8.C.,extate,22 acres 2.h4|Dayvault,oven7.48 Aeeeereeoneres6.47)Cloet,J.1.seeereneserenees3.46|Carter,W.38.62|Carter,W.”+2 ion we K6.96 w.cpesees A +yeCe+i:bu A .3.WL,46 ners .....5 ’59102]OL,ataera oie eiseskes 16.09Lae::Mee ssoarenntsss 569)Wilson,R.W.,73 seres 4 Sapdstoveree 21|Webb,J.W.,46 were ........'Hees ce eeccenes 24412.66 |Colored,Aiscvecerecees GT5.78|Reseboro,Enos,4 acres *1.222.97 |Stevenson,Jim,40 aeres 1.98 11.129|Turner,Burge,26 acres 7m) 22.44]”re |3.20|Brown,HJ,oo ote eeeen .oy 168g|Bank,Davie &Wiley,acres...10.67|Cathy,A.M..100 meres oo...sees 3 ee |Dickerson, 10.54 |Carpenter,W.P.,30 aerws ........*seve .TE atecces18.25|Cornelius,W.W.,60 acres 11.20 °‘13.53|Cornetius,C.H..280 acres 2aas 17.008 eeeee ae 1 orves 21,1736.22 od MORE eee eae esyzat18aevres........BBR Oe I otec corescess «=|Ee Be Mas ©Oe terres6.40|Morrison,R.R.,55 acres ..........6.60 .|“45|Morrison,Mrs.Emma,170 geres ....18.12 ——,6.00 Houser,C.HL,I fot ...... 2.28 |Mayes,PR.i Oe 8...462 Plot,Sas 18.32 |Howard,W.A., ‘92 |Mott,W.B.,82 acres vats eee 97.98 Pope.ert BB MEMO...gereeee‘91|Mayhew,W.A,,153 1-2 weres ......gag,Pratt,.%. 4.43|MeDowell,J.B,27 acres ........a2.Sane c .4.71)MeKnight &Freeze,135 acres ....9.60 ert ' 5.43|Rozelle,Mrs.L.L.,280 acres .....aay 58 _—9.64 Southern Power Co.,30 acres ......B42 Sells.dno,2 ma as 6.24 ao 12 3-4 meres ......4.88 oan a,La a “SR ee iz |Washam,.fr,58 r orate ae ¥see ..he reer peace \'icon)eee 2 core a a Somers,Mrs.Berhta,1 lot 20.63 Morrison,Vietor,2 acres .........10iaooCélered.comers,W.V,,estate,0,99 Morrison,James,1 lot ............88|malty,Connie,3 o Sowers,Jno,|lot...15.39 MeDaniels,Harriett,1 lot ..........3.46¥.ee Gn aad ol eae 2 Sowers,G.BL,1 lot 10.88 MeLellend,Henry,1 270.00 |Bortoes.8B oe ere ee A ade,oe 1 106|Melebeek Oe teu skhségn|U Gonteh,0 acres,eee sare 6.Mee We.‘)1943)MeLelland,Emma,1 lot |)...2.84vog.gn |James,Perry,2 acres i “t Snann,Lathew,1 bet .............6.34 McNeely,Jno,1-2 acre ....3.79 es |Lang,Henderson,cxtate,13 acres “a,lhompson,P.H.,1 lot .......1.22)McNeely,Laura,1 lot 6138O65Gli3Weleme.9 turner,Chas.H.,3 lote ..........00.21 |Mishert,dno,€bet .........5.74|Young,Alexander,65 weres 6.2;{vrner,Mrs,Lule,1 fot .......19.54 Nichols,Frank,1 lot 4s 4 |Honeycutt,Mrs.G.C..15 aeres :haw corner,G.E.,1 lot ‘17.12 Owens,Tom,1 let ....wale 3.8412""White Delinquents,~Waseem,9.C..1 19.50,Petty,Martha,1 lot...0...eves.hallMeeetined5.i.eh mcrae 2.50 Webb,W.BE.2 eens 48,91 Petty,Delia,2 serve ............,s B.a7 17.46 Rrewn..J w :bo aeres .26.\Wilkerson,J.W.2 bot ........:5.88 Pickens,8 W.,2 1-2 acres .nae 4.04mtDevidecBob.ee :Wood,Mrs.Harold,1 lot ............1.22;Rankin,Mach,2 germ ..............6.20noeSate,»8 mcren Sade White Ransells,Lee,1 lot 1.22fcche16-8"compress Pad @ Saddle Co,lot.64.17 Reed,Ella,Plot...06.)#1wagsKeounegu:nel Se ie Per es ke cn cei 3}heard on the VICTROLA at our~10%mae States On,bb chert,Boon,1 lot ..........weve 2.4 et ©oF een resales —Colored.Sherrill,William,1ovot 2.222!Tn |store are thedirect cause of one |C.,ét acres ao)\(lams,zoe.1 =a oisieiaiateieisieis)bie 8.90 Smith,Jno.IL,blot o.......00.00.,sez}man voluntecring his services to 22 52 |Thompson,Mise Carrie,Zincres By Mhoon,Ma,FL creteee OB|Henlth.6.BW.CG neces ceree ne :20 Unele Sam. 20.19 Kagie Mills.Haticy,Walter,}bot ...........:6.04)Bemith,J.Me.1 bot...eee ee 1.55}YOU should hear these Records! 1n17)Bagwarly,T.A.28 acres og,iatley,Annie and Alfred,1 lot ......4.95 Steelman,Mattie 2 lots .............¥2.40 ill Ww ‘Hh pl F 4a |Coal’Arbus.18)arree ot ego Carahert,Andy,1 lot...sae 4.88 |Stevenson,Jno.W.,1 ba .......0.8.go)They are thrilling.e will play isoy)Ikarman,©©188 actos rage Dennett,GW.1 lot wet nese 4.88 Stevenson,David,1 obot 06.00.00...86]them for you et any time! Ae vy |Rvevidec,J.W.,10 neree aso cower,Lele,ft dot ..........me 8.49)Stockton,Bi,1 bot ............6.23 - 4 Hayes Wl a -4 laiten,Andy,1 lot Pies as 84 Stockton,Tom,1 let .coe eee 6.16 10.38|Malden,J.A.,fr.,22 acres ce ee 244)Stokew,Annie,1-2 mere ...........,1.83hs:ch.40 wer sa,becles,Belder,1 lab occ ccc ae.1.83)Summers,Mack.1 lot ......see 4.98«ok -2 re ae Feimater,Melvin.lot.4.79 Summers,Jim,1 lot ..ene 6.46 Everything Musical.Yivest,L.W..6 ae.Urey,dno.BL,1 let 12.04 Summers,Wer.1 let .3.68 Le ee +x Tien —reen,Margaret,|lot 2.44 Wilson,W.M.i lot ‘6,90 105 East BroadStreet.aL Pg aa ih erichesr}“S*Hampton,James,1 lot 4.25 Watt,Quinee,1 lot ‘3.2%Phone 304. te Careon Malinda.109 acres”.Holmes,Perey,1 lot 4.40)Watt,Thomas,|lot 2.98 in Stecle. Lannle 10 ear oe Howard,Emma,1 lot 4.27)Weaver,E 1-2 ucre 1.638 a;,.e"Howard,.1 lot 10.95 Weaver,I!,1-2 wer ne 3.98 ;aegis4conDelinquents.olan toe os 12.49 )nasi Ea Sree es rei]The paint that is CHEAP per gal-Mapes oR.se cee Oo"Kerr,Henrietta,1 lot 2.44 Walliams,Niek,i lot :61}ion ig DEAR per JOB,Sepnet))8268 nares)16.1%Kimbrough,Will,1 lot 410 Williams,J.B.2 lots Mal Nae Steelman,Hardin,70 ac 3-6 Marsh,Susun,1 lot .1.83 Allison,Mary Jane,1 lot :1.32 cig Smith dW SO ners BLS Moore.Richard,1 lot 6.23 Kddinger,Eoima,i tot 615.16 |«0 ©.ee 12.84 woore,B.L.,2 lot .6.11 Benton,Mary,1 let 4.88 ji a Summers,Peter,22 acre:2.35 Murphy,J.P..1 lot oe ee heb.p Gtelle.1 lot aaesaaoaee*3%Mekee,(LC.1 bot ao :=45 Wacvey.1 wt :ped h *6 Campbell,Emma -—6.2 nd.W.P..1 let es a 88 :Matinds.|lot :1.63 Le Brows,Wk.oO oe Nicholson,Josephine,1 lot 366 Campbell,M.8,1 lot "8BeeenWW[ac ON neues 43)Pecan,dennie,1 lot ..1.83 Campbell,W.M..1 lot SatClark)Lo Kilmore 1 gee Sheil,dno.AL 4 lote 13.84)Careon,M.D.1 lot 24Ucienaltamrts(ML ni pian ee 24.1"bhemas,Ed.1 lot 1.88!)Caron,Wood,1 fot 12LaedeNaoe14.5.White.Joseph,1 lot 1.88 Chambers,Tessie,1 fot 1 CIGaRIL HUA iene 7.5 Woods,Dave,1 lot 1.88 Feimster,Luther,1 lot 1.22 tba MiN A,fs Aye 18 Woods,Vina,1 lot :1.85 Feimater,Nell 1 lot 61 a Ae Martina G)AC 4\wets.1 2.14 Woods @&Carson,1 lot 124;Feimater,M8.A,1 lot istmay cost you a littl more per . MB Mariling ©A.geet 3 anes 1.46 Griffin,Tom,i lot 684 Galor,WML,Ddat ee ‘61 Tlon,but wit!cost LESS per job’i :ee ace erase 4)Stevenson,Jno.1 lot 5.62 Gentry,Mollie,1 lot a ,;eae :Harteell,Wo H.1 lot ;1 7 VT any other paint made,as it will doJosey,Stella,2 eee ''Webb,Roy.|#29 Hampton.Mary,|lot :61 :;:OREViney.‘Salle se ae "=Weods,Richard,1 lot 6.23 Hampton,Lorena,|lot oye}from one fourth to one-third MlGaesMiki©J)ee wecee |!Statesville (Outside).Harris,Jno,W.,1 lot :6:1]WORK,do it BETTER and last Nney Mina Me Cc.Ww acre *Barphart,MT,117 acres 6 Hines.Jo.1 lot ::“447 onge:Te |eae talawalbailiae Sb were Barnhart,Eo).B.5 acres 244 Holtsclaw,W.M.,1 lot sd ¥‘AG,Linpard.J.Marion.St acres oe £02 |Reogine.W.G..4 lote 'FOR SALF BYonikpaceree')Barringer,A.1...64 acres 7.70 Keetler,C.M,1 lot :18lewogh!Benton,C.K.1 tot 7.8%Keaton,Bell,I lot :«|Lazenby-Montgomery Hardware Co. nos :gone *?Bowles,A.BR.1 lot 5.55 King,Charlie,1-2 nere 14) .neler R..entate,1 lot 4)Brown,W.1 lot 1389 Kine,Will,acne 1.6 Statesville.N.C. Re bb,fica 4 wesate:#4 acres 4)Byers,Carl,1 lot ASs King,WoL.ft lot Lal ——seca esr omen rear rare eae Troutman,F.Atos |t ::Carter,w w ace ly 69 Lyneh.Doek 1 het 1.823 reutman,HON,50 i +Carter:Bros.,6 acre 244)Morrison,Carrie,1 lot 61 cypecansis‘ieee :“89 Cashon,J.T.5 acres 12.31)Mecrison,Emma,i tot 61 NEW S \ il WitakGare 1 Oo Aelingtee :559)Campbell,J.Wo.1 lot 122 Morris,dna,1 tot 1ty ‘- a A Ss nee Cigasea :‘8 Caldwell,Etta C..1 lot G11 Murdock,Addie,t lot at eae ::berlain,Job.1 le w.5L Myers,HOC,|lot 1.92 |::2CetoeeedicongenFMtenoessuingMyers,He Bey tot ‘||Turnip Seed in packages a mas aL a fe 184)Daniels,C.FE,88 neres £2.40 MeLelland.B.L.,acres \.6F ;:° \anderbare Peter,tht 81 Day,PL 8..2 acres 2.68 MeLelland,Gusa.,1 let 1.22 and in bulk.Also a .ees —‘5 Davis,Hoy,1 lot 6.01 MeNeely,Laura,|lot 1.22 |.Dishman,Mrs.Nancy,16 et Dellinger,Bo L..1 dot 9.39 MeNeely,Jane,|lot “|variety of other gardenMilisawenee‘2.Fox,Mrs,Clemis,1 acre 3.056 O'Bryan,Naney,1 let 1.82]ae g d ’=‘0 Pry,BA,165 acres 40.68 Patterson,Herman.1 lot ®«a6 1 re :F |Oitolend,Jd.i.8 meres 11.68 Phifer,Carrie,1 lot 2.44 {and I Ie ld seed, :i.'2|Gregory,W.H.HL,61 acres 36.856 Phifer,Hall,1 lot 56oe+=50 neres ‘7 Huser.J..,4 acres ‘53 Reavis,Jno.1 let 1.1 All New.Bo marca »218 neres M4 Harbin,J.F..28 acres 14.84)Seott,Magwie,1 lot .1.58|| rea here ha.RD ease ‘6 Harmon.B.¥.,5 1-2 acres 16.91 |Simonton,Nancy,|lot 1.88 Ue wets gc We nee 6 Henry,RF.|”18.29 Spann,Jack,1 lot cal T N.BROWNWilkin,Be lke 192)Jenkins,F ;5.14 Stevenson,Henry,1 lot 440 ||e ° Will pelnsge b_a 1s Sore 192 Johnson,E 1 vere 144 Stewenson,Rebecea,1 lot 24d]Williame.8 o -coe 4 Jobnson,J :seesie 1.31!Stewart,Jno,1 lot a ° are ona.eee meee 19!Kestler,W.A.I.6 acres 98}Stewart,Sam.,1 lot os 1s :lwge White Delinquents.Lackey,C 2 6?‘rane ;has Laetiavar,y,C.W.1 tot 5.62 Stockton,Francis,estate,1 lor zing Shaver,Mra,Jno,F -_”6 Litaker,A.M.21 acres 10.29 Stockton,HB.&.,1 Sot :0 STATESVILLE AND ELKIN ab le .Lippard,T.D..1 let 10.17 Summers,Malinda,1 lot 1a:13.54 pee a _.Amanda,estate.4 acres 10 caoua dj.J,25 acres 2.96 Summers,Lettie and Lena,|lot 1.2 JITNEY LINES20setre.M.C.,161 neres 20)Lyons,8.C..M and M,2 acres .64 Summers,David,3 acres :.6.84]SCHEDULE. erg occ :7 I...36 acres 12)Mayberry,SF.1 let 5.97)Thomas,Ellie,estate,3 acres 2.42 |:4 s tesvilt 8:00 aUetadpelagic89!Mayberry.SR.1 lot 519 Turner,Will,1-2 acre aay ar Leaving Statesville..8:: Mes aM er 45 acres 7)Maxwell,Miss Julin A.42 acres 59@ Turner,Magwie,1 let reine:2¢|Car Leaving Turnersburg . oe Weal Pe '4|Matheson,1 A.1 lot 3.90,Turner,Naney,|bot 916)Car Leavling Harmony ..8:oh AR ce ks we.ge ee <4)Mitehell,JS.10 acres...4.26)Warren,T.W.,1 lot B79)&Houstonville .9:05 a.migPharr,A.ML.80 acres tg|Mek Bataes,1 to wee 6 White,Arnest,1 lot 1.22|Car Leaving Houston occa ‘ eh naan My ;a 1 |Mosteller,G.D..93 1-2 meres.28.08 Wilson,Lewls,|lot a1 /Car Leaving Hamptonville 9:50 a.m. Le hemline A nese 19|Morrow,Annie,1 lot...92 Witherspoon,Maurice,1 lot 1.8)Arrive at Elkin ........10:30 a,m. ‘Warren,B.C.v8 a 12)Mott,Dr.J.J.14 1-2 eres 18.26 Allison,Tom,|lot *221 Ca»Leaving Elkin ......3:30 p.m.'»H.C,25 acres 171 Ger,Mr-.C.EF.107 aeees 86.567 Bennett,H.B.,1 Jot Biv :H t ile 4:10 p.msnot13!Patterson,TS.1 3-4 acres :9.62 Holtselaw,Wo M..1 lot 72a|Car Leaving Hamptonvilie 4:2)p.m.Walker,T -ween (2)Pain,C.©.2 neres ‘61 Howard,WA,1 let 6 ix|Car Leaving Houstonville 4:55 p.m. SMR REE Sa 1 £0 BCren 11)Phifer,Bo L..¢neres 23.36 King,Beli,1 lot .244!Car Leaving Harmony ..5:05 p.m.Cigisinetl Aude 4 —Phiter Jo,2 meres 61 Turnersburg.Car Leaving Turnersburg 5:25 p.m.;ms 58 (dG Tt lat ;..-Wasson,Joe,&oes 66 Phifer.&.tu,2 ie rasta tile ratte in pig Elle::wap oe |Pool,8.A.DT Jot ar leav esvT.rn- ee H..67 neren in|Memeey SS.1 it...ing at 8:00 a,m.makes connection a Brown,J.A..S81 ares 50|Gemma,R.R.1 lot ....c000.-.ae with both North Wilkesboro and El-oe Bet Aaa echt apabhte 96 Reed,Jerse A.1-4 nerem o4..12.65|Green Slaters,55 1-2 weres les :v3 Bowles,Mrs.Jane,1 acre 13!Rockwell,J.H..2 lots ;:6.19|Gather,3.A.20 ceren kin-Alleghany trains.2 or 66 Statesville Development Co.,4 lots 3.33 Gaither,R.E.G acre«Leaving Elkin at 3330 p.m.,making vo Claywell,J.1."66 meres 106}Gieertil.WF.4 neres 1 Galthes,WL.88 acren aoe connection with trains:;Jip pat i.73)Spemks,1 T.5 weres vous 7.18 |Green,©.W..38 acres ’2 goi ;6:45 p.m.17.83 pomlaey,Mrs.A.B..38 ecres 92 Gowers,GON.2 acres veo.BIT)Galtier,J.AL.78 neres |No.12 going to Salisbury 6:45 p.conees,A.N.,187 neren 02 Steven’Qe tit 3 .56|Granfield,A.F )were ae No.16 going to Charlotte 6:50 p.m. ao bk —aa ee ne ans 54,Strohecker,Rev.extate,4 acres...4.88 'Hayes,Hal.1 sere ry |No.23 going to Taylovsville 8:10 p.m. tS feeb.(March A ace 62|Summers,WOV is acres AIT Holmen,F.C.41 acres 46.06!No.35 going to Asheville 10:25 p.m.Le ladda Ce ea aces 22)Templeton.Ko M.1 lot ones 7.68|Harpe,Wo M.,958 acres 50.86 NO SUNDAY SCHEDULE.Nico Laames"(GAL aaa cee 158]Thompson,Woo\.1 lot 1.48 Keller,O.A.,100 aeres 1 ete|s : Le Pores,W ¢ae ae 18 |Watts,Tot 1 lot .as :31)Mason,Roy,|acre ;:68 JITNEY TRANSFER co vgn Pol,Wo 8.80 acres se|Waeren,WO beeen O28 |Meson.Hire.Rite,452 acres...“On.ae :€. °oe ae :63}White,C.N..11 lot 4.88 Nichols,becca,extute,Jil acres ...eat Sta’ville,aaa”Soees:CB A Geren 44!White,Wo A.1 ‘61 |Strowd,N.£.64 acres ro (SE |,aie Me a ll ce 09|Williams,DOS.1 lot 2.72 |Shaw,B.A.,23 1-2 acres :ge oe aes "=-s Tal,6%ners 1.24)Williams,Carrie,1-2 aere ......‘4.27 Summers,J.W..67 aeres ..........- a |;olored |Woodward,mes Wk Wa 3.08:Wat,©.5.GG acres oo cevenccscces 13.381 DR J M HOLLANDxxRailey,Billy,estate,27 12 neve wo)Pek,§OC.f eevee oo...cece O84 Colored.ae °Stee hat te i2|White Delinquents,Campbell,Solomon,11 1-2 meres...1.64]DENTIST. (te:Martin,Chartes,29.2 68 Alexander,M.(.,1 3-4 acres 8.04 Campbell,dim,10 1-2 nerves...a2 |.Cig|Meera CA.8 1-8 peven %Bowles,Anniv.15 acres ....2:40)Foute,Orne.7 neve .ata OFFICE MILLS BUILDING.ce ee on t,Mre.DR,9 ners .......4.91 Gaither,Laura,55 acres ..458 linery Store ce wittts ie a0|own,Jesse and Annie,1 lot ..92 |Johneon,Prank,Sl acres........4 #3 |Over Mra,Sims’Mil4.05 7 Hnnewe.noe 32 acres 1.86 |Brown,ALR,1 lot ..........eee 18)Nichola,Dick,6 1-4 acres...2.97 |Statesville,N.C. 5 R Delinquents.|Brown,M.K..%eres o........005 17 |Stimpaon,dne.,8 acres ;5.07 Brandon,Mra.Lydia,%@ acres 172)Brown,W.B.1 lot 1!To @ee..27 acre6.66)Graham,8.G.,36 acres 85 |>ee eee eee ae Seconad,Rev "BR.th wanes16.59 Johnson,J.Jr,65 aeres +94 ,we $4|Guruce,Biches.16 _‘61)Turner,.Axley,F.J .142 nerea ..*”31)Turner,J.Frankaebseeeeuaa|1.96|Dalton,Gas‘Vine,R.F.,206 acres fe *S ceeeel “Fulbright.D.J.,80 aeres 184)Cash -Current,R.8. 1 14.89|2 ,Houston,BK,M.,extate,15 acres |5c16Kale,BM.OA.,26 aeren bees *|pe ®°=5 ¢and G.C.,35 acres ‘|a |Bottled xclusivel by2.21)~72 aeves :=|Haier,D W..48 acres ae :Fortune t.1 138 e29|Moore,HL.110 acres |||a Pertenece.T.J...7.60‘a mV.1,186 nerves weal *oe 20.74)6.99 Stewart,Mra.laabell,76 acres ‘a)2.69|Mtewart,J.H.,68 weres 3)id1.78 Sherrill,4.B.,100 weres "a ;|fB|a.477 |Clark,Frank,2 seres “ata.pe |Sherrill,J.A.74 neres g 4.96|ha Htatenvilie (inside),144 :Zan eet a / 1.e -four BottlesoneDollar. Your Hands Are not tied fromcarryingoutyourex-pectationsand desires when you havemoneyINTHEBANK. Your Bank Account depends on whatyouseve, It is ‘not'a matterOFGOODFORTUNE. Acquirc the saving habit while your in-come is small and it will be casier asyourincomeincreasesto Increase Your Bank Account. Now is the opportune time to open anAccountwithws.People’s Loan and Savings Bank.| “MONEY MAKES THE WAY EASY.” GEO.H.BROWN -.President.O.L.TURNER --Cashier.i FOR SALE el, 206 acres,le productive,red land farm,fronting quarter mile on the most traveled,public,sand-clay rond leading into States-ville;nice two-story’,frame seven-room dwelling,located in abeautifulgrove;bern and out-buildines,fine well water,twobranches;abundance of Suit;quarter of mile from school andchurches;80 acres in cultivation,30 aeret in meadow,balanc.inwoodiand,part of whieh is inclosed in Paciure.An exceptionalOpportunitytobuyafineyrainandstockfarm.Will take in partPayment,small farm if well located. ERNEST G.GAITHER. Insurance,Siocks and Real Estate.Phone 23.Satesville,N.C. THIS BANK| Is essentially an institution for allthePeople.{t places at the dis-posal of the Farmer and LaboringManasweilasthebusinessmaneveryfacilitythataconservativelymanagedBankmayoffer. Merchants and Farmers’Bank. Of Statesville,N.C. “The Bank For YourSavings.” »S.Tomlin,Pres.F.B.Bunch,Cashier.L.K.Lazenby,Vice P.J.A.Knox,Assis’t.C. DIRECTORS, C.8.Tomlin.-W.S.Page.L.K.Lazenby.-E.G.Gaither.E.B.Watts.-J.A.Knox.J.L.Stevenson.-J.R.Hill.Clarence Stimpson.-“Herman Wallace.R.T.Weatherman, “fy ”€tec ?erating >ning ih Sr te 2 ERE PATRIOTISM §BUSINESS Every good citizen at this time shoulddohistowardstrengtheningtheFederalReserveBankingSystemwhichourthascreatedwithitsbilliondoliarsofresourcestostandbackofitsmemberbanksandalltheirde-positorsYou can contribute directly to thestrengthofthissystem,and at the sametimesecureitsprotectionby°pyourmoneywithus,since everyadepositwithusgoesdirectlynewsystem,whereforyouwhenwanted.aedPhisisasuggestionforpromptaction. Member Federal Reserve System. STATESVILLE,N.C. Sendfor Booklet,“HowDoesit Benefit Me?’ H|Ree jlips had the namesof i |to‘ment,which has beew lenient in deal-sev-|farmers advertisingseedsforsale,onlytogettheythattheywereentirelysoldSimilarlettersaddressedto, are supposed to be able to spare a!——oot ¢ond these crops,al rought back the replythattheirfarmershaanoneforsale,a5_conditions had been unfavorable.| It seems to be entirely up to us.Yet I find some farmers having seed|of these crops that is fit for plant-)ing,but is being used for feed.’Again I would urge you to plant this‘yourself or to save it for a neighborandtofeedsomethingthatisless)valuable.Grain for feed is going tebemuchmoreeasilysecuredandat2lesspricethanthatwhichisfitfer! sowing.{If the farmers of the county hav-ing more seed of these fallwowncropsthanisneededfortheirown)seeding,will send me their address’and state the amount,kind andavalityofseedtheyhavetospare,!shall help them to place it withthoseneedingsuch.whieh shouldprovetobeanadvartavetobothhuyerandseer.All will be neededthat-ean be secured,if our farmerseretarxiseanythingHke«full crop’next year,“Do your bit”by eo-on- with your neighbor so he may alse raise a vood crop to help feed our army and our atlies, If your wheat or oate contain cheat and weed sced,see Chat they ore Cleaned hiv ronning threugh a fanAi]and hould he way every y fo Inan sowing of une which ‘essary if afoodmarketablecropistoheraiseetAllwheatanehouldalso be treated with in or tone just hefore seeding to the smut.Snivt and weeds ar tea cut down the vield as y auclitvy.Some fields have been low- ered anywhere from 5 to 40 ver cent. out. scaall grainsrrassestreatedthis ‘arseed, f thoir pos ible yicld with the given)(:ehotnumberofplants these pests This vear an extra effort chovld be yade to prepare the lard in the most avproved manner for seeding and te seed the greaiest acreage possible.Not only do we face a shortage feed crops,owing to the preceding short crops and to the greater num- ber dependent upen tose of ua who ate producing.but this from the ranks of the producertheranksoftheconsumertv many of our most able - going to moke a great hortace offehorerswhichwillin’oturn affeet vr output cf farm products. To cverecome this labor short:go it roing to be necessary for th maining on the farms to wor’ doys in the year,plan to hoors of toil mere efficicnt and raise such crops as can he grown with the least amount of hand labor. Many of our farmers are near fo staking their al on which means that they are of the vear so far a hor is concerned.desiles,erop is too freeuently Wieck @ great amount of or is not a food cron.ine use more machinery =and Hiehien man’ just by one me to ac is mm Yee r th YMAINY too we ron, idle pertinackTPOic horses labor and incyes efficiency.Tj much ost what a thine costs ae to how more each warkmar eeutuces ¢ the cost of pvreduction,This fell it should he the every farmer to sce}as 1 az possible to wheet av ¢of our staple food crop nly come on first next vear hut may he grown with much tess labor than the hoed crops.Ut will also help fo listribute the work enrouchout th: vear and will proteet the land from weshing during the winter months, when we have our heaviest down- peurs.The growing of a crop of wheat on land that has been me other erop will as wheat vrows at a different « ‘an from the hoed crome and after 4 lifforent manner,and usine more « other clemerts of plant Whe ver possihle prepare the land ey! to permit ‘+to heeome frm before seeding time,which hoch ‘not be delaved so much as is fri quently the case.Wheat should‘sown as soon as the mat danger of the Hessian flv is passed.whie! should be from about the middle of October to the first of November The time will vary with the seas»: Early freexes will permit earlier ceding. Plan your work early and cet oing as the weather permits,but in the meantime don't forget to co-op erate with your neighbor by help ing him to wet good seed.He wil! ‘njoy the prosperity brought shou: ithrourh your thoughtfulness and wil!help make vour neighborhood 9 betteronetolivein.G.BE.DULL,County Agent Hurrying the Tax Bill. General debate in the Senate on the $2,006,000,000 war tax bill virtuallyendedTuesdayandsuchrap-id progress was made on the finanrecammitteeamendmentstotheHousebillthatleaderspredictedthe /measure’s passage late next week‘Senator Simmons announced that heexpectedtoasksoonforatimelim it on debate and also to set a dnicforafinalvote.Senator LaFollette made public »|minority report,concurred in|Senators Gore and ‘Thomas,urrinethatthebulkofallwartaxesbelaidprofits.An effort to haveprofitsincreased ja mot o row | he restful to it food blue-( lestroy ‘ sure ©as the : of Ne changing ~~" bodied men, “ang |ow ys ”A Sage, ’w teaspooniul "foul,constipated was ho 4 ach-ache,d *meni ¢healthfat by | Various persons asareallegedtohavePresidentandtheickoryRecord,Itordfurthersaya,that made Hichory men andedwithhimsaid he seemedquitealotofinformationjotted in4notebok, Accordin k the govern- ing with agitators and persons ex-Pressing disloyal wentiments aboutthewar,has deeided to deal vigor-ously with maleontents in fature.A correspondent of the NewtonEncerprisetetlsaboutahanti-draftmeetingatPleasan:Greve schoolhouse,Catawba eounty,Saturday tignt.About 200 were present,butnotnearallofthemwereinsympa‘ny with the meeting.The corres- bencent says: “Aftor appealing to the audience tnrce times,Lem Shuferd succeeded m clecting ,Authur Bridges chair-ni ind explained to the crowdthathecalledthemeetingtogetthescitimentofthepeopleontheselec-tive draft aet.Said he cid not believe tic Presiaent (who was «man whoivmpedfromoneconelusiontoan-other and whe ran so fast old mencouldnotkeeppace),knew the senti-ment of the people;that Tom Wat-eon would test the constitutionalityofthedraftaetintheSupremeCourtandthathewouldtakeanyMonceyanyonewishectosendTomWatsonforthispurpose.CurtisHilton,at Helten.Bros,store,hassolicitingfundsforthispur- poss and sending te ‘Tom Watson,anc woen |learned that poor work- ins inen on the farms of the leadersofthismovementwerecontributing, neart went e@ut in sympathy to tne iynorant men, ‘Rod.Shuferd had a petition Treading to this effect:‘We,the un- ined,eppeal to trongrress to re- boat the Conscription il and we askfoefroepressand=free speech.’ About 60 people,we learn,signed th petition.” ——en ee eee DROWNED IN CATAWBA. Ci,de Sigmon,19-year-old son ofottSigmon,of Catawha couniy,drowned in the Catawba river,half-mile above Gxtord ford,latedeyafiernoenandthebodywas covered a few hours tater.In com- with two ether vo.he was ining in the river and wot beyond depth.His companions were un- le to rescue him and he could notim oer fie 8 em eeemo Any One Who Bas Used It. Wiles vio atways atm to keep amberiain’s Collie and Lx nh etme Aah teitnbtlity,ask an tet eeetatennerineetemeedttiemeadete \CHILD'S TONGUE SHOWS IF LIVER OR BOWELS ARE ACTIVE! If Cros-.Focerish.Sick,Hilious,Give Fruit:Laxative af Once. Every mother realix:after :tileren “Catiforr that this is their ative,because they love its pleasant taste cni it thoroughly clear the tercer Tittle stomach,liver and bow- ts without griping. When cross,irritable,fever h,orbreathistemachsour,look a‘the tonguc.mother!If eoated,give of this harmless “fruit vid in a few hours all the *sour bile anc piv- Syrap raat Tax. bad, laxative,” undigested food passe oul id you have a weil,child agai.When its lite is full of co!I,throat sore,h arrhoeea,iie-—romember,a 2 ing”should alwys 'miven, Millions of mother *nin Syrup of Figs”| 'a teaspoonful child tomorrow. for a 50-cent Syrup of Figs,”which has dizections fer babies,children of all ayes and grown-ups printed on the bottle.Be-ware of counterfeit sold here, don't he fooled.Get me iuine, made by “Californias Pie Syoun Ca.” --& Py .“FOR SALE. Two high-cla farm f reres cach,} orm muniti necessary outbuild excellently adn markets ,mail “California 80 ,bighway of neartybothsides:about 1chidingpasture,remaind 4-room tenant housOtheralsoontoy cultivation;wired for2°aeres fertite,h.emesect! occupancy by ownenerifier,but price at {.sonable.Wf nterested,under thease conditions, nee or address RK.BR McLAUGHEEN,Aug.3 Attorney. The Brady Printing Co. Has taken over from R.P.Allison the agency for various Magazines and Book Publications and wants your orders for sub- scriptions to Maga- zines of all kinds,Will order any book wanted. All Magazines on coun- tersoon as out. talk-—have Lixten to me!take no more sick- ening,salivating calome!when oil lous or constipated.Don't lose a day's werk! (alomel is mereury or quicksilver which enuses necrovis of the hones.Calomel,when it comes into contactwithsourbile,crashes into it,break-ing #up.This is when you feelthatawfulnauseaander:mping.Hf you are sluggish and “all knockedout,”if your liver is torpid and bew.els constipated,or you have head- ache,dizziness,conted tenene,if {th is bed or stomarh our,jne posafal of harmicoa °Dog t Liver ‘Tone. tere’s my gwuarnnt stay 4 pet a Dedsen’s Liver yoootul tovight and it itVaigedenyourightup ;you fee fine and vigoroustag,LT want you to go back stere and get)your .Liver Tone is destroying thecalome!beeause it is real liver metecine;entirely vowetable,therefore itannotsalivateormakeyou{guarantee that one o ofVedson's Liver Tone will pat yourluoggiehlivertoworkand¢ieunyourbowelsofthatcoorbileandronctipntedwastewhichiscloggisivoystemandmakingyoufersbile!mvarantee that @ fol.of Dedson’s Liver Tone will keepontitefamilyfeelingfine.forthe.Give it to your ehildren.havimles.;doesn't gripe and theyrtLagle, ri “Far S ior to“Old Fashioned Halle” writes Mr.M.D.Irwin,Lawrenceville,Ga.He says “IhavebeenfeedingBuckeyeHullssincetheyfirstcameonthemarketandwouldhavenothingelse.Fed inquantitiesIconsiderthemfarsuperiortotheold- CKEYEHULLSUNTLESS are superior because they are 100 percent.roughage white old-fash.ioned hutis are one-fourth lint which is worthless as a.Theycytake hulls.” cost several dollars less per ton.They come in sacks.half as much space for storage.Try them, the best results and to the en oder,wet theTosecuredevelopsilage£tc as much .it is easytojorthenextfeeding.If at anytimestthirtyminutes.prefertobybulkasofold Bookof Mixed Feeds Free the t formulafor every combinationoffeeds used in the South.TellsGivesrigh:lor every com!how much to feed for maintenance,for mili,for fattening,and gives directions for using theycopytonearestmill. work.+,Send for your bet.k TheBuckeye CottonOil Co.vem.ice=Sa” Simple sanitary Come andHALL’S ee: ———————= i 'i 4{ Vy Tronks, Steamer Franks, Suit Cases, Hand Bags, PHONE 83. SHERRILL-WHITESHOE CO, OE.er ote epee DRUG Phone No.29, reene oes ee T«UNKS,SUIT CASES AND HAND BAGS. aed We have just received a large shipment ofTrunks,Suit Cases and Hand Bags. Nowif your vacation needs requiresaTrunk,Suit Case or Hand Bag,it will be to your advantaye to give us a look before makingyourpurchaseinthisline Wardrobe Trunks,$20.60and $25.00. “FREE” -—-—-AF :Halls D-ug Store,to every man one” Sharpe Safety Razor. The fdeal Army Razor. ‘The ®conomical Home Razor. The 100 per cent Efficency Razor. The Strictly Guaranteed Razor. get yours,STORE, \ “5,00 to $18.50. $5.00 to $8.50, S1.25 to $8.50. 3.50 to $12.50. THE STATESVILLEREALTY&INVESTMENT COMPANY: Appreciates the very liberal patronage of itsfriendsandpolicyholders,both NEW and OLD,Qur office is an open one,and we invite all ourcustomersandthosewhowillbecomecustomerstousethesamewhentheysodesire,As in thepast,we will strive to give the same MMH GRADE SERVICEthathaswonforthisCompanythegoodwill andconfidenceofoverseventeenhundredpatrons.“WE INSURE ANYTHING INSURABLE”and PAY ALLHONESTLOSSESINCASHWITHOUTDISCOUNT.We will be glad to have ou call at our officeforanyinformation,or volaghene No.54 if ourserviceinneeded. We do NOTARYPULICworkalso.J.F.CARLTON,- KS Ft R YOUR Cordially yours, ok aetna wife and children. +wife and chikiren. exempted;wife and child. Fred.arion Feifis,Mooresville;—oined artillery.tler Woodsides,Loray;acrepte waived exemption.' Bennett Pattersen,colored,Houstonville,R-1;accepted;claimeddentwife.red.Albert Lazenby,StatesvilleR-4;exempted;wife and child;Charlie Anderson Morrison,Eufola, R-1;cxempt;wife and children Sancy Yalton,colored,States-ville;accepted;waived exemptiv Robert Tate Setzer,East Monto; exempted;physical disabilits George Norman Sloan,Stat R-h;aecepted;claimed cxemption as ministerial student,Thomas Bat Actin,St ville;exempted;held EK.Vester McDowe'!,sta \ accepted;waived os:! Dave Gregery,:‘A cepted;waived exem Fred.Hyams Des Stat Ie exempted;phy-dix absilat Moses Arthur Beas Me \ R-2;éxempted;wife and childre: Eimer Windell Denn,colored, Statesville;cxempted;ptysica ability. Trey Lee Sherril Moores ille t accepted;cluimed pendent pa rents.Edward Grier Waugh,Statesville; accepted;claimed dependent wit dame Vietor Woodward,States- ville,R-2,exempted:Gepenaent pa rents.Henry Lester Mo stexempted;wife and childrenKarlGradyMason,Mufela,R-! accepted;lnimed dependent 1 and mother Lonnie Gwy vote ”Ne R.FL Dos exempteac; peeysical disa- bility Walter Martin,colored,State ville:aecepted;laimed dependent wif John Washington Show,Harmony, R 3;exempted;phy 1 disability Little Arthur Aneorion,Harme nv;exempted;phyical disability Joha Stevenson,worm,States ville;exemmed;physseat disability. Cout Little,coelered,Statesville (new at Boone);accepted;made no elaim Lloyd Barnes Rimmer,Troutman, Revs wecepteds;waived exemptier W.ade Mitchell Shue,Mooresvitle; exempted;wife and chidren James Row Small,Mooresville: accepted;—¢leimed dependent pa- rents, Arthur Morrison Steele,State ville;exempted;physical disability Alovzo Lee Poole,Mooresville;ac cepted;claimed dependent wife Aarne Leroy Fortcer, Moores- ville,exempted;physical disability Ford BE.Beaver,Statesville;ac cepted;Waived exempt Pacvid Camypletl Cowan,State ville;exempted;wife and mother. John Wesley Bagyarly,States ville;accepted:‘aimec dependent wife and two children, Daniel Lemuel Warren,BariumSprings;exempted;wife and chil dren. Alan R.Anderson,Slaiesviile;ex empted;in military ser ice William Dumas,colored,Harmo- ny;exempted:phy sic “al disability Fergie FE.Stevenson,Statesvill accepted;Made no claim, Fayette Ramseur,colored,Eufola: accepted:mrerarte oO claim, Hilliard Sinclair Boers,colored Stat le,aceepter;ceaimed de pendent wre Oxsenr Lemant ¢ounrell,Moores Ville;exe mpted>Ww er"niberve Hiram Wal “ho rrill,State villes exempted: p!eal disabshits Rugene Tur »col 1,miwood, R-1;)exempted;phy ly disabled Ely Wileox,New Hope;pted claimed dependent wife Melvin Lawrences Pucker,(Vt walt;exempted:physically d Oscar Prerce Caumoubell,8 ville,R-7;exer rh ability.Clyde Walter Sharpe,“usfola.Rod; accepted;no cham Latta C!{fe Com ,Stony:PF accepted;ne elaim, Arch Weaver,Noped,St ville;accepted;ye aem Robert Tee I exempted:wife and ¢ Rufus Fracklin # R.-1 xemp Dastd kt ' Same A i Strate @xe rm pt Preston Tr nt ville,Rot emt \ dam Frar <;\ Hepe,acces laim Frank Hi t.Me« cepted;no clouJohnMa 4 shee tien ' R-1,exempted;pe 't Fugene Hol!ar 0 ef failed to reaper Charlie Marti:My,New How» eerepted;failed to respond Oscar Reid,colored,Statesvilic,R-ce ndFray,|Stato c mee Basrice Davis,Statesville,exempted; we Simons,States-abili4exempted;goes to Fort Ogle- dune Lee Young,Mooresville;ex- physteal dis- .Glaspie,colored,ccepted;ne elaim,:4 .Dunlap,Fletcher Bass,Dunlap William —Alonso ohn Robert Maloney Bufola,R-1; pi.Eastcongotowife.Lonnie Neil Milis,exempted;join- ed Piedmont battery._Robert Walter Srothevteity States- ;Bufola,avcepted; is ;wife and chikiren,colvard wasnttoNorth Wilkesborotoseetosee.’eects a.m.,omen or empteds joined a SHIPSSU:SUNK.4merchantfellewhatduringthetastwntweekinsonycom-ison with the previousweek“slight increase was noted."ieeeteenvesselsofmorethan1,600 tonswerelostlastweekthroughminesorsubmarinesinsonwith21the Ribbon and a great many other under 1100 ton ancient eal things that will be on sale at 5c. Ernest Neal Sloan, Ver non Re .Rash,Olin,exempte:: "oie ‘and children.Wallace,Troutman, Benfield,State_wife and childre: Tilley,Olin,e% ote..Olin,R-!. Pon't take chances on curing your |)MRS.MARY SIMS. Tobaceo with old flues,for the |TheCashStore price of Tobacco is the highest this year in history. seek parents. rres 1 to:Charlotte, We can make you the best price necepted;wife. ,Statesville,R-1.;physical disabiltty.,Harmony,R-2,ac- ‘phone us.We can make delivery the day you order! STATESVILLE TIN CO. ‘Phone 55,114 E.Broad Street. »and children. Laan,Statesville. \rthe r Shook,Eufola,R-1,e. ical inability. Twenty Threeohud been “summon ;nobody wants a slack Tire. Unless you keep your Tires re- paired you have a slacker with you at all times. THE IREDELL VULCANIZING i &SUPPLY COMPANY. |Phone 201 Court Street. om failed to pass Manlius Gaither. 16 who passedphysicaldisa- Untrimmed,nothing reserved for anyone.Come first and get choice.We alsohave a ficeline of Collars, BabyCaps,Children'’sMiddyBlouses, 4t Don’t miss this opportunity. C.WA .| SLACKER Tires and Tubes in Has stood the test of time.We have a full line of Chattanooga Walking _NoTic E TOC REDITORS.‘|Plows,also repairs.qualified aa administ of the McDuff Ag bur y. Sympathivers —Mr. Kesler’s Position. ympathized with te Albert Houpe,deeedsa 1 hereby ivi... In Bottles5c. plows without leaving it cloddy. cons havine claims avainst his| “ath a the poe ck i “I Iredell Hardware Co. FRED DL.HOUPE,{ vehi,Atty Administrater,| subscription date futher had to learn to arts to se"ho 7 in lisloyal citizens an! ABOR FEDEK ATION. Elkin Blankets —ALSO— WOOLNAP BLANKETS Ready for early selling at prices that cannot be duplicated later in the season. We have them in White,Tan,Grey and a beautiful range of Plaids at $2.00,$3,00 $3.50,$4.00,$5.00,$5.50,%6.00,$7.50 and $10.00 per pair.All fresh new goods. Yours truly, Parker Guns. i EMONS W HITTjfTI: ber Your Face, of wood and metal,to insure perfect ba ntaini ne three N.Y.Salesreoms,32 Wenen SwekStreet.lotion will keep jvice is used to and.he autifier.';Ge aneee ouncesivaldisability.orchard white at t vrrent,Olin, weetly fragrantmassageitdaily into the fans,arms and hands. rough,red hand and chitéren, ee crenata eceeatnetaen messi i _ Wear well because they are made of the best material by the most skillful craftmen. Shoot well because they hold the charge compactly together at extreme ranges. Handle well because the greatest attention has always been paid to the distribution ost progressive sportsmen. rt @ waruime,(Salt ,. This is the disc Plow that gives universal satis- faction.It leaves the ground in splendid cor- dition.Will break harder ground than other ‘Myig er a 4 aa MILLS &POSTON. Wear Well.Shoot Well.AndHandleWell lance and the most symmetrical outline. Twenty-bore Parkers have set the _=ce for small bores in America,and are grow- ing in popularity every year with m For further information regarding guns in gauges rangingfrom 8 to 23,address, PARKERBROS,MasterGun Makers,Meriden,Conn,U.S.A. ‘Those Who Know Better’KilnDried Flooring,|[5,00ttsuouae ‘Than C.WATKINS say tumter Collie,Base,Case and eck,Won't be cheaper for many von Meal.my ShingleKing of Ire-marvelous " wars,or no wars.SO BUILD NOW! RED CEDAR SHINGLES! |Nails,Ridge Roll,Valley Tin,Brown time.'The Landmark makes t with regret —regret that oceurred and for its possible con- nees.Mr.Stikeleather is a antial citizen or nis communi- well regarded by his vriends and ora.The only explanationisthathedidnotappre-the seriousness of such talk. Dr.Nicholson and Mr.Stike- er had gone to their homes in Iredell when the report got .An attempt to get a state- from Dr.Nicholson by "phoneHesaidhewouldtalktoThe ndmark when he came to town to- BOARD HEARD 78 CASES. Work of District Exemption ;Board at First Session. |The district exemption board,at ‘its one-day =sessi in Statesville t week,passed on 78 applications 18 counties and two cities.Of31wererefusedoutrightand granted outright,while seven granted partial exemptions,two excused because they were al- y in service and one appeal was Qne case each was heard from An- and Mecklenburg.The Anson was refused exemption, lecklenburg man was exempted. |In Burke two men were exem ‘po long as they continue in i gent business agriculture. E ,E.L.Pickens,is an agricultur- al extension agent.Another Burke man got exemption,another failed ‘and the appeal of one was dismiss- ed,the papers not being properly 'made o oa cos thes ut. |Three applicants from Cabarrus “were exempted.Three Forsyth 'men were exempted and two granted |reprieves until November Ist.This time was given them to initiate new |men into the jobs they now hold. One Gaston man was refused and another exempted because he is al- 'ready in the military service.The one application from Guilford met no favor and was refused,while the three from Lincoln were excused. Eight applicants from Montgom- were excused,while two were ;‘used.One applicant from Polk was ref:;another given until |January Ist next to enlist. Two Randolph men lost,being re- fused exemption.Two from Rowan -were excused and one from Stanly refused.-One man from Swatn was refused, >two excusedand the case of one sent back to the local board with recom- |mendation that he be exempted.One |excused is in the naval service. ‘Five Transylvania citizensnrefused. wereOnefrom from F fate, 'while two from that county were ex- cusedThe one Asheville man considered was allowed to go until June,1918, he will graduate.Four Winston -Salem men wereOnewasexcus-1917,and one Of the eiexemptedand three refused exemp- tion.Therecords of the boardatthis session were not made to show claims of applicants,or whether the appeal was from the individual or behalf of the government in each what the decision of the lo-So that the showing sonotgiveabasisforanopin- the policy of the districtcauseforexemption,It a p a q e z e g s n i h af gh g 8 i i 27s publie this |¢ the |4 STATESVILLE,N. acegped;no claim.Wil Thomas Christopher,Statesville,exempted;wife and chil- ren.Palmer Alexander Morrow,Eufo-la,R-1,exempted;wife and child.Herbert Herman Pope,Troutman,exempted;wife and children.James Hart,Mooresville,accept- ed;no claim.ThomasStatesville,exempted;child.Clarence Pool Abernethy,States-ville,accepted;wife.John Moose,Statesville,exempted; ——egpliy.ander Washington Sharpe,Har-mony,meanness physical disability.Louis Luekey,Troutman,exempt- ed;wife and children,William Andrew Heath,States-ville,R-6,accepted;wife. Mert Copeland,Statesville, cepted;no claim.alter Clarence Gibson,States-ville,R-2,accepted;no claim._Davidson,Eufcla,accepted; wife.Roy owe Church,Statesville, accepted;to appear.Charlie Wilson,Tosccutns,ac-;no claim.alter Davidson Brown,Moores-ville,exempted;wife and children.Clyde L.Williams,New Hope,ac-—no claim.rrison Nicave TroutmanStatesville,R-3,exempted;wife and children.Otis oe ee ieHarmo- ny,exem ;join army.Thomas Everett Cash,Statesville,accepted;aged parent.Jason Reid Jones,Troutman,ex-empted;physical —a.ylvester Campbell,tatesville,accepted;aged parent.James Frank Brown,Mooresville,R-1,exempted;wife and children.Jubal Ranson _Statesville,exempted;wife and child.Robert Graham Jonnston,Moores-ville,R-f;exempted;physical disa- bility.Mason Edgar Brown,Troutman,exempted;wife and children.Chas.Sylvanus Johnson,Eufola, R-1,accepted;wife and aged parent.Odell Alexander,Elmwood,ex-—physical disability.arvin Stimpson Campbell,Statesville,exempted;wife andchild.Carl Walter Sharpe,Harmony,R.F.D.,exempted;physical disability.James Samuel Overcash,Moores-=R-5,exempted;wife and chil-dren.Vance Hosuton Mayhew,ville,exempted;physical disability.Royal Gwaltney y,Olin,ex-em ;wife and children.Charles Dobbins,Olin,R-1,empted;wife and children.oward Gregory,ivoresville,R-5,exempted;wife and child.Charlie Leon Brown,Statesville,exempted;joined Iredell Blues.Wood Hayes Powell,Harmony;transferred to Washington,D.C.Clyde Graham Bass,exempted;wife and child.William Harrison Wooten,States- ville,R-4,accepted;wife.John Martin Barringer,ville,exempted;joined cor Jefferson Troutman,wife and ac- ce Moores- e@x- States-hospital uck Long,Statesville,accepted; no claim. Clayton Campbell Somers,,acce ;no claim.a Pte om ar =R-1,ex- empted;ysieal disability.niel Luther Ritchie,Dcsceville,exempted;physical disability.James Carson,Jr.,Houstonville,exempted;wife and child.Leroy Caldwell,Mooresville,‘R-4,exempted;wife and chiidren. No Prosecutions in Catawba. Mr.now a »ss t spec t investtheCatawbafolks New Statesville, YoungStatesville OfficerberofaPartySenttoFranceForStudy. John A.Seott of Statesville,whofromtheofficers’ Mrs.J.Scott,atHewillreturnto Statesvweekandremainhereuntil hisigforFrance.The portwhichhewillsailandthetimedeparturearenotmentionedforobviousreasons.The three batteries of field artil- lery at Oglethorpe furnishforoneregimentofartillery in thenationalarmy.Fifteen mentheseventhbatterywereselected toa.for study and -,Lieut.Scott being one of them.The only other artilleryman fromthisimmediateseceon,goesabroadisJ.Edward Johnson of Da-vidson,who was a member of Lieut,Scott’s battery.Infantrymen willalsobesentandtheentirewillnumberabout150.First Lieuts,W.M.Jones and A.G.Robertson ofCharlotte;First Lieuts,W.T.O’Don-vhue and W.P.Beall,Jr.,and Sec-ond Lieuts.C.H.Stafford and R.H.Starr of Greensboro will be mem-bers of the party.An announcement from Washing-ton says that immediately on the ar-rival of these officers in France theywillbeginintensivetrainingunderthedirectionofMajorGeneralPer-shing.The plan provides for estab-lishing an officers’school in theAmericanarmyarea,where they canbegivenintensiveinstructionsimi-lar to that being given the regulararmycontingent~In addition some of the young of-ficers may be sent to French English officers’schools,asgiovernmentshaveexpressed their willingness to undertake aateworkofthatnature.e of theyoungofficersalsowilbeattachedtotheregularregimentsnowinao——oe have8ienttrainingtheymay ———ve ney =Rg the merican units a whosewouldbeofvalueinhe may ~ w armies at home.It is possible30thatmanyofthenewofficerswillbesenthomeas‘tnstructorsassoonastheyhavecompletedtrainingcoursesin5Itistheunderstandingthatthe training course in France will in-clude not only study in seheol butstudyandobservationofactualop-erations at the front.It is quite acomplimenttoLieut.Seott that hewassélecedforthisservice,andthosewhoknowhimexpecthimtomeasureupfullytoexpectations. Items About the Soldiers. Lieut.-Col.R.L.Flanigan,who went to Shelby last week to take charge oftheFirstRegimentintheabsenceofColonelGardner,has returned home.Col.Gardner did not have to be away as he expected.Dr.R.A.Campbell,captain in themedicalcorpsoftheFirstregiment,is located at Hickory as examininsofficerfortheFirstregimentuntilthe regiment is sent to Greenville.Mrs.Campbell has joined Capt.Campbell!in Hickory.fckory,says the Rec-ord,is the receiving station for re |cruits for the First regiment.“UndernewordersoftheWarDepartmentthestrengthofeachcompanywillbe increased from 180 men to 250 anc the number of officers will be doubled.”Mr.Frank Brady,son of Mr.andMrs.J.A.Brady of Statesville,isnowamemberofCompanyM,31stMichiganinfantry,at Jackson,Mich.Mr.Brady was working for an automobile company at Detroitwhenheenlisted.Mr.John Martin Barringer ex-pects to at Charlotte the first of September for duty in Dr.Breni- nm a officers|Monroe,Biscoe, and|install a new recouaniaes jrvents,Mr.and Mrs.T.J. zer's hospital unit.Wriston Scales,son of Mr.and |Mrs.John L.Scales,formerly ofStatesville,now of Charlotte,is a radio electrician in the North Caro lina Naval Reserve.He last May. Cowles Boys in the Service.| Cadet Miles Cowles of Statesville,|son of Mrs.W.H.Cowles,is a member of the class that will grad-|uate at the United States MilitaryAcademyatWestPoint,N.Y.,next| week.class was due to natein1918butisgraduatedayear|ahead on account of the war.W.H.H.Cowles of Wilkesboro,| an older brother of Miles,was lastweekcommissionedsecondlieuten- ant in the Coast artillery service.he having been in training at Fort Mon roe,Va.Mr.Stuart Cowles,a youngerbrotheroftheabove,mentioned,haxbeenappointedacadetatWestPointbyCongressmanRobertsonoftheseventhdistrict.Young Cowles graduatedattheStatesville|school lastspringandwillthisfallenterSchad man’s Military School in WashingtontopreparefortheWestPointen- trance examinations.If he passes al!=he will enter West Point next une,AT PARK THURSDAY NIGHT. -"band will a concert .os to'clock and the te CivicLeaguewillsellrefreshments.Admission to the grounds will be..TheconcertwastohavebeentonightbutiepostponedtoThurs- for a little out-for the quodwork enlisted | and it is . Civie ;for three months, ‘ly emgaged in ©.TU ESDAY,AUGUST 21,1917. reroenemuaaasDOLBOARDBORROWS. pte RupeesatSee For Colored School +The Teachers. t a meeting of the city schoollastweekthelistof the next school year,presenbySupt.Thompson,was fo 4 y Former teachers re-clected are:Ethel MeNairy,Christineive.Marea Jordan,Cora Belle,Annie Terry,Margaret Wil- Sara Rutledge,Mary Wortham,ie Glenn,Jo.nn,Nelle Arm-,Mamie Eaton,Ma P-;Mr,M.E.Yount,pal.isses EthelwTeachersMontgomerycoun-Thessa Jimeson,Garden City,well county;Allene Curtis,rty,Randol county;Beulahur,Concord;Janie Tuttle, ville;Nellie Hines,Pelham, on county.e new teachers succeed MissesJessieMassey.Clyde Fields,KateFinley,Ellie Grier and Bain Hender-who declined re-election;_andMattieMcKinney,who accept-||declinededre-election and later bTeachersForColoredSchool—Re-becca Gaston,Alma Carter,Bessie McLean,Abignt ,Bevestte,Cc W.Foushee,principal.At this meeting the school board adopted «resolution to borrow $20,- to carry out the programme ofingandrepairs.A part of the=,has already secured.thousand was borrowed fromtheState’s educational loan fundandthecountyschoolboarda-priated an =$500 pow ~amepurposes.e money r- rowed as needed.,The board has closed a contractwiththeCharlotteofficeoftheGén-eral Fire Extii r Company totiandventilat-be plant in the street schoolIding.The work is to begin atonce.The cost will be about $11,-000.New plumbing wil!also be in-stalled in the building and the wallsceilingwillbecalcimined.It ispurposetomakethebuildingcomfortableandsanitary.The colored schools wiil open inquarterssimilartothoseoflastyear.It is the purpose of the board,however,to erect a new building forthecoloredschoolassoonaspossi-ble.The plan is to supplement therancemoneybelongingtothe—$8 —withabout$5,000 of the money borrowed,and erect the new building for thecoloredpeople.The board also contemplates com- pleting the Davie avenue scnoubuilding,some of the rooms there being unfinished. Pythians to Honor Soldier Knights. The local Pythians will give a smoker at their lodge rooms Thurs- day evening in honor of their mem-bers who have entered the militaryserviee..Refreshments will be serv- ed and all Knights,visitors and mem- bers,are invited to attend.Short talks will be made.The Pythians who join the fightingforeeswillbegivenareceiptforall!dues during the period of the war. That is,the soldier Pythians will not be required to pay dues while in themilitaryservice.Eighteen members of the local lodge have entered the service and some of them are now in Statesville on waiting orders.It isexpeetedthateveryPythianwillbeonhandtoextendbestwishesandGod- speed to their brethren who have answeredthecountry’s call. Enters Army Service as Major. Mr.Wm.L.Allison of Chicago,Ill,arrived Sunday to visit his pa- Allison, and other relatives.He will leave churchomensireCha.A. tomorrow for Chicago. Mr.Allison has been commission.| ed a major in the infantry service|f the regular army.We entered the|ficers’training camp at Fort Sher-|idan,FL,in May and was in trainingwhenhereceivedhiscommission,On the 27th of the lineis to enter on his duties.Mr. |.on £7 _|\llison has been in business in New!nher York and Chicago for several years; the latter city for the past few) vears,Where he has been successful-| the railroad in business, Dr.Talley Offered Position.| Statesville friends of Dr.and Mrs.| B.C.Talley of Bennettsville,S.C.)will be interested to learn that Dvr.|Talley has been offered the position|of afeistant veterinarian in NorthCarolina.Dr.Talley had volunteered and passed examination for serviceintheVeterinaryReserveCorps.of the y and did not accept the offer by.alley practiced his profession in Statesville until he went to Ben- nettsville two years ago.Mrs.Talley was formerly Miss Mary Colvert ofStatesville as BOARD MEMBERSPENITENTIARY.Dr..8.J.Bernfeld and Louis 1 C ,indicted members of exemp- tion &No.99,New York city, y entered pleas of guilty 1. e conspiracy to obstruct t ara eer when they were about to be placed on trial.They were sentenced to each in the Federal at Atlanta.eee et oethe“All the townthose RETIRES FROM MI Y. Rev.C.G.povgett,Speveeet Rector,Will Give UpWork—ChurchNews. At a meeting of the Ladies’Mis- sionary y afternoon at 4.30,talked to theladiesaboutmissionworkinChina. BRIEF ITEMS LOCAL NEWS oil late corn is needing rain toe 1Gilbert has the Farm Loan and those interestedmay securethem of the First Baptist|from him..T.J.Congerlastweeksold.P.Fox land in Shiloh town-.&.J.Helland. pee Bun,begin «er —The Crescent ciety chure y,26th,at a.=‘on.dL.will be assist-|Iredell ed by Rev.D.W,»At Trinity iscopal church Sun- lay Rector C.G:announc-ed to his congregation that he wouldseverhisconnectionwiththechurchOctober1,would leave the dioceseandgiveuptheministry.Mr.Pros- peri has not decided definitety what)/. he will do but he will engage in sec-ular work,He has been with Trini-ty church as rector for the past five months.When about half way through hissermonattheunionserviceattherirstPresbyteriancaurchSundayevening,Rev.J.H.Pressly becameilandhadtodiscontinue.er ion was immediately dismiss- Presbyterian church nexteveningDr.Chas.AndersonpreachatthelastoftheSundaningunionservicesYortheStreetMethodist,First Presbyterian,First Baptist and First Associate Reformed churches.Rev.J.M.Clark will preach at theFirstPresbyterianchurchSunday morning. eve- meeting is in progressyy”A atNorth Baptist church,ial dreds of ministers and laymennd“5on homes from the con-erence new purposesalongthelineofcouaaltetle activi-ty in their churches.”— The teachers’institute in sessionattheresumedworkdayafterFridayforweek-end.three grry,intermediate and hi the ,arevroceedingwiththeirregularwork.The present enrollment in the entireinstituteis156,There will be patriotic opening ex-creises tomorrow menaing.and Fri-lay,the closing day of institute,an educational meeting will be held,with a number of addresses.Prof.J.H.Highsmith,who is conducting theinstitute,will be principalEverybodyisinvitedtoatte iexercises and the committeemen of the county are especially requested to be present.There will be a special meet-ing of the committeemen,at the coun-ty superintendent’s office,Friday morning at 11 o'clock.There are about 40 in attendance atthecoloredteachers’institute,whichixbeingheldinthecourthouse.Prof.Cc,W.Foushee,principal of the Statesville colored schools,is con- ducting the institute under the direc- tion of Prof.Highsmith. Recruits Wanted For the Blues. Capt.Westmoreland of CompanyEhasreceivedorderstocontinuere-ceiving recruits.Recruiting for thelocalcompanywasrecentlydiscon-tinued,but it is now understood that each company will be increased to 250 and more men are wanted for the Iredell Blues.This offers,a good onportunity to get in the ranks ofthehomecompany.Recruits acnreporttoCapt.Westmoreland or to he officers in charge at the armory,on west Broad street.Capt.R.A.Campbell of the regi-mental medical corps,who is sta-\tieoned at Hiekory as examining offi-|hoys had a :..:eat n.|cer:will come herejmonthhegoestoCampGrantinTl-|ime to examine recruits .from time to The Blues yesterday received a of new rifles and other equipment for the company is ex- pected within the next few days. supply ‘SOUTH RIVER HOME -COMING.)Johnson and Jno.L. Home -coming and Children's Day at South River Methodist Epis- ‘opal church,Scotch Irish township, Rowan county,Thursday,August 80,beginning at 10 o'clock in the morning.ere will be songs,ex- ercises and addresses.The public is cordially invited and especially for- mer pastors of the church and for- mer residents of the vicinity. CONCERT FOR TEACHERS. Mr.Karel Bondam,director of music et Mitchell college will give a concert in Shearer Hall tomorrow evening at &o'clock,complimentary te the teachers attending the teach- ers’institute.The public is cordial- ly invited to attend.The concert is free._ VETERINARY HOSPITAL. Dr.C.L.Cruse has bought from the Henkel-Craig Live Stock Co.the L.C.Deitz blacksmith shop and va-cant lot on Water street and will im- mediately erect a modern veterinary hospital and equip it for treating,horses,dogs and cats, HELD CONSTITUTIONAL. In a case in“we -yee JudgeSpeerthelawconstitu- of to present. Peal,Phewaecase waspresented by gy °F e £ a>.i #8 ie“2 g wm = ==°i f i :i =5 and zeal}land nner Horace Smith and hisweekwerestruckandSoutherntrainatthe crossing in westo'clock Saturday night.killed lasiaet,his bodylymangled.His wife was a local hospital,few hours later.Rutherfordton,whereriedaweekago.ing relatives in Gastonia. |THE SCOUTS IN CAMP.|Scoutmaster C Alexander andabout20ofhisitsreturnedFri-|day night from Hiddenite,where\they spent a few days in camplintrampingaboutcountry.|good time and those inchargeoftheDavieSprings,where ithe Seouts tarried,say the States-|ville boys were the nicest bunch\they have had.|cinleapennesepenener ETRE|STATE COUNCIL JUNIOR ORDER.Messrs.W.T.Nicholson,N.‘Milhol!will|represent the local council at the|meeting of the State Council Junior|Order United American Mechanics,;which meets at Asheville today.Mr.|C.B.Webb,former State councilor,|who eame home from Washington|Saturday night,will also attend the|meeting. TO DINE WITH MR.THARPE.Mr.Chas.C.Tha wants all the|men accepted on the draft from EagleMillstownshiptocometohishousenextThursday,without fail,for din-|ner.Mr.Tharpe to show the|men from his this courtesyibeforetheyareintoservice‘and The Landmark will add that the|guests may be sure of a good dinner. PLAY AT WINSTON-SALEM,The -Salem 2“Mr.HarbinMr.eM Gastonia,cornet-ists,and Mr.Barkley ofcinsistanceimte.sraste atstrationFridaynight ne He en re l ]i zgi gz in ,! SFj zg izei fi : |Zi ,:|to have the names of scores of with tiwhoagreedtojointhecovalent—oe corelandthesewillprobablybebroughtialDistrictboards “|promptly to local boards those whoNavyCutsLeague..|¢laim no exemption but they should-also act promptly on the cases ofa”er nee those >do gm qxeanption,andnaespecia’on eases of personsbeenseveredbyorder"Becreta:of obligation is early.Fe fef ; to any naval stationorship,andthat | i zi ie ofthecountryare knitti sweaters,|5 ——.This notice means that these pence sure to be within the quota.not “be accepted unless tendered The same will be true of the 30 percomesomeagencyotherthanthecent-to be furnished on October 3.presen officers of the league.The last 10 per cent.must be select-ed with great care to be sure that noLosePatienceWithSuffragists.,,...in the whole quota is sent forContinueddisordersinfrontofthemilitarydutywhileaselectedper-‘White House as the result of “picket-son with an earlier order of obliga-ing”by militant suffragists,caused tion for military service is allowed the Washinton police to put into ef-to remain at home.fect an order prohibiting further dem-onstrations.Six of the suffragists |MessageofCheer From England arrested were sentenced to the work-A message of hope and quiet con- house for 30 days.t fidence in the future is given to theAasailingtheconductofthesuf-British nation by Premier Lloydfragistsinunsparingterms,Senator George,in the House of Commons.Myersof Montana introduced a bill to|The people of the British Isles can-prohibit White House picketing.jnot be starved,notwithstanding the“The proceedings have been out’German submarine campaign,andAlousandalmosttrea-jthe military situation grows morele”he said.“I think people|hopeful.The difficulties of the al-are disgusted with the proceedings.lies will grow less and their power The President,out of the generosity|increvse,while the troubles of Ger- i of his heart,pardoned the women re-|many will increase and her powercentlysenttotheworkhousefor60fallaway. days.I think he erred;they ought!“This is the supreme hour for pa-to have been compelled to serve their tience,”the premier declared in con- | to stop these insults to the President.”for hope,for unity.Let us go—_—|through this hour with a temper thatCarstoMoveTroops.will enable us to destroy a great‘:‘military despotism.Let us =goAnideaoftherailroadequipmentthroughthishourwiththeoldtem-required for the movement of troops| may be obtained from a statementbythe quartermaster's|corps and distributed to the rail-roads of the country a special|committee on national defence of the we shall begin,and the world shall begin,to reap the fruits of our val-or,” The stock of wheat in Great Brit-:ain has increased by one-third with-—Railwa —900 in a year and this year’s harvestmereaneOyeepromiseswell,but economy still is oeigpegge |of a Sey oe necessary.German claims as toa8,oar i -a id British shipping losses,the premieraweiesmecanyceaesaid,were exaggerated in the hopeShpiudantryatoneacheofcheeringupthepeopleoftheCen-loon total of 6,229 cars made tral wers,Although the subma-ta 366 trai ith lo.Tine losses in April had been 560,000upSeon6.229 =eae fe tons,they had decreased until the ‘of 9116 one gan average for July ane August wouldmadeup.a,or Shipbuild-be 175,000 tons net each.77 »1,055 box,1,899 stock and ing had been speeded up,vessels had—purchas rst and _.=Tile Pein tal tonnage acquired in 1917 woukRecruitingContinues.reach nearly 2,000,000 tons.The pre-War volunteers for the regular;mier said he believed the lossesarmyhavereachedatots!of 190,347 would grow smaller and that the ad-men,bringing the roll to 7,000 in ex-miralty had met with success in com-the authorized war strength.|batting the submarine menace,whilethetotalfortheex-|measures taken by tne shipping con-army was filled several days|troller had permitted vessels to car-its bape —te enlist "y increased tonnage. a day.They will be needed and the Preacher Held For Trial.recruiting service will not relax its Rey.H.F.Wolfe,Socialist preach-efforts.There still are 25 States or,arrested for preaching seditionhavenotsuppliedthenumberofhadahearingbeforeUnitedStatestedtotheminthedistribu-Commissioner Nichols in Raleighthetotalquotabutsomeof|and was required to give $5,000 bondotherStateshavefurnishedtheirforappearanceinFederalcourtquotaseveraltimesover.Wolfe is from Ohio.Rev.D .A.asay talale™waa peaanaae Long appeared as his counsel.Dep-John W.Kern Dead.uty Marshal Sturdivant,who heard.John W.Kern of Indiana Wolfe's preachment,was the prin- 5i ; ts E th saying,among other things,|that the worst slackers would bewasacandidateforthosewhowouldgotoFranceand“get shot in the back.” uraemic poisoning.:fi <§ mB 5 f :=2Bryanin1908.e was afterward _Dr.Long charged the deputy,whoeetotheSenatefromIndiana|i8 an ex-preacher,with being drunk|was the Democratic |in |and argued that Wotre was off men-that at the time of his retire-|tally.He was indignant when Com-—ae March.{missioner Nichols decided to holdbeenundertreatmentinbotsfortheFederalcourtandontoriumforaweek.|account of some of his remarks offi-summer home at Ces suggested that he be put underterment.Wife and |arrest.Commissioner Nichols,with him.j|however,decided to let Long's talk—|pass.ACON AND BERNARD.SSSRPais&thins of rate |Camp Commanders.was inspector of the State!While at Camp Sevier,Greenville Ht 3s ze e : zi EA 8.C.,the North Carofina t will|be in command of Major J.F.Mor-‘ational rison of New York.It is stated,however,—=arrangement is_temporary t another,proba-bly a North Carolinian,will be as-ees to command later.jor Gen.Clarence Edwards ofOhiowillcommandatCampGreene, ”General Edwin ForbesGlennofNorthCarolinawill.Sherman Ohio.a Hi:ef il Ht Hi d , HE é | wl tr | ;:18 “S F E ia t it n 4 a3i i et l ri t i s e >datedchewteomeakarealthou:e case oexplosionatMareIsl-|persons of prior obligation are stillandnavyyardwasbeingblockedby|pending in the district doard,buttheinfluenceoflaborinterests.great care must be taken bythe lo-secretary gave notice to the eal board to send ne one to military uty whose order o igation is sowouldbeadmittedhereafter|iate as to make it improbable thatjwillbewithinthetotalquota.accepted By September 19,when the secondleagueasatcallismade,there will ve enough ap-managed.pealed cases and cases within thewomenOnewentere,exclusive jartediction of the diatriet:eB.|ec to ma*.¢up the sec-wristlets and other articles for sail-on 30 per cent.from men whose or-ors under the euspices of the navy der of obligation is early and who are It is time Congress acted ;clusion,“for courage,for endurance, ile Friday neght,death -_witness.Wolfe was charged| w fi l ontana and Idaho,unless certaindemandswerecompliedwith,is re-garded as being political and not alabormovement.Instructions havebeensenttofieldworkerstodeter-mine,in so far as can be done,whether the threatened strike ispartofaprogrammedeliberatelyatohamperthegovernmentintheprosecutionofthewar.Dis-trict attorneys in the four States af-fected,us well as in California,Ari-zona and New Mexico,have been instructedtoinstituteprosecutionspramptlywherejustified.Leaders Arrested.James Rowan,district secretary 0theI.W.W.and 26 other allege:members of the organization were a:rested at local 1.W.W.headquarters at Spokane,Wash.,Sunday afternoonbyacompanyofIdahoNation:! Guardsmen and placed in the county jail as military prisoners,Strike orders advising farm worl.ers “to let the fruit lie on the ground” and calling on construction werke:« to lay down their tools have bee:signed by Rowon.“Lumber workersinthefourStatescrealreadyo>strike,”said Rowan.“I think thestrikewillspreadfurthernow,and probally will affect industries irwhichnostrikehasbeencalled.Eventhoughalltheofficersoremployesoftheorganizationareputinjailan:all the halls closed arranzments hav:been made to handle the movement.” EAREE Suggested Bond Issues. Issuance of $7,538,945,000 worthof4percent.Federal bonds,subjectonlytoincomesuper-taxes,‘warprofitsandexcessprofitstaxes,anddesignedtoprovide$4,000,000,000ferfurtheralliedloansandtoretire the $3,000,000,000 non -taxable 3 1-2 ber cent.issue now authorized to cover loans to the allies,is contem- nlated in suggestions submitted bySecretaryMeAdoototheHouse ways and means committee.Loans of $40,000,000 to Italy and $5,900,000 to Belgium were made by the government on the 16th,bring-ing the total thus tar advanced theverofourrace,so that next year allies up to $1,916,400,000. Mooresville Creamery. At a meeting of directors of theMooresvillecreamery,the Enter- prise says the report of the businesssincethelastmeetinginJanuary!! Doors,Windows,Mantels,| Sash Weights andbutterfat,$15,993.82,an average of Cords,Sash Locks and Lifts,Hinges, Pad-Locks and Hasps and Staples.C.WATKINS, showed:Butter fat bought,41,627 pounds;butter churned,48,464 nounds;gross sales of butter and buttermilk,$19,496.The total paidpatronsduringthesixmonthsfor 38.6 cents per pound. W.M.Jamison,G.F.Neel and A.! S.Alley were elected directors to fill vacancies. German Casualties. German casualties reported dur-ing July in the German official lists,|but not necessarily having occurred in July,amounted to 89,863,as fol- lows: Killed or died of wounds or sick-| ness,21,389;prisoners or missing,|14,620;severely wounded,13,896;wounded and slightly wounded,39,-.\058, classes since the beginning of thewarexceeds4,500,000, aoe t planned.|war,le mn man . ’the -|der the bendtenp of bale Gaicountilanovertacthasbeen‘ormed. entire movement,nydeclarationate,|Wash.,of James Rowan,sec-retary of the organization,ageneralstrikewouldbecalledAu-»gust 20°in Washington,Oregon, g5hI Elkin Blankets “WOOLNAP BLANKETS Ready for early selling at prices that cannot be duplicated laterintheseason. We have them in White,Tan,Grey and a beautiful range of Plaids at $2.00,$3,00 $3.50,$4.00,$5.00,$5.50,£6.00,$7.50 and $10.00 per pair.All fresh new goods. —ALSO— Yours truly, BalmMagnolia totakecareof the com-| Cannot be| b stops T:Soothi |mg wee Sample (eithercolor)for |LyonMig.Co.,40South FifthSt.,Brooklyn,N.Y. OSTEOPATII. Dr.S.W.Hoffmann.OFFICE OVER "Phone,279 Green. Locks,Butts,The No man wants his wife to work her fingers to the bone!He wants her to have everything that will make her workeasier—save her time—give her leisure—for this makeshomelifebrighter,happier,sweeter. .Center Sstreet. TOBACCO FLUES. Don’t take chances on curing your old flues,for Tobacco with price of Tobacco is this year in history. We can make you the best price Write or 'phone us.We can make delivery the day you order! STATESVILLE TIN CO. Phone 55,114 B.Broad Street. _—— r xSLACKER And nobody wants a slack Tire.Unless you keep your Tires re- have a slacker with you at all times. &SUPPLY COMPANY. Court Street.| and Tubes in ff The total German casualties of all) PATRIOTIC RECORDS heard on the VICTROLA at ourSoon,Vobonene sn tee ee 1manvolunteerii2eeisservto should hear these Records! oo are thrilling.n for you at any time!Andrews Masic Store.| —-—_|)ater.(fj Lazenby-Montgomery We will play ti n ¥fi Ye No wife can do herself and her family justice,whensheisallfaggedoutbyneedlesswork.Every woman who does not know the value of theMcDougallAuto-Front should visit this store withoutdel:y and learn how it cuts kitchen work in two.Williams Furniture House. *ees tata ITH sixteen years of ex-acting service Paroid Roofing toof youcanbuy.Askus for 2c.roofing. el i t , i ea e For a bag of Davis Bros. Graham Flour,fresh lot right from the mill* Don’t forget that we have anything you want in the way of Spices,Vinegar,Extracts,Rubbers,Jars and Jar caps. Phone 89. Eagle&Milholland. FINE LOT COUNTRY MEAT.— Miller-McLain SupplyCo. Harmony High School. A Farm Life School For Girls and Boys. —SPECIAL COURSES IN- Home Beonomies,Agriculture and j the Manual Arts. Prepares for Colleye and Universi- ty entrance. Fall term opens TUESDAY,Sep-| tember 11,19L7. Eogage board now at Dormitories. | For further information and new iMustrated announcement write to R.H.LANKFORD,Principal, Harmony,N.C. - Builders Hardware, Material,- ber,Paint. C.WATKINS,‘phone No.43. |WANTED! SCRAP BRASS—HeavyBrass 7c.per pound,.Brass 5c.perpoudi=FOR SALE: New 2nd second hand rachinery for sale and all kinds of boiler room supplies. C.H.TURNER.‘Phone No.14,Beli No.7. Battery Trouble Righted. If you have Bat trouble, 8 Car.‘lh locate Fring able All work :done by an expert! aA Pr r e r r e r .28 and 24 are not operated on MATTERS OF NEWS. H.H.Meese of Cander,Buncombalcounty,71 years old,died Inct weekitesthedilectsof0kickbyahorse,The Observer says that out of 75doctorsinCharlotte33haveofferedtheirservicestothearmyandBhavebeenaccepted.It is reported that ex-Judge Craw-ford Biggs,Raleigh,may be appointedassistantAttorneyGeneraloftheUnitedStatesinplaceofE.J.Jus-tice,deceased.It is officially announced from Pet-rograd that the residence of Nichol-as Romanoff,the deposed Russianemperor,is at Tobolsk,a western Si-berian town.His wife and childrenarewithhim.A number of National Guardsmen,including men from the coast rdcutterSnohomish,wrecked the {W.W.headquarters at Port An|Wash.,throwing the furniture|papers of the organizxtron into the bay,from which they were later re-|covered.PIESAARSRSTRNAS \Cavalry to Be Converted Into|Atillery?|It seems to be pretty well under- |stood,says the Lincolnton News,that‘Troop A and the other cavalrytroopsinthisStatewillbetransfer- red to heavy artillery baiteries,theentirefivetroopsofcavalry,with jan additional battery,making six hatteries being expanded into a reg-‘iment of field artillery.It is under- stood that the artillery will be pro- vided with six-inch guns and each‘battery will have 190 men.This will mean that each cavalry troop after being transferred to artillery,will be considerably increased in number of men in each command“The camp of Troop A,”continues the Times,“is four miles this side of Greenville,in a hilly section,goed for artilery practice bu:not desira- be as a drill ground.This camp is one of canvas tents.‘And this fact lindieutes that the men will be there ‘only a short while.It seems to be iwenerally believed that —the North ‘Carolina troops will soon be order-| fed to France,where they will receive |”ithe major portion of training.” Canada’s War Expenses. Canada’s war expenditures areaowabout$850,000 a day,the total; to July 20 being $623,000,000,ac- cording to figures made public.This sum includes upkeep of Canadian troops in France,for which Canada owes Great Britain 272,000,000. Advances to the munitions board ‘amount to $288,000,000,while $22,- |900,000 was spent for hay,cheese, flour,ete.Canada is supplying about $10,000,000 a month to buy ‘cheese and contributing $25,000,000 t month to the imperial treasury for the purchase of munitions in Can: da. Killed Member Posse. When a posse attempted to arr os: ji ieero Sessoms,colored,in Evdgre leambe county,the negro barricade! |himself in a house and opened fire ;Carey Weeks,a member of jposse,was killed;Van Sharpe ‘seriously wounded and Brace Tav! Jo.Stallings ond W.HH.Clark sieht! wo nded,The negro escaped,althourh house in which he was located wi riddled with bullets by the posse AMERICAN TROOPS NOTIN VEI The report las’week from 1. thet wounded Acnericans from th American front were heing brouuht ¢ in hospital at)Bath for treatin: which was at first supposed tot that Americon troops were aciy ‘nerared on the battlefront,doubt 'referred to Americans with the ¢ fian troops or in other braches of t! se;vice Se far as known,Am troops have not becn engaged at front eeeeremene6mee NOTARIES PUBLIC EXFMPT? A Shelby lawyer yamme ‘ wited who was called in the Iraft,asks exemption on the sr hat he is a State officer a not vuiblic.State officers are exems from the drafi,but the exemptic: oerd,under adviee,rejected the tary public plea and appeal wil! taken to the district board.If fails,the courts will be asked ti le the question,it_is said, PAGE FOOD COMMISSIONER. The Federal food commissic’ appointing food commissioner: each State.Henry A.Pave |Meore county is named for % Carolina, The State commissioners wil! minister the food econfrol bill a applies to State matters and w! ordinate State food activities wiih those of the food administration.\'!will serve without pay. eReea em ‘TWO ARRESTED IN KENTUCKY. Sheriff James 8.Taylor,a mem ber of the Logan county (Ky.)¢*- emption board,and County Judge Edwards have been placed under a rest by Deputy United States Me: shal Richardson on the charre © ‘conspiring to violate provisions «' 'wart f jthe selective draft law. Stomach and Liver Troubles. No ond of misery and actual sofferine Senused by Gieorders of the stomach and and may be avoided by the tee of Cham! lain’Tablets,Cive them a triel,They on'y jeomt a que eer neemnee i THE ONLY STIGMA.‘@reensboro News.»The only stigma about conscriptio: Dei ohdd 7 iS Sa teen Sena es Bd Sa!J cI ie ‘jehurch,died Saturday ;a Corn Patch. Correspondence of The Landmark.| Treutman,Aug.20—Mr.William|L.Ostwalt,a prominent farmer who|resided in the of Bethel)noon after!‘an illness of two or three weeks.In-| terment will take place today with |funeral service by the pastor of Bethe!church,of which congregationMr.Ostwalt was an active memberThedeceasedissurvivedbyawifeterchildren,six brothers and one sister.He was a prosperous man and a self-made man;was one of the sevenbrotherswhosefatherwaskilledin|the civil war.The mother was leftwiththisfamilyoflittleboystomakeherwayunaided.Just how well sh«succeeded in this is attested by th:seven fine farms and equipment: strung up the river,beginning at Bethel church and extending to ufola.A prosperous bunch of red-blood ed men who live and move and cast their influence for good in the commu nity.Their numerous families of numerous children are likewise makinggoodandalreadymanyofther.fill ;ositions of trust and hénor. Mr.J.tk.Brown has broken ground and today begins the erection of 2 new store house here.The buildine wil!be of brick and two stories.Mr.G.M.Josey,a farmer living dowh the river a little ways,has 1 field of 16 aeres of corn on which he expects to make 640 bushels,This field was worked at a cost,says MiJosey,of $64.Thus the corn will cost him 10 cents the bushel.If per chance he sells this corn at $2,whichismorethanprobable,the divi- 3 nds will make the majority of th }War babies look like the profits i heandy shop. |Miss Jessie Alley of Asheville i visiting her father,Col.A.8S.Alley of p Shin place.Messrs.Percy Sherrill anc |K.R.Alley,two young men who erjlistedintheregular’army severa’ ;years avo,were here on a visit lastjweek.They have returned to their lnost of duty in the State of Maine. |Me A.P.Torrence of Davidson ijhereonhisannualvisittohisdaug¢h- ter,Mrs.G.M.Young.Mrs.B.G Allison and little daughter,Virginia jare here from their home in Tennes- jsee on a visit to heme folks.Mr |}Herman Kyles of Salisbury and Mr|Tevis Edwards of Taylorsville -are ispending a few days here among ee and relatives. Mr.Albert Cavin left last week for |New Mexico,where he hoves to 1 jcuperate his broken health.His fricnds here gave him the trip and he ‘desires to heartily thank each and ev ery one who rendered bim any as ce, |NEWS IN CONDENSED FORM jftems of Interest Gathered From Over the State. jt Mrs.Harriet FE.Julian,widow of D.R.Julian,former sheriff of Rowan,died at her home in Salishur this week,aved 69.A daughter and two sons survive. Clarence Davis.who killed Lewis Shwe in Wilkes county Jast fall,wa eorvicted of manslaughter in Wilke Superior Court and sentenced to five years in the State prison It is reported that the srovernment is preparing to esteblish an s¢hool at Morehead City, the aviation schools +t Rie! Harrisburg.Pa.,und elsewt P.A.Hartman,a prominent.citiawnofRowan,former county com missioner,died Just week at his heme n Providence township.Rowan coun- v.He was 72 year.old and a Cor foderate veteran The dead body of Sidney Gr.Ch tion of Manson.Warr intv.& found at a railron eros pe Manson,early ore n Vis dead hofse were nearby. Killes a \ Dr.H.Q Alexander,who it)was nderstood had agreed to keep thepeaceaboutthedraftlew,sperkineitKing’s Mountain on the night of the W7th,“proceeded with caution.” wceording to the report.but declared he draft Jaw Sunjust.” M.1...Shipman,Stete Lalor com ssioner,ha bisupee it Brevard News and the paper will be conduct vo by CL Gi.Oxborr rothe r-in-ln ef Mr.Shipma fc i fr wapaper exper ence vard,which ih The Ford ard lor South River,Rov wn sold to | yivania. known as the‘ab Companys0.Tatum,|! “owler. A eworn Ug mbrella of os tra Sulheburv nd pu flight A farmerwaysofbeeat handle and the =be settled under the were safely hived Miss Kelly of Jo! State,and Mi who have quarters it Hepartment of ed are conducting ¢} Witeracy in NorLegielaveremad for @ eampaign timtheState “The Confederate veterans’1 or at Newton on the 16th was large! attended.The Wiekery company of the National Guard was eatuthere‘was a big parade and awarded the best decorated alam.Major W.A.Grahe Commissioner of Agricul the speaker. At Goeldaboro Sunday “Pig”Aus tiny.@ negro,walked up to Libby dones,a white man,standing on thx at and fired three shots,instantly ki Jones.The nerre tried to hiscacape but wae captured er t to,Raleigh for safe hoeping.|in said the and the white marhaddisputednightbeforeabout: piece of ment |: ae 5 PRONE commen ht ?Pe Ra for you is a goodservant. The Maxwell engine steadfastly cuts your gasoline bills in half. That’s becausethe Maxwell engine is builtright. Every mechanicaldetailoftheMax- well,indeed,isbuiltright —the smooth,wear-proofclutch,run- ning in oil;the trouble-proof,simplePsaloes‘the iki | vitalpart,in short. TheMaxwell priceandMaxwellup- keepcost arebothso low that any man— and this means YOU—can afford to ownone ofthesecars. SE Ws an n Touring Car $745 Roadster $745;Berline $1095 Sedan $1095.Ailpricesf.o.b,Detroit SS S WW H 4 8 Ed G White Motor (.o. Statesville,N.C. | | || | A Call For Women! The President of Mitchell College has issued a call for seventy-five Boarding and one hundred Day pupils. Earnest,ambitious young women from the age of twelve to twenty will be in the first call. The enlistment will take place at the Office of the College Wednesday,September Sth.The sacrifice will cost something but it will be worth the price and more.’ Superior Officers will be in charge of the training. The advantages will be great for the development of aricher womanhood.Failure to enlist will te a reproach. Bear in mind the date of enrollment,September 5,and the place. College.‘ Mitchell y ws oe ee the : Bees snaps xef Goee not couse snoi"| .'..,This is an Age of Reciprocity! If we heed your interest when you come to US we bolicve you will heed our.by continuing you patronage at this shop. It is on this princi le that we stand to win or lose your trade, If this logic is «.“veci in your case,come in and we will save you money and make you glad. calling to arms of the negro by thePresident.the Mississippi Senatorcontinued:;~“fT maintain compulsory militarytrainingwillleaveaprobleminthiscountrymeredifficultofsolution,more han I fear,in conse- quences,than the sudden emancipa-tion of slaves half a century ago.I helieve the preserving of a free gov- ernment in America will be about asdificultaproblemavierthewaras‘»overcome our chief antagonist— Germany—now.” Even if it be true that the present war originated in “a quarrel between rulers,instigated by commercialbandits,”and is “reproach to Chris- tian civilization,”it is only fair to remember that we had no part in bringing it on and that we kept outofitaslongaspossible;that we areinitnowforself-protection and toproventGermanyoverruningtheworld,the United States included.The criticism of the draft,comingfromSenatorVardaman,can onlyencourageresistancetothelaw-—en-egurage the ignorant to get intotle.Senator Vardaman knowsthat.White he has a right to hisinionaboytthedraft,he has norighttogivepublicexpressientothatopinionwhensuchexpression, can only t in harm to the coun-ttv and ividuals who will be iffluenc:¥his opinion. The grand jury of a court in Mis- ob sippi the other day brought for-1 indictment «against the KaiserhighcrimesandyetthecitizensMississipoielecttotheSenateaanoftheVardamantype—placeminpositiontodomoredamage|*§ws than the Kaiser has yet been je todo. IMPUGN MR.POU. “The expected has happened in the case of Mr.James H.Pou of Ral- edeh,who has made more than a store of pubic addresses —by invi- jon —on the war,its cause and and our duty in_connectionwith.They now charge that.Pou is a candidate for Govern- .Mr.Pou is a very able man—is»student and a thinker.His ad-—are informative and he has a public service in giving the people the advantage of hisknowledgeofEuropeanpoliticsandinternationalaffairs;the things thatbrouchtAmericaintothewarand the duty of the ciizen in conneciontherewith.In discussing the duty of the citizen he has not minced words.He has talked plainly.He has alsotoldthepoliticiansthatthemenwho vo to war are the future rulers of the country;that al!issues prior to Apri],1917,are dead issues;that men of volunteer age,who do not of- fer their services for the war,need net expect in future to ride into of- fice or dead issues. For that they charge Mr.Pou with being a candidate for Governor on awarplatform.The t.andmark has no idea that Mr.Pou is a candidate, but if he is he would make a Govern-or of which the State would beproud. NAMSNE Zhe industrial edition of theGreensboroDailyNews,recently is- d,contains a lot of valuable in- mation about the State’s indus- es and gives an enlightening in- wiht into cotton mil!conditionsFheconditionsarequitedifferentfromwhatevensomeofourown people think they are,and widely_.from the pictures portray- ef hy the child labor agitators;and it is a pleasure to note that mill qwners generally are constantly king to improve social,educa-ea,religious and hygienic condi-ms in their mill settlements.TheNews’industrial edition was theWorkofMr.J.©.Patton of Char- te and the work is well done.Mr.tton,by the way,is doing an in-trial seetion for the Sinaay Char-latte Observer. rwr Worry muy be as sinful as drink .*Bishop Woodeocx or Ken- y continthe,but tt doesn't makeafoolofaman.--Greenshoro News‘Not the same sort of a fool asdrink,but the chronic worrier is a nuisance.He is always in trouble~he thinks—and he wants to tellothersabouthiswoes.His presenceisgloom,the sunshine and all joyinfifevanishwhenthecomplainer fluence around.A man under the in-of booze is a nuisance,but heisfotalwaysgloomy. Mr.rd E.Britton,editor ofthe=News and Observer, °secretary to Secretary ofDaniels.Mr.Britton “hes:the News and Observer since7 even tempo-his successor is not an- lashington September ist|eral ttf i hs 32 : i F 5. se si t gi t 23S=$ay the Ger-to break theFrenchlinesmetwiththeusualre-sult—failure.The airmen of the allies are work-ing havoc with the German fliers andonGermanpositionsfarbehindthelines.In fights in the air SaturdaytheFrenchairmenaccountedfor17GermanaircraftandtheBritishfliersseven,which were completelydestroyedorforcedtolandinside the Teutonic lines badly batteredfrommachineguns.Eight Britishmachinesfailedtoreturntotheir base.In aerial raids beitnd the lines al-lied machines have bombed numer-ous towns,railway stations and can-tonments,the raids extending as farasSalzaete,near the Dutch vorder,18 miles from Ghent,wiicn also re- ceived a visit. American aviators belonging totheLaFayettesquadrontookaprominentpartintheFrenchraidsandperformednotableexeeution.One of the Americans,CorporatWillisofBoston,was missing fromthesquadronwhenitreturnedtoits base.German airmen also tried theirhandatsiippingthroughtheBritishpatrolandseInthistheyalsowereunsuccessful,and the scorewasagainstthemintheend,for theexplosivestheyloosedfellonaBrit-ish prisoner clearing station,killing 10 rmans and inflicting furtherwoundsonninemenoftheirarmywhohadalreadymetwithhardusageatthehandsoftheBritishguns.The Russian troops are now fight-ing better and have beaten off Teu-tonic attempts to invade their lines.The Berlin war office admits thelossafterseverefightingoftheBel-gian village of Langemarck.north-east of Ypres,which the Britishtook,with other important positions and a large number of prisoners.In two days in the Lens sector the Ca- nadians took 2,700 prisoners.The Germans are making a radi- cal change in their methods of de-fence along the British battlefrontinnorthernFranceandBelgium.The continuous lines of wonderfullconstructedforwardtrencheswi their deep dugouts,in which livedandfoughtgreatnumbersofmen,are fast passing into the discard.enemy is adopting the system of scattering his advance forces overagreatpath.Cunningly constructed strongholds umong the myriad ofshell-holes along the front now con- ceal innumerable small and more or less isolated garrisons of men whoformerlyfoughtshouldertoshoul- der along great stretches of pictur- esque ditches,through which com- munication was not broken for miles. This alteration has been brought about by the ever -growing prepon- derance of British artillery,which buried the German front line trench-es under an avalanche of shells andleftthedefencesnothingbutheaped furrows of earth;and made the fa-mous dug-outs veritable man-trapsinwhichcountlessthousandshavelosttheirliveswithoutachanceoffightingback.The continuous del- uge of breaking steet made repairworkonthetrenchesimpossibleand as the Germans were gradually pushed back,they of necessity were forced to invent another mode of stemming the ever-advancing tide. REEANELEATT NAT TES Only By Hard Blows. Major General Pershing,the American commander,told the Asso- ciated Press in Paris that the war can be won only by hard and force- ful blows delivered by a well-train- ed American army eorking in con- junction with the allied armies.De- ploring the lukewarmness of the American people in regard to the war,General Pershing added: “Every man,woman and childshouldsupporttheadministration in its determination to arm =and equip the American army and to keep up its morale and that of the allied armies.This war will not be won by talk or by subscribing to theRedCross.The American peoplemustcometoafullrealizationof what the war means.It can be won only by striking hard and forcefulblows,fot otherwise.” The general was)very emphaticintheinterview.: SSOayREUREOS |Will Be Treated as Deserters. Renewed instructions that drafted men who fail to report for service wil! |be classed and punished as desertershavebeensenttoUnitedStatesdise injured severely. trict attorneys and agents of the He-|partment of Justice by Attorney Gen- |rshal General Crowderhasruledthatpersonswhoneglecttoappearforexaminationwillbeac-ie ee and that theconcerningexemptionwil!be denied.In cnse they then|fail to will be treated asGoeortecdTammtetora.-York a eens inpubliclibrary,kaune,Wis,.erowd,where they werekneelandkisstheflag10 times. Alabama miners,threatening tostrike,25,000 strong,werebyJohnP.White,president of theUnitedMineWorkersofAmerica,j to remain at work pending a confer-ence between Secretary Wilson andlaborleadersatBirminghamtomor-|row.‘James Lee Hawkins,a farmer of Clinchburg,Washington county,Va., about 25 years old,killed himself at!his home by taking poison.Hawkins’was exam'ned the day before under'the draft law and passed,although claiming exemption on the groundofdependentfamily.| Hearing that negro and Porto Ri-ean troops may be sent to the 'camp at Columbia,8.C.,Gov,Man-|ning has lodged protest with thegovernment.It was recently statedthatnonegroeswouldbesenttothe South in camps,but later reports say they will be sent. All vessels sailing for the war zoneandcarryingwarriskinsurancewillberequiredhereaftertoarminac-| eordance with navy recommendations,or pay an additional |per cent pre-mium for each voyage.Evidence thatsucharmamentisnotavailablewillbetheonlyexcuseaccepted. A Jackson,Tenn.,special says that E.T.Lombert,age 35,post in-|spector,residing there.was shot;from ambush.He was in Chester) county,Tenn.,investigating chargesarainstaruralcarrier.Lombert andhiswifehadrecentlyremovedtoJacksonfromCorinth,Miss. More than 100 citizens of NewYorkcityjoinedthenewly-formed vigilance committee to wage a vig- orous campaign against soap box or-ators whose utterances are consider-ed improper.The American Defence Society announced that it would con-duct a vigorous campaign against all soap box orators.jAdetailedplanforadvertisingthe!next issue of Liberty Loan bonds in)newspapers and other mediums of publicity,to cost from $1,000,000 to| $2,000,000,to be paid by the govern- ment,has been presented to SecretaryMcAdoobytheNatiealAdvertising Clubs of the World,with a recommen-dation that it be adopted. Enraged over the stabbing of asol:lier hy an alleged member of the{.W.W.after the militiamen hadderogatoryremarksaboutthegovernment,members of theThirdMinnesotaNationalGuardregimentraidedanddemolishedI.W.W.headquarters in Duluth andbeatsixoftheI.W.W.members.Street car service*has been resum-ed in Kansas City after ai 9-day strike of motormen and conductors. In the settlement the carmen gained the privilege of membership in a la-bor organization and to select com-mittees to deal with grievances,while the car company was victoriousinitscontentionforthe“open shop.” Mexico is preparing to float at home the $125,000,000 loan which that country has been endeavoring to o}-tain in the United States to rehabili tate her fiances.It is planned for each person receiving wages or a salarytodevoteoneday's pay every two months on “patriotic days”totheloan.Popular subscriptions are to be invited. Co-operative purchasing of mate- rials for ship construction has beendecidedbyrepresentativesofthe country’s ship building plants,toeliminatecompetitionandinsure prompt delivery of supplies.A cen tral purchasing officer will be nam ed to work with Maj.R.FE.Wood, purchasing officer for the emergencyfleetcorporation. Secretary Baker has warned the mayors of cities near army irainine camps or cantonments that they wil!be held responsible for maintenance of wholesome moral conditions —in their communities.If the desired re sults cannot be obtained in any othe way,the Secretary said in a tetter tothemayors,he will not hesitate tomovecampstoothersites. A delegation of New York negroeshadcalledonPresidentWilsontoprotestagainstraceriotsinEastStLouis,Mliois,and other parts of thecountry.They issued a statement inwhichtheysaidthePresidenthadpromisedthateverythingpossiblewouldbedonebytheFederalgovernmenttopunishtheoffendersandpreventsimilaroffensesinthefuture. Only one person,a workman,isknowntohavebeenkilledbytheex-plosion which destroyed the powder|plant of the Curtis @ Harvey Co.,limited,at Rigaud,near Montreal,Canada.Six other workmen wereThefirstexplos- overheatingthenitricacidPropertylossis airplanes flying at highcrashedtogether800feetinthe aijattheArmourHeightsaviationcampnearToronto,Canada.One ofthemachines,bursting into flames—”earth,killed i|ator,.A.J.Dorr.The victim by 8 resented jon was caused by of the machinery in building,it is paveryheavy Georgettes,Crepe de Chine,|) Silks and Voiles. The best the market af- fords.The styles are New and Prices right. Skirts in Silks and Voiles. Full line Wash Shirts in White and Colors. Extra and Regular Sizes. Special prices on Misses and Childrens’Summer Wash Dresses. See them. Shoes That are made by manu- Rattan Seat,Slat Back,Price $2.75. Rattan Seat and Back,Price #3.25. Crawford-BunchFurniture“The °Store ThatAlways,Welcomes You.” Will Continue All This Week ----——Or until we close out.- 1 lot Hats,sale price,1 lot Middys,sale price,1 lot Collars,sale price,1 lot Feathers,sale price,1 lot Flowers,sale price,1 lot Baby Caps,sale price, We also have a nice line of White and Colored Skirts we are offering at a greatsacrifice.See our line and be convinced. MRS.MARY SIMS. The Cash Store. A bedspring that can't saz because of the patented flex- ible hollow strand construction; that does not roll you toward the center because it cannot sag; that is absolutely noiseless,having nothing about it to creak or groan; factures who make solid leather shoes.Every pair guaranteed to give good honest service. For Men, Children. It.will be our pleasure to show you. ’W hy 7 ‘ em + Women and]‘ that conformstothe shapeofthe body; that hasnoloosestronds,open linksor sharp cornerstotear bedclothes. Quarter century guarantee.30 night's free trial. Try 11 30 Nights to Prowe it's SupremeComfort {i| ; |Thisis the disc Plow that gives universalsatis-faction.Itleaves theground in splendidcon- dition.Will breakharderground thanother|plowswithout leaving it cloddy. We have 2fulltine of ChattanoogaWalking - == BE EE .i 21;spring term sday,January 8)1918, |,|@losesWednesday,May 8,1918. Bunday School Pienic —New .N.Troutman ee e School House. .1.Troutman is still -respondence of The Landmark. chronic laryngitis and @|Statesville,R-1,Aug.186 —Crops | re looking fine around here but a’ i nS 3 SS RR S E H s é Bir iz present were:| rner of Camden,C.in is needed very much.. of Jacksonville;|vis-|'Sunday school pienic at the Ar-| Duke;Miss Elba oe thurs school house,Barringer town-; has been teaching|Loftin me August 24th,Some songs and isses Rachel Besden |home on a citations will constitute the exer-The U.S.Government,know our sound finan-} remation,Mr.Sam.Nesbit has al-|eises and some good talks will _bewolittleaneene:cial condition and the character of theMEN behind our :returned from Malcom,—2 ——by one or two preachers.Ev b k.accepted our bank as a ber of the FEDERAL { answer the draft call.Mrs.A ——is invited to come and bring ne ont Dw Boe Cooenevaes and dauynter,-fu b heahots,Dinner will be served RVE SYSTEM.es ¥in,are guests o'rs.M.jon To : ; Ste ‘handay ih Fors /@He>_of Elkin,are ENeenwood will,go|.Lumber is being placed on the We are oneof a VAST ARMY of responsible banks =» which STAND TOGETHER.ns cho bad been to Catawba to visit her father,%iground for which to build @ = 0 ;|J.H.Booth,before returning to Bchoolthouse to take the place red Saiurday from «:aeeae,*Lg a «to ie ma PiyterPng on gt 5 ~~be =On our securities we can get MONEY when we y vind Me.FP.L.|e wedding o r.“lof a few ings when A ‘ decorations were of golden grow and |worth.ec ak ae ,jman Lippard and Miss Emma jjt is complete.|want it - ee ene.|Sundayere’with hi son,Br.usene Hon,|Schofete,|Ti nce a and/TELEGRAPHERS GET RAISE.When your money isin our bank it is absolutely 7 Friday morning Mrs.Lawrence en-|“Me ee Makin act ems tin|eae a 08 —Ay ngPhil-asitereasee in wages songing,trem safe and you can GET it when YOU want it.oa.4 thas 5 te Ob per ee er Make OUR bank YOUR bank . tertained at two tables of br al ‘kin,returned Ashe-adelphia Led’,Sagurday from -Wh of ia Ledger,a copy of that PA |2)“‘tclegraphers of the Southern .Mrs.J.B.Glover,Te.ists,where they aan4 ton a |per -boon,sagt 2=e.wuilway eystem,has been announced.' made the highest score and was pre-|gay ‘irom Virsinia,Laon teen er."\eeerd of Barium.These|The raise,which it is said will aver-We pay 4 per cent interest on timedeposits. sented le .|Morr visi ‘7 “;>= Mare "White received the a nt young men have been,hie ‘and Svive from anges 1‘and “me:THE FIRST N ATION AL BAN box of correspondence card:Rev.Dr.and Mra.R.G.Miller of Mecklen-thing like 2,000 men are affected. Statesville,N.Cc.i? oa ~~,5 ecuren wes vorved followed |*2'!county are visiting relatives bere.Dr.’both brides are young,ladies at ;|Miller will go to Montrent thie week.city.Their Iredell friends extend To Cure ©Coté in One Day.‘ by ice cream in cantaloupes.The!Mes.Henry M.Ware,who visited Dr.W.R.:.| |Ware and family,lett Friday for Topeka,Dest wishes for the new life they decorations were of white hydran-Ware and family,left briday flor Topes™have entered ey sol pee sa | money i t to cure. signature ob 0c.| ;Kans,te join her husband.. geas.;.enh Walter Culbreth has returned from The force of the gospel is being ste Miss Dorothy Gill entertained the ee et ee where he svent wielded with might and power a\==: idge club Saturday morning.Mr.Spencer Ware went to Sutisbury Friday this section now.Splendid meet-|-————ARKETREPORTS.°“”2 idge was played at two tables and|‘7"hia sister,Mra.John Randieman.|ings are in progress at Bethel and |M \ Miss McBride Alexander won the!yan A ee neener ane and!Perth,and the colored people |Statesville ProduceMaree .Mr.5 i y and sen).:echo prize,a deck =—.A salad|returned Vriday from Valle Crucis,where they barca _>=a \The following|prtose —:yesterday “Dry ”because like champagne,it course was served.The ome was “pent several days.i the sou o r re |or producee local —i 9 Grettily decorated with nacturtiual|2c"0r W,&WareSePetesry con thes 2k is neither sweet nor sour—neither and hydrangeas.Club guests were ference of the Southern Methodist Church Those who have filed claims for Exes,3%c.per dozen.Wet nor Dry with the “sparkle” Misses Juliet Bristol,Elizabeth =Mra.Mary @ Jones of Washington is the exemption may realize what a God-|Rooiers,ie.to Se.per Ib, Brawley,Marie Stevens and Ruby “et of Mr.an@ Mrs.Jno,H.Gray send a child or children can be,as @|Tub Butter,26e.per Ib.retarded.3 ‘henens HN went tq Salts-3}|?*°:: Henninger s Ruth and Rae Gill salis-wife or other dependents are not a’Dairy Butter,0c.per Ib ‘—Sow to spend a»week with Mrs Jo cuftcient alibi for the man seeking |eee Hiden,300.por Tb.The fruitsalts of the orange Miss Sallie Davidson entertained Mrs.8.Le Cushing left Saturday for Gas-exemption.It is hard for anybody Hams,2c.per ih ‘|are mighty welcome to the nerves, the Young Women’s Missionary So-|tons tw joie MJ Cushing,who &now in who may have fo,me but it would §Sider 22 20 abe"yer tb |while the “ng sterilized water ciety of the First Arsorinte Reform.|et Oe ame end cil,whe vin.|OOM best for fathers to be left to’Now Red Honey (stramed),16.per tb |ms a ed church Friday evening at her home ited relatives here,returned Saturday to Care for their families.|ita beeyo —=per as |sluicesout e veins and cools the .id sa he oe »het .TD Sourwoor oney om,ec.per . peng pike cake,metons end’'‘ie WAatyer ot Hit Poi E whe visit-Programme Third Creek Home-|——Roney.ane Wi _.|blood.a :".6 A.D ‘rpes-|’\,RubberCasi {;i } ce.Gee Wee,me tee Uasrmahipsei Cann Baseaes te Coming.rural filtn’Potatoes inew)81-50 per bushel,Whistle”is —gd :'Le .|visit relatives.Pre me for the me Coming at Grain.'—_ ring,will be given a birthday,Mr.and Mrs C.M.Cecil of Hish Point are|Crock chureh Friday,24th:i i The pettewies fal were paid yesterday nerves.T a bottle now for dinner tomorrow.Singing part of the |\iting Str,gud Mire.J.A.Brown,in Sharpes:|9.30 a.m.eetCeon ae a Sas ver ‘a:ourself.ld only in bottles — !2 nee sure township ‘No.|power esus i.a a .. programme.Public invited to at-Mrs.G.Ww.Stevens and Misses Marie and aa :Corn,31.90 per bushel.,dealers in hi h class bottled tend and take baskets ‘Gind ;a y 8 p 5 Hadys Stevens are spending a week with Beripture reading in eoncert,standing Oats,85e,to 9c.per bushel.:° Miss Kathleen Long,daughter of aipah Point “Fen tk a Fale —bb se atk Mr.Hor Cowan f On the local market yesterday 25 1-2 cents drinks.: .¢o vint.sr A yw nvocation r.Horace Cowa ;en Nad !“ Mr.and Mrs.Jacob A.Long of Gra-|9°,,{°Winston-Salem to visit Mr W.R.=a ——a [ere orm paid for best grade —BOTTLED ‘DRY’BY :+!«r ,+r an pire. ! ham and mece of Judge B.F.Long Mr.R.L.Poston left Saturday for Waynes-Tisanee. Gcalame.Cauble,Carson,Finasen.———a a |° .—_>.=‘=seca .—2 oo family,who!Address of welcome Rev.—————<—.—in =xz i |4 ‘i am wi >marri in t resby-ave been re for severe ys.|Responses by representatives rom eac 1 lredet!.Apply to 5.NO..; .|Misses Edna and Sadig Deaton of Corne-locality.'¥.Aug 21. tertan church of Graham =on the ius cM "Pred Denon of Hopewell,Va.net Scivcted.ones ce cia a —eon CLEANLINESS is a much sed are visiting Mrs.M.L m t her home re.#.Phyler,.L.Yandel en e ‘. .;near town meer =len Sev.eb.Brown .5 ar:one stock hoe eas ee epee word,Look US over. Mrs.M.C.Wood will entertain at a ard Mrs.¥.T.Meacham are visiting —Selo Recessional Di Kouen.villa,R-4 ;oe we.=wee | rs.Meacham's relatives in Ashevilie |Hymn Miss Hagel Spencer Wallace OCTAGON BOAP Sc.cake,with package N.|cee RASH'S Store.| four tables of bridge this afternoon:Miss ii Effic ,-i »aus ee in honor of Mrs.m.A.White.:ing —oes Sree ee eee cnn Beaten 2.99..G.Washing Tablets at _Mrs.RE.Nooe,Misses Sara ang Cather-,Masie Choir.Aug.2)|-® ine and Master Robt.Nove are visiting at Hsatory of Third Creek Chureh Mr.J.H FOR SALE—Good sec d-hand busey and |e >.4 ings Mrs.V.I.Privett and Miss Jean.|oo "2 nette Hoke entertained a number of the home of Mr.H.8.Vannoy,at Ronda.|Carsen.—; friend sorencion fonst Set.("ere,sane,Solo.Selected Rev.J.©.Yandel |harness.J.B REECE.Aug.21 it |a tiends at a wa rme jon feast Sat Little Miss Sara Webb is visiting her aunt Addresses 15 minutes each:5 ! urday evening.Cream and cake|Mrs.H.A.Millis,at High Point.Adbeemes18 minutes weet eters?Mr AOR SALE-toe see”Cm oe.|;fe cat ; were served after the melons.|Rev.J.R.Serowes of Marion ix visiting Jno.Fleming.\==-i Tie re Our repair department is in skillful hands.old —at on =a in Concord township Connection between home and church fy pn gpa”7H aa caaaan a ERNEST G ' r.ory ipley,w was in Statesville on)Rev.T.H.Spence |"-‘‘oo a a \é ‘ns ‘big ” -—7 eo mm Se oe ea.——u meet has The value of Sanday School to home train-_GAITHER,Statesville,N.¢Aug.21 -2t.We do our repair work right . a ;3 returned to eveland,.Mr.Chipley is ing -Rev.No N.Fleming j ,i township,and Mr.John Walter employed in the Cleveland-Vackard Motor)The sai meaning of Wome-Coming Rev FoR ee.spe eagte ceive,Yet we charge only a moderate price for the good work Smith of Caldwell county were mar-““"**Dugald Munroe.,——~———Te we do . ried in Siateasville on the 16th.The |F erage aoe .ee ~or one Home Coming 7 House of Many Man ..3 .e >.ino.Oe riday for sions Rev.J.L.Yandetl..t iTED—500 colored :,preferably mar-::z ‘; ceremony =”performed =Hotel|Brooknenl,Va,to visit bie parents.Rev 2D Benefits derived from Home Comins Rev a gag alot =aden eee cat S hones per Bring in your watch.It should be cleaned every year to { Iredell,Rev.Dr.Chas.Anderson of-end Mrs.J.A.Scott.Licut.Seott will re-R.W.Boyd.dus,1 4 uk (Whines toe enemy wale ' ‘turn to Statesville this week God will take care of yeu,Male Chorus Bt ee eg ef preserve it —"i Miss Elizabeth Sharpe has.returned from Hymn No.608 Bi A tt a that {Wark Ot4 per wvek to ee ees e marriage was A&PUNAWAY |9 visit to Charlotte andfourth Corciins.Miss Benedi ‘te sort al halakha granted after one.three and St wane sty Ihrer 1 YOUR ct <4? match,without the knowledge or Fannie Sharne of Charlotc sccumpenied her!Ushers.A.Niblock.C.BR Wood,pondaponer ean aie ok When was YOUR watch Cleaned last? .*jhome and will spend awhile at Mr.C.B f oe _.28 : consent of the young lady's parents |orcison's eae ——.work insid@ ai!year round.Apply,Eman:Let us fix your glasses and furnish all your optical goods. The young people had met at the “Mr.and Mra J.W.Kaneer and Mr.and ment Bureau TALLASSEE POWER COM-> Agpelachion Truiniag School at Mra S.J.Webb are in Atlantic City.They The Lackey Reunion.PANY,Badin.N.¢Aue.21--8t.. Boone.Miss Howard left home to go “re expected home Friday.Carreapencine:af The Lantuare ANTED—Voune ladyfor general off R F HENRY J | to Mara Hill to enter school and by .Mi"Catherine Burkhead of Charlotte,who!The annual Lackey reunion was held on the ‘rs ne ue Oe ee eos e De 9 eweler. 4 ’::2 pi evious arrangement Mr Smi pent ten days with Miss Mary Stearns.re 17th at the residence of the late B.C Lackey |egsential than stenography Apply in person.|- a :..turned home yesterday at Hiddenite.About 125 relatives and friends}FF LL.JOHNSON,Coca-Cola Bottling Co.: met her in Statesville Wednesday.Mr.and Mrs.Emmett Morrison have re-|were present Out under the maple in the ’hen 17 a BOC OPOROHOHOHOHOMOHOM turned from two weeks’stay at peve Sul-yard a big picnic dinner,consixting of every |=Semen ———ae |WANTED—Two boys who will work.Must | Mrs.Josey Shores and Mr.Lean-wer —.—o ,dattemes of the season,was spread,Just be :|.Bev.Dr..Anderson went te Nashville,|fore dinner a short but appropriate talk was be neat in appemrance an po eee os both of re Tenn..yesterday to join his wife and son.|made by Mr.T.F.Murdock,then praye:act dees.High School boys preferred.Addrens »Grove township,were married at They will return home in about a week |“fered by Rev.J.J.Edwards.In the after-|Py care THE LANDMARK Avs.11 the court house on the 15th,Justice =Mr RK.T.Weatherman will return tomor-|noon the crowd assempled to listen |te the |ee e Sloan officiating.vow from a business trip to Savannah.Ga.|music furgished by Messrs.J.P.Sumpter |WANTED—To contract with good saw om oak and poplar. 7 Dr.John L.Kesler,dean of Baylor Uni-and D.T.Pritchard with their violins,Mrs +to eut million feet or more of Miss Lena Alma Hoke and Mr.\cosity,Waco,Texas,visited relatives in |Robena Teague necompanied them on the pic}fumber.Party appiying for job —must 4 of pleasant ad-A For you if you carry one of our new Thermos Bottles : James Morris Goble of Shiloh town-|Statesville and the county last week.From en After a pleasant da ? |+‘oO 0.»y spent all pa ed have good outfit nd te able to manu-: ship were married Saturday aftor-Statesville he went’to Thomasville to visit vagecting rsca with Mrs.r Wash.uackey facture remmher rupee KERNBERSVILLE on your outing. noon at 6 o'clock at“the home of Rev \hin brother,Rev.M.L.Kesler.He will re-af Rocky Springs,in Auxust 1918.FURNITURE MPG.CO.,Kernersville,N.©. ee eee Oi Thome present from a dinuamce wore Ml |aaa.—2 8 We have large,small and medium,You can serve“9 .° J.Pressly Mr Pressly officiating Mre.Nathan O'Berry of G ro in vin r h ere =*.f ¢it ds hoe ””J h Ba a f i of U var { , wcnheie Teer ¥vt om .h ithe am ly Peters ome Vn FOR RENT.St reroom formerly occupied by your beverage just the right temperature,pure ne an Mr te inaued for the it MW.i han ane Rock Mr.and Mrs.T.B.Lackey of Me RP.Allison,R.A.COOPER ,d omas went to Blowing Rech r.re o mores ville .wen.:: Bertie Rhodes nel one a inp wok fe en eb vation bot Measry Jas.and Plummer Laney with am:Awe -refreshing when carried in these magic bottles, Claude Henry Weston and Miss Le-,mother,Mrs.©.B.Webb,went to Greenshore Rebeces Moore and Genoa Ellis,all of States-|f C edit|ting of Creditors.§1265 hot or cold indefinitely.Indispensible to lia Lucille Bustle;Mr.J.Burgess!cvenine spend a few days |ville |Mew.L.C.Asheraft and two young sons Fifteen years ago the sons and daughte™tin THE DISTRICT COURT Ot THE UNIT- D Stroud and Miss Meekly Ann *who spent some time with Mrs.Ashcraft's|of the late Alexander Lackey decided to meet STATES FOR THE WESTERN pIs-automobilists. We'll be glad to show them to you.mother,Mrs.C.B.Webb,returned last)and spend a day together ench year.Friday :+ week to their home in Raleigh.Mr.Asheraft before the third Sunday in August was chesen a.a ee ae Brown.| Notices of New Advertisements |"for them and accompanied them home.|They with their families met for the first time :.*)Bankrapt,in Bankroptes Mrs.Jack Wyekol®of Lenoir spent the with Mr.RC.Laelmy,he being the cidest. : Sow,and stock for ante.Cee o ‘|7 Notice i*hereby given creditors and all oe one a.ow how le Wd —“~=.Lt Mt ng then the totowtns years with the next cidest|other parties in interest that the above-named Soap be.cake with washing powders at|jeft Sunday fo ok en 2a santa peclchaegneamma the eight brothers and *-)James William Brown has been adjudiented POLK GRAY DRUG CO “On the Rash’s store.|ndiny ra week's visit to Ashe county.ters who first met to hold the firet Lackey |yamkrupt that said bankruptey proceedings 'e Jersey calves for sale 4 EK Roya.pe =e Raere,who wee at the Chartette|sana only four me sew living Mensrs have been referred to the undersigned as Ref- i! ee cael be a.-Bee |Senateritam for treatment last week,returned |Fielding,Press and Jefferson Lackey and Mrs.|cree:and that “She frat.meeting of creditors non OOOO IOUL CHOC plant.Talinasee Power Co 8 Le moe 1.Wesd Locher.1 tthe tntemtien tees bate all inte lew tee oe Bone D eect ; John M.Howard,executor,will sel Mention—Mee |surviving te connnue reunions a»lon’burner,at Statesville.No C..on MONDAY, September 2 |ant\Personal thongs,|erm mee Serriadbcn 3 vous,ac 10.in clock,8m FOUNDED 1838 CHARTERED IN 1669 .baller,ete.,for sate.BE.G,Gaither.lorreapondence of The Landmark."the purpose of electing a trustee and trams. ts Secout-hand bugey and harness for sale.Hiddenite,B-l,Aug,18-Mrs.T.MH.Lacke Home Burned —Colored MAM}seting such wther ani furor business wx may I RINI I Y COLLEGE 4.B.Reece ond chitiecs,Kain ont Deal Masors.VW and)>Hurt.praperiy come before said meeting Seed rye.J.K.Morrison Grocery @ Pro)D.A.Lackey and Bowles went to Gorrespondence of The Landmart A}ginime against sais bankrupt should,be ’y ‘ duce Co.Charlotte oat T.BH.Lackey ™sworn to on the regular blanks pre Dt R l 1 AM N e (° New fall shoes Ramaey-Bowles-Morrison |who is ee ae ‘re.Lac!;Stony Point,Aug.20.Mrs.s.¥.Brown lor that purpose and duly filed with the 3 9 i Co.\and Mr.Vv.are there yet and ia daughter,Mrs.Bernard Parry of Hille-T undersigned referee,JOHN M.ROBINSON A.College of Wheral arts with an extablished national repatation for high standards, Your favorite cigar at Stateaville Drug Co.Ww.‘Lackey and D.Q |toro,Uis.,and Mre,T.W.Noblit of Old Aue.2),1817 Referee in Bankruptey.|traditions and progressive policies.its large endowment fund makespossible fret . Thing:fixed right.RF.Henry das today te be wih.weeper went!Fort,who were on a visit to relatives here,f quipment large of well trained and cw teachers.¥ Good maple rockers.Crawford-Bunch Por.|Mr.and a eeewe left for their homes Thursday.Rey FW |,:.low,Comfortable,reams in carefully “* |:.J.G.Lackey and little bers.|Noblitt of the Eastern North Caroline Con)OR SA LE.Classical and scien to bachelor’s degree,coursesinolde ne iments,Schools of and Law.‘ been with Mr.Lack-|ference and Mr,Ewell Somers of Virvinia.-pa . ‘At a bargain.Cash or on time,five head For estalogue and illustrated booklet,Co. shirt walhts.4.M.MeKee @ Co.ey's mother,Lackey,will return|t two days last week with vedell Canne wants Statervilie >relatives here :'a wae ant >.Loyd Sharpe and|were traveling in @ Ford roadster and!of horses,two surreys and five or six buswies. |g.R ALEXANDER,Statewille,N,C.\R.L.FLOWERS, beans Vittle .who he heen vieit-)were mount Big Zhe.clearance sale all this week.Mrs.|ing aon"left‘aaereen tor |C2.:SS to a man Aug.17---2t°. Last cali to the bigDuddy Rabbit sate Mrs,Pred Lackey |has been Inid up for severaldays.While out |. =;ont Pus,of Camis =2 Se ee |ae et Clothing c father.."mn sustained severe injurte our fw mill .senitery @f woolens for suite and overconts,|Daniels and son.)Mr.M Seopa who fives near Liberty Sirest on every five minutes. wanted.Mrs,Jno.H Kansas,are at Mr.|church,in Ale county,had his dwelling|at 12 o'clock Saturdays.Good wames .4 —=ae =contents dextroyed by fire «few nights knitters,loopers.Cam also une! _—dobn M.Robinson,and Alexander county.|A meeting in werk ™ reTeakvaptes.ie cen on 2ere ©at the M.E town for enle.W.J.Mason,foreLee,who hu A *returned to Btateaville,Fianeenesliipeaenscennneteem :Specialists in all:Loeation in capital city gives specialopportunities. é oa t es oe d “ei t t f B i n a n t 4 ca ee lvanus Crater,son of A.F)Cra-ter,died at his home in Yadkin coun- ty;Friday morning and was buried2icemeterySaturday.Rev.Manly Current conducted the funeralservices.He was 27 years cld andwasanidiotfrombirth.It was nodoubthardforhisparentstcgivehis®up,as it always is in a case likethis,but it surely was a blessine toallthewastakenhometorest. as Ethel Jurney,who has been in Mehool a year at Boone,is visiting at ‘Ber home—Mr.F.A.White's.She will very return toseljgolthisfall.isses Pattye Jennings,ZeldaHegardandMessrs.Tom Jenningsanne probably James Howard all left last Wed- will be in school this year-—all savé one,and she didn't quite go toscligoleither,but she seemed tohateleftonthatmission.Beforeshe'reached the train a license wasred—do they have to have anowtogotoschool’?and MissZe!Howard was united in mar-ri to Mr.John Walter Smith ofCajdwellcounty. iss Howard is oue of our bright,energetic and pretty young girls andMr,j Smith is a prominent businessmandfarmerofhissection. Heft’s wishing them the shady lanesflowerypathsoflife.will be a little hard on Mr.Mrs.J.P.Howard,as they had recently.given their only other davghter,Mal Everette ‘Harmon.In passing |w to state that these are two m of our brightest and most ing young folks,who are justingout-to try the world.Maynotbedisappointedintheiran-tions of the future and life.}Mr.Will Wright,wife and chil- .are visiting Messrs.J.E.,.and T.M.Jurney and other rela- ‘All who are interested in thedbeveyardatUnionGrovearere-to mect there next Satur-25th,and help clean it off.writer with his family,in ful-mt of a few years’promise,t on a visit to r.T.M.Jur- "s Sunday,and by chance ran in a family reunion,and you can 3 that we don't always go therwaywhenwehappenupononeoceasions.Mr.Jurney hasidealcountryhome,overlookingwatersofRockycreek,andeatingmajestically‘eneatn theofthemassiveoaktrees,sur-ed by the manifold beauties ofreandsupportedbythewealththesurroundingfields.Among theresentwere:Mr.E.tk and family,Mr.Wright andmily,Mr.Jas.Mitchell and fami-and Mrs.W.F.Walker and chil-|t wnder the shade of theinfrontofthehousewe “|the deep red,juicy,sweet of many a plump melon during Way.When the noon hour came bounties of a good old country brie were spread before us and younowtherest.We certainly enjoy occasions likethisenditisgoodforustorelax r minds from our daily tasks,take {"a day now and then and get somejoymentoutoflifeaswepass rough it.We may not pass this y again.Don't brood over yourtroublestoomuch.Don’t brood over war too much.Look up!Lift your heads and catch a few impsex of the beauties of this life. n't cross the bridge till you come»it.Half the troubles that are rooded over fever come. STWorryingaSin. *It is no more sinful to drink your- gelf into the gutter than to worry rself into the grave,ic the opin-Right Rev.Charles E.—Episcopal bishop of Ken-ucky,spoken in a recent address inNewYorkcity. “People are petting life badly fixed up,”he said.“They are short @ning their lives by ten years by nseless worry.Worry weakens tne heart and hardens the arteries.‘eople are carried away by the mis- ken idea that one can't live with- it Worry “Worry is an evil. more than rum or vice.It is as sin- ful.as drinking or gambling.It isguilty,sinful,cowardly thing!It always a personal weakness.” NehempFromScott's —Mrs. «+Houston's Death. Bevecpondence of The | pBcott'’s,Aug 16 MissesLieticHunterattended the erence thin wee at hing Pearl Morrixc+Corne .dohn Rufty are tirtuteIhBtatervilixiMre.Mary Ann Heures»died n of the It destroys sndmark Myrt Decverne Monday afternoon atStonyPointatork »Bee te wurvived ty a con,Amos Hous 4 ®&Gaughter,Mrs Minnie Sherri aMr.Amos Frye of Bryson City,anda dane Overcach of Stony Point.BM.Merrow and Mise KatherineWenttoBlowingRockthisweek seominy atte ie mere Catarrh in thie section of thethanaflotherdiseasesputtowether,years war supposed to Ag sme local *by con-to cure with >!treatment,Caterch i««localbyconstitutional ge a y for Mars Hill College,where| Maud,in marriage to! P.|and Tom McKnight. ‘held regularly.MrledattheoldCookcon-eal wasostedbyMrs.Car- Many years secretary.Ww.A=We oxrogramme,was much enjoy-|ed,ineluded several familia:otic selections,concluding with “TheStarBanner.°The uniforms for the Piedmont battery arrived Sunday morning anc were issued Sunday afternoon.They‘add much to the appearance of the company,and the boys in uniform ire at present the pride of thetown.The battery has received or-ders to be ready for departure and will doubtless leave for camp this week.The town will regret their going.The boys received a warm welcome on their arctval here and\the citizens have extended them the ‘utmost hospitality during their stay. In addition they have provided ahandsomesilkflagofscarletwithltieldarmscrossedandembossedin, vellow,mounted on the regulation jstaff,which will be presented to Capt.Morrison and his company be- fore they leave.The presentation speech will be made by Mr.Thomas N.Hall and the occasion’will be !public |Several ladies from Concord came lup Saturday afterncon to present |utility bags to the Cabarrus mem- bers of the Piedmont battery. The Sunday morning services at the Methodist churcn were conductedbytheEpworthLeague.The younypeoplerenderedaninteresting—pro- gramme of readings,recitations,etc.,which was followed by the com- /munion service.Nineteen Boy Scouts,Scoutmaster|Z.V.Turlington and Assistant Mas- ‘ter Lathan Mills left Friday morn-ing for a ten-days’outing at Mon-ltreat.The use of a cottage was'se- cured for an encampment and the’ [boys expect to have a_thoroughly |good time.The party was accom- |panied by Messrs.W.L.JamisonTheyhavere- ' |ported a safe arrival.|The stockholders of the Moores- ville Co-operative Creamery held;their annual meeting last week,with|50 present.The report showed asplendidbusinessforthepastyear, \the gross amount of sales being $19,- 1496.The directors were authorized jte make an appropriation for the community fair to be held here in |October,to be awarded as prizes in,‘the dairy department.The meetingwasconcludedwithshorttalksby |several of the men present. At the regular meeting of the La-dies’Missionary Society of StMark's Lutheran church last week,the members enjoyed a luscious mel-on feast,which was provided by the kindness of Mrs.Watt Goodman,Mr.Cicero G.Falls,who received J.his commission as captain of infan- ‘ry at Fort Oglethrope,is spendingafewdaysherewithhisparents,Rev.and Mrs.L.A.Falls.Mrs.L.|V.Henry and little daughter,Jamic Tee,have returned to their home at St.Petersburg,Fla.,after spending everal weeks with relatives nere. The Mooresville Canning Club is till running on full timeMissEuniceSloopwill leave for Missouri this week,where she wil! be enagged in the miilinery businesshisfa.Mrs,J.R.Tlastings of Spartanburg,S.©.,who was here visiting her parents,Mr.and Mrs. .E.Hawthorne.returned home Saturday.Mr.Chas.FE.Mills of Statesville spent Saturday in Mooresville. At a meeting of the board of gov- ernors of the chamber of commerce Thursday evening,the old board, with the president and secretary, were re-elected.A farmers’bureau was added to the beard,with Messrs.J.A.Steel and J.A.Craven as the members.Meetings hereafter will be held in the city hall.The secretary was instructed to take up the mat- ter of better passenger service with the Southern railway.It was unan-imously voted to push the matter of paving streets Miss Ida Henderson,who came home sick from her vacation trip to Leray,and was not able to be out Inst week,is better and hopes to be able to start on her Northern mi! linery trip Wednesday to buy the fall millinery for J.P.Mills Depart- ment stores The Cook reunion at Amity Fri lay.17th,was the celebration of Mr Andy W.Cook's 4th birthday There was a crowd of several hun- dred people)Mr J.A.B.Goodman, the secretary of the eunion,presid ed and made a speech,Rev W.LA Hough,pastor of the Baptist church of Cornelius,who is assisting in a meeting held by Rev W K,Hol comb at Shady Grove church,fras called on to conduct devotional exer Mr.J.RR.McNeely led After a song,*When Roll is Called Up Yonder,”Rev Robt.E.Lentz,late of Texas,who was reared in the re:guberhood and an old friend of the Cooks,was call-ed on and made a ringing speech.He was so glad to get back home and to wreet and be greeted by old friends of long ago.He said this was al-most his home,anyway;that he liv ed many years in Texas but thatNorthCarolinawasalwayshishome.He came back te North Car-olina only on a visit and to see thecountryoncemore,but when he gotbackhereandsawthewonderfulstridesthattheStatehadmadeinthelast20years,he decided that wewerenotindbutaheadofTexas,and he would make this bie home for cises prayer mn the -the remainder of hie life. |has lived 4 ed to over $8,and Esq. ity,who great grandchild.eleven of these reunions,1874;then no more forForseveralyearsthey have.Cookhomeaboutthreemilesfrom for 60 yeare.was a longyardepreadwithdinner,ley string band furnisheditwasamostpleasantday, be remembered xa every oneent.“Mr.J.R.MeNeely and Mr,Horton were appointed to take upWferingforMr.Cook,which = a..Neely made it $10.Mr.Cook iszreatfavoriteamongtheoldyoungpeopleofAmityandroundingcountry.There were ¢friends of his present from Concord ind Salisbury.He is in his usual health except a sore eye. Esq.Jim Haynes Brown of Ami-went to Baltimore for a‘onsultatio¢n with a stomach special- ist,but who was not operated on,isathomeandthoughconfinedtohis ved with cancer of the bowels,andmayneverbeabletogoabout,is‘heerful and not suffering any pain, He was told by the specialist that he was in no immediate danger andmightpossiblygetwell,Mrs. Brown,who is also an_invalid,is able to get about in the house =and wait on her husband.They have thesympathyoftheirfrtendsandofthe entire community in their afflictions. Rev.J.W.Stokes,Presbyterian minister from Donalsonville,passed here in his car SaturdaynightonhiswayhomefromMon-treat.He went out to Mt.Ulla tospendSundaywichhisoldfriendand schoolmate,Dr.George Tl.Brown. He taught schoo!at Back Creek in 1894 and 1895.He seems to be get- ting along well and likes Georgia.Mr.John Cohen of ——is showing a minnie ball that he car-ried in his left thigh after the Civil War for six years and 14 days.Dr.J.H.Newell,dentist fromCharlotte,spent Friday and Satur- day here with his two sons.who be- long to the Piedmont battery,and visiting his old acquaintances.e lived here 23)years avo and wasase!of the then little village.Mr,J.P.Mills was fhayor along aboutthenandDr.Newell ran against himindwaselected.They both say theyreallydidn't run but that the peoplejustranthemanyhow,because the where in 'mavor's office then was a very tame affair. Dr.Newell says we don't eatnouvhbraninourbreadtoharden sur benes and therefore have decay- ed teeth too soon.He says the roller mill flour,which is clear of bran,ispartlythecause,and that 40 yearsago,when he began dentistry,therewasnosuchthingastreatingchil-dren or young people's teeth.If one hurt or came loose,they just pulled itrut.VERNIE GOODMAN. Save the Flour. Declaring the United States and its allies face a wheat deficit of 400,000,. 000 bushels unless new economies are introduced,Herbert Hoover,food ad ministrator,has appenled again to the American people to eliminat: waste and to conserve wheat by sul stituting other cereals.A saving of one pound of wheat flour a week fo very person,he declares,would g: far toward solving entirely the food question |ee TO FRANCE, Of 24 men of/the Coast artillery elected in Richmond last week for inimediate service abroad as mount- ed police,10 were from North Caro ‘na.Among them were W.H.Mil- ler of Newton,B.L,Tucker of Ad- vanee,Davie county;C.O.Cornel son of Salisbury,F.P.Cress and R K.Lentz of Concord. What is LAX-FOS | LAX-FOS 1S AN IMPROVED CASCARA A Digestive Liquid Laxative,CatharticandLiverTonic.Contains Cascara Bark, Blue Flag Root,Rhubarb Root,BlackRoot,May Apple Root,Senna Leaves andl'epsin.Combines strength with pala. table aromatic taste.Doesnot gripe.50c NATURALIRONBEST,CHEA?-EST TONIC FOR ALL! Highly Concentrated «cid Iron MineralGoesFromTwotoSixTimesAsFar!MORE POWERFUL ECONOMI- a THAN PREPARED “PAT. INTS.” When people find their appetite off.vitality low,and are sluggish,tired and worn-out,a short trent ment with just plain,every-day nat ural iron is the wisest course. You can get natural iron,known is Acid Iron Minera:,at most druy stores and ai 50-cent bottle goes from two to six times as far as oth er and weaker iron compounds laboratory and chemist.A dollar bottle will permit a who! family to take it a couple of weekswhich,in its powerful,highly -con. centrated form,is usually efficient to increase the family's vitalitystrengthandappetiteinaitruly wonderful manner.Acid tron Mineral has been bo:tled,tested and guaranteed up to its present high standard for thirtyyearsforuseinhospitals,surgery and dental work,and it may now besecuredinfamilysizedbottles.sure you get the genuine,the trademark“A-I-M”is your protection.Itisnon-alcoholic,is net a taxative,and is the product of the only medic-inal iron mineral deposit of its kindknowntotheworld,50c.and $1,Bottled by lessors,the F of erWeMineralcontain ‘lviously a Ga.,| Be! o)For has not conitmaybecompelhim = endl’division of labor,as EdisoninWashington. Secretary Daniels yesterday and later|went to the White House to call on)President Wilson.It was Mr.Edi-| son's first visit to the President since| the declaration of war.|It is well known that the great) inventor has been giving much at-!|tention to development of anti-sub- mariné deviees.Secretary Daniels said| jit was a subject about which he could a nothing. \»American passenger ship,ar-|riving at an American port from Eng-|}land.reports that it was attacked by| n submarine off the Irish coast.A/j torpedo fired by the submarine missed|ithe mark and the naval gunners miss.| Jed the submarine. ‘SENDS EVIDENCE.SENDS ENCE That Cannot Be Controverted! 'Facts are stubbern to overcome. |Notwithstanding the amusing}statements one reads in the newspa-lners by some people trying to foist}manufactured articles on a confidingipublic,Tronized Paw -Paw =stands wut boldly with a devendable record |+f corly a quarter of a century.It x net a “cure-all”but prepared sim-‘or what we claim and no more.||Thovsands upon thousands of letters || feontaining the warmest proise reach - our headquarters,and =while we ( net helieve m promiscuous publish- ing of testimonials,we occasionallyfer!compelled to give one,as fol- lows:M F. by |COL "0 A Meister.an upholsterer trade,living at 2711 Wheat street,Columbia,8S.C.,says:“I suf-| fere!from indigestion,liver troub- les and constipation so that I could net eat nor sleep after any fashion I saw your fronized Paw -Paw ad- vertised in the newspapers,but was at first somewhat skeptical,havine' ‘ried se many ready -made medi- ines;however,I obtained a_bottle ind used it accordirg to directions, |tablespoonful half ar hour before meals,and in a few days,before us- ne up the first bottle.I felt so imuch better that I wish to congrat-ate you on having such a splendid remedy.I am sleeping well again and my indicestion has disappeared. 'l need not tell vou I shall continue the treatment.which has made me feel so much better.”{ If you are suffering from anytroublessimilartoMr.Meister. there is no reason whv vou should not obtain the same rele?as tic h md.Step into the nearest druygistandobtainabottle.If he is not up to-date,eall at the Polk Gray Drug Company's.Formula on every =bottle. for 14 ounce bottle,only $1 on given to mail order Drug Co.,Inc.,New York. PUBLIC SALE YOF VALUABLEFARMANDDESIRABLERES-IDENCE PROPERTY Hy virtue of the vewer contained in the|and testament of L.M.Howard,decennteoftredellcountyC.the under ivne i onSATURDAY pose to public sale to the niwhest wh,the following described Price At Interstate ¢ter ad SEPTEMBRE 22.101bidder f ‘oetenlextate t The farm and home place of the «nid PO 4 Howard,decensed.<itunte on the Lewis FeadthreemileswestofStatesville farm contains 88 acres,more or lees,athcovesofwhiehisnowinfinestateof enation,About &acres of which ts fine m land,dredged.tying on waters of *cek,There is on this @arm a nic om cottawe residence:a good tenantodoutbuildings,and ales abundance of woodthnkandpine,fer all domestic purpowThepublicroad,sand-clayed,runehroughthisfarmandthesamewillbe » vo tracta and then sold all towetherTheundersienedillbxgtadatany time tehowthelandtoanyonewhormenybeir ted in the same JOHN M.HOWARD. Zeb.V.Lone Executor Nue.21.bw. terhto vie ir Atty SEED RYE. We have a few unfilled or- dersfor Seed Rye.In ordertothestockinfortheseweareoffering$2.00 per bushel,CASH,until theardersarefilled.Get your| Rye on the market whileyoucangetthishighprice. J.K.Morrison Grocery &Produce Company. Le ERE ee ne eerere |ware,oF ne wars.SO BUILD NOW ! PINE SHINGLES! JUNIPER CEDAR SHINGLES! RED CEDAR SHINGLES! Nails,Ridge Roll,Valley Tin,Brown ‘ond Green Shingle Stains. C.WATKINS,Shingle King of Ire-| lell County. iM NEAR TOWN miles ‘. | | | “Those Who Know — A teA ll mi 4 That’s Fit To Smoke. Thats Che Wai)We Keep Hoase STORE OF QUALITY. StatesvilleDrugComp’y aioe to Texas.pext noon,Fe.Worth p-m. Reeee ve ove io p.m,Arve Dallas 1h INGERSOLWarprice#1.35. =" need. Waltham, Reliance. Eigin, YOLLAR WATCHSeemeifyouareinneedofanykindofaWatch.In stock,Hamilton,New York Standard, I can supply thatSouthBend, Jewcler. H.Bb.WOODWARD & |RatsrMice Por Sale ByC.D.MOORE,Statesville,N.C.BRADFORD &HEDRICK,Loray,N.C.And All Good Dealers. C.WATKINS for “Everything to Build With.” Full Stock—Lowest Prices.Shingles,Doors,Windows,Ceil-ing,Flooring,Siding,Boxing,Moulding,Laths,Lime,Cement, ete.Next Planters’Wh-,Statesville. FOR SALE. of )acres exch hence and M Two high-elo farm healthful comma itic outhbuildtin had adapted te atl ery ar ma daris One ha vil ny of neatly a 1 s wit *he oon at t no oeuiti hoe uw woeodiend;new ” in all necessary a:fine ©lree excellently to markets high both sides >nalw pastnr tenant ”errs itrele frotire nt clading te roemOther vitivation Wired fer iafertiledreadovepropstierenggrece Ne ned t about balf in ood meadow , bottoms Uitable te vree@ sale and ne{ne vy ta pe alxo »aere ire These cecupaney by but pyMoonterested ier the kot MeLAt acrifice,t reine conditions, CHLAN, Attorney Better Than C,I won't be cheaper for many sonable. WATKINS ©say years DR.VANCE HASTY, DENTAL SURGEON, Rooms 5-7-9,Second Floor. PIRST NATIONAL BANK BUILDING,Statesville,N.C TELEPHONE ENCAGEMUNTS"Phone ii.Hours *to S SPECIAL ATTENTION TO CHILDREN'S ‘TEETH | mover s s aFORSALE. At a bargain,60-acre farm,one mile from square,on Mocksville read,New seven-room howe,goed barn,granary,wagon shed, wuto shed.All under fence and crom fence.Good orchard and good well of water.‘Two branches on place;45 acres in cultivation,balanee in)woodland Price $110 per aere. Mptendid truck and dairy farm.8.L.TOMLIN,Statesville,K-4.®14 4t®. Your Crops Are the best they havebeenforyears.Alsowices.Give the wife aBiastolelpherwithher work, Myers Pump and repairs for all makes. W.E.MUNDAY. Your Plumber,114 E.Bread St. Phone 55. C.1.LESTER, REGISTERED AWCHITECT, Statesville,N.C.’Phone 340 Green. NEW SEED BUSINESS. Turnip Seed in packages and in bulk.Also a variety of other garden and Field Seed. All New. , T.N.BROWN. Battery Inspection Free. We are thoroughly equippedtorechargeBatteriesandhaveinstockafulllineofBatteryac-cessories, STATESVILLE MOTOR CO. Let your pocket!this ‘gument;: Which is more 60 geal.Ordinary Paint at 81.50.8890 48 wal.Fair Paint at s1.75..s4 40 gai.High Grade Paint at 80 OR 30 GALLONS conaider economical? $2. 4 reee *A 16Dav wou cheaper had it cost even twice its price,because itwillovt-wear them all. $64.50N ‘STATESVILLE AND ELKIN"SITNEY LINES SCHEDULE,;Car Leaving Statesville..8:00 a. i Cer Leaving Turnersburg .8:36 a.,Car Leavling Harmony...8:55 a. |Car Lenving Houstonville .9:05 a.Car Leaving Hamptonville 9:50 a.|Arrive at Elkin .10:30 a,Car Leaving Elkin .3:30 p. Car Leaving Hamptonville 4:10 p. Car Leaving Houstonville 4CarLeavingHarmony..5CarLeavingTurnersburgArriveatStatesville....Car leavi Statesvitle ing at 8:00 a,m,makerwithbothNorthWkin-Alleghany trains,Leaving Elkin at 3:30 p.m.,connection with trainsNo.12 going toBeaterNo.goingto Io.3 vi | . F p.5:25 6; making desires when you have mIN THE BANK. Your Bank Account depends on what you save, It is not a matter OF GOOD FORTUNE. Acquire the saving habit while your in- come Are not tiedfromcarryingoutyourex- pectationsand is small and it willbe casier as .your incomeincreases to locreaseYourBankAccount. Nowis the ne time to open an Account with us. People’s Loan and Savings Bank.“MONEY MAKES THE WAY EASY.” GEO,H,BROWN President. O.L.TURNER Cashier. FOR SALE 206 ecres,level,productive,red land farm,fronting quarter mile. on the most traveled,public,sand-clay road leading into States- ville;nize two-story,frame seven-room dwelling,located in a beautiful grove;barn and out-buildings,fine well water,two branches;abundance of fruit;quarter of mile from school and churehes;80 aercs in cultivation,30 acres in meadow,balance in woodland,part of which is inclosed in pasture.An exceptional opportunity to buy a fine grain and stock farm.Will take in part payment,small farm if well located. ERNEST G.GAITHER. Insurance,Stocks and Real Estate. Paone 23.Satesville,N.C. THIS BANK Is ezsentially an institution for allthePeople.{t places at the dis-posal of the Farmer and Laboring Man as well asthe business man every facility that a conservatively managed Bank may offer. Merchants and Farmers’Bank. Of Statesville,N.C. “The Bank For Your Savings.”: C.S.Tomlin,Pres.F.B.Bunch,Cashier. L.K.Lazenby,Vice P.J.A.Knox,Assis’t.C. DIRECTORS. C.8.Tomlin.-W.S.Page. L.K.Lazenby.-E.G.Gaither. E.B.Watts.-J.A.Knox. J.L.Stevenson.-J.R.Hill.Clarence Stimpson.-Herman Wallace. R.T.Weatherman. until the’day ofmeaniingticnentrainment,Troop A was colnton showed their hospitalitythetroopers.A party was given on young ladies of Lincolnton athoroughlyenjo: and the boys in |chaki.cream was served.Also so party wasgivenonthelawnofMayorEdgarLove,at which al)the ladies were handsomely costumed,re!Uncle Sam,Columbia,RedNurses,Cow Girls,Indians,ete.De-licious punch,sandwiches,cigars andiwaretteswereservedthroughout |the evening.|‘The hospitality of the towns of|Newton and Statesville is not to be forgotten.The ladies of Newton onthreeoccasionsbroughtmanygoodthingstoeatandmadeageneralspreadonthecourtsquarefortheboysinkhaki,Statesville showednerinterestinthetroopbygivingheboysapieniedinneratLineoln- on Lithia Springs Thureday beforetheirdepartureforCompSevier.The|commissioned officcrs and enlisted|men partook of this good dinner and;will ever feel grateful toward|people of Iredell for their interest.|ec departure of Troop A Lineolnton Sunday merning,August12,was rather hurried It have seemed hard ‘for the parents,swecthearts and frieads to see thebeysdashawaysosuddenly,but itwasstrictlymilitarythattheyshould4osoardwasbetterforthereason ‘that it did not give the time for se‘rious thinking and heart rendingthoughts,which are entirely unnec-wssary,because there is nothing nec-ssurily serious about the situation.t is a matter of duty and privilege ‘or every patriotic American teservehiscountryinthepresentcri-sis in some capacity,whether he be‘ivilian or soldier,and thereforeshouldputonhisfightinggerbwith a cheerful heart and optirigtic free rather than go around weeping. 'to Bostic,from Bostic over the C.,C: |&O.to Spartanburg,thence to Camp|Sevier over the Southern.at camp about 4 p.m.we immediately|fetrained and within two hours wererestingcomfortablyin7acompletely|pitched camp.J|The entire troop is taking well to|camp life and we are proceeding withhedailydrills,which constituteibout8hourswork,besides otherroutine.The day begins with rev-eille at 5.15 a.m.ana ends with re-treat at 6 p.m.Dvuring this periodtheboystakeonanapnotiteequa!tethatofabillygoatastheyaretempt- ed to eat tin cans.The entire troop joir in sending heir kindest regards to the folks vack home.Yours verv.truly. HUGH M.MILLER, Troop A,N.C.Cav.Greenville,8.C. Making Booze of Foodstuffs Stops September 8. All processes in the production oflistiledspiritsforbeverage pur-poses,according to a ruling issuedrytheUnitedStatesfoodadminis- m.on Saturday,September 8.This the food contro!law,which reads:|“That from and after 30{from the date of the aret,no food,fruits,f{feeds shall be used in the production B E § 3F ‘i of distilleries after was ruled will become f is seen the entireinLineolnton|these canyons. but all who can possiity co so,are doing their bit foodstuff., ew the lawn of the court square the tion was jwar price of material and by the ‘officers ‘ion. Cake and ies to bects in thejductwillhave|Missoula factories,wnich a grower|orought here by the ithe beets. |in price.will relieve theW.'s have cai ble camps to close dow mn our commu- nity. ,smoke come over into our Leaving Lincolnton about 10 a.m jell and looking forward to Sunday,August 12,via the Seaboard,turn of their loved ones when peace Arriving! tration,must cease at 11 o'clock p.; limitation is placed by section 15 of daysrovalofthis| materials of |“Some years ago my back was very |of distilled spirits for beverage pur-roses.”The act was approved August 10.| |The 80 -day period named wil!ex.|My back as well as ever.I haven't ivire at midnight September 9.As had any trouble since.”\this date falls on Sunday,and as the|;ij ,‘internal revenue laws prevent the!Price 60¢c.,at all dealers’.Don't operation 1o'clock at night on Saturday until)the euing Monday at 1 a.m.,it!y the food administra-|ion that the provisions of section 15cRectiveat11p.m.Sat- ee >|Belcher Bad Citizen.TheBradyPrin ting ¢, |»5 i 0.samen batiled fee Buncombe = ee _°——for 30 ne H tak f SromahttoRalgellie’elt te be ball as taken over irom ffforSouthCarolingofficials,says,the R.P.Allison the |} ty for,dhree years,having exeaped||agency for ae :| rom :prison,ines an Bookwhersbe,wae serving«ive al]DulSieationsand wants | seer Mitchell located theman your orders ay ood at a near 5 to »|county,and sent @ party of five of-agafers’to roundhim 8.They ind]zinesof all kinds.Will rey “the-he awakened orderany book wanted. gone,he,convict i,the ofte||All Magazinesoncoun-om &&battledwith!tersoon as out. was Everybody,not only the farmers, Vast acreagesofiancvalkeyandttobeshi loss to the ,Mexicans were hundred to workEverythingisveryhigh.We the governmentTheI.W. in Montana,causing We have an active Red Cross or-| ganization here,rooms open every day.Everything made is on display in a large window.In @ corner is a nurse dressed in full uniform.Very attractive indeed.\ Sur Chautauqua i+on this week, at $2.50 per season ticket.All our entertainments cost more out here than back home.An aeroplane flying over the val- ‘ey a few days ago caused consider- able excitement.Our dams are ruarded.Forest fires are becoming ‘uite alarming.Armies of men arc sent out te Coe them.Owing to the drought it is a serious pr i- ion.Just across the Bitter Root mountains,immediately into Idaho, they are worst.clouds ofvalley, causing darkness,as an approaching storm.Morning and evening we enjoy the comfort of a fire indoors.During suly .we had some real summer weather,but last August snow and ce were in evidence over the entire rallev;so that we find our winter clothing comfortable nine months of ‘he year.I hope to enjoy a sutmmer n dear old Statesville some time,’ <here I shall feel comfortable dur-' ne warm weather | Hoping all our many friends arethere- 'os declared, Sincerely,MRS.E.M.PURDY. (A newspaper clipping enclosed by Mrs.Purdy mentions the eeroplane and says it created much excitement, os its nationality was not discovered. People who saw the airship heard an explosion and saw :t fall to the i Se a easierto hendle whenputting then in the barn andcasiertomeas- ureout when mixing feed.It keeps thea clean and makes your help think of thern as forage--notas bedding. Even though sacked,Buckeye Hulls set fer ch lessthan loose hulls.It costs us money to sackthas tut we believe that that will helpyou use this product to best advantageis Other Advantages old worth Buckeye Hulls ‘are free of lict Netrachordust. which has no food value.They mix wellwith otherfood. 2000poundsofreal roughageto |They take less spaceinthe the ton—not 1590.Barn.' ee SS =See Kimbreugh Bros.,Indianola,Miss.,eay? “We areusing Buc Hulls and arevery much with them.We inne they are superior to style m 7 iF i i if y cenasnsiane:SAT snmnssmnen Halls Drug Store,to every man one Simple i SanitarySharpeSafety Razor. The Ideal Army Razor.‘The Economical Home Razor., The 100 per cent EfficencyTheStrictlyGuaranteed Razor. Come and get yours. HALL’S DRUG STORE,° Phone No.29. re nme ane oe ~~ }eround but a search failed to dis- ‘Jose any evidence of the wrecked flyer). STATESVILLE NEWS. This Case Has a Hint For Many Landmark Readers. This Stotesville woman Doan's Kidney Pills. She has found them as ed. She wishes her neighbors to know. She publicly recommends them. has used represent- No need to look further for a test- ed kidney remedy. The proof of can be investigated. Profit by the statement of Mrs.C. A.Kyles,210 Bell street She says: merit is here and | ‘lame and sore.I began taking {Doan’s Kidney Pills and they made |simply ask for a kidney remedy —get Doan’s Kidney Pills—the same that Mrs.Kyles had.Foster-Milburn Co., TRUNKS,SUIT CASES AND HANDBAGS. We have just received a large shipment of Trunks,Suit Cases ard Hand Bags. Now if your vacation needs requires a Trunk, Suit Case or Hand Bag,it will be to your advantage to give us a look before making your purchase in this line. f Trunks,25.00 to $18.50, Wardrobe Trunks,$20.00and $25.00. Steamer Trunks,$5.00 to $8.50. Suit Cases,$1.25 to $8.50. Hand Bags,%3.50 to $12.50. PHONE 83. SHER RILL-WHITESHOECO, OMIT ER Props.,Buffalo,N.Y. eT"a ante llth ‘veming,C mpositioaginqne,two THE STATESVILLE REALTY &INVESTMENT COMPANY Appreciates the ve liberal patronage of its friends and policyho bothNEW and OLD. Our office is an open one,and we invite all our customers and those who will become customers to use the samewhen theysodesire.Asinthe past,we will strive to give the same HIGH GRADE SERVICE thathas wonforthis Company the willand confidenceof over seventeen | Look For The “Daddy Rabbit” i This great “Daddy Rabbit”Sale has been one of the most sucessful selling events Statesville has ever known,all because we gave the best merchandise obtainable for the least prices. We wish to especially call your attention to the fact that this great sale will only continue for five more days or in other words Saturday,August 25th,is the last day.Come and “C” our merchandise and our prices they will make you buy.| Stetson Hats.Silk Hose.Neckties.Men’s Suits.Khaki Pants.Hats. Both felt and Stiff Stetson}A big line of 50c.Silk |Several hundred 25c.Neck-|A nice line of men’s Wors-|Men’s Khaki Pants in all]Extra!Special!Men’s Felt Hats in a variety of styles,)Hose in all colors,Daddy|ties to select from,Daddy|ted Suits,$12.50 and $15.00)sizes,$2.00 values,Daddy}and Straw Hats Special, :Daddy Rabbit Price,Rabbit Price,Rabbit Price,values,Daddy Rabbit Price.Rabbit Price,Daddy Rabbit Price, $3.19 to $3.98,40c.20c.$9.85.$1.48,98c. and THY LANDMARK MR.R.L.MATHESON DEAD.©¢Davidson is visiting her aunt, ra .:ae .Vrs.W.P.Hedrick.Misses Eula : FURESDAY,aa Augusrust 21,tot7,Former Sheriff of |Alexander flyon and Emma McIntosh,trained I een omen ————=———Passes Suddenly —Exemp-(ures cf Washington City,are‘.;’ry cuests of |Miss Melntosh’s —sister,Court Items.tion Roard’s Work —Tay Wop.hedarick.Mine Mar Gene Moore,colored,was commit-lorsville News.\rmstrong of Belmont is visiting Is i i i t h i itedtojailSaturdayindefaultofs,.cciat Correspondence df ‘The Landmark.roaunt,Mrs.I.©.Henley.Mr how in operation and willbe 0 ave the farmers In $200 bond to sad in ne Su-Caviorsciile,Auge au Thitowne!Edwards has gone to Lake Ju a .. -a.larceny‘of a wetech ta Mr.was shocked and addened vester-‘be pel Aw few days oma an ns,pay,im 9 very price we can. dames Woods.d iv When the news spread that Mr.Again Promises About Coal. o f yaerene re ",t shoe ")Mathesor t assed ;:a ;Rothesh and Eugen M Nore,color :i rt ..;Z :Oe o }fn |,a /the cheering news comes from We invite the public to come toed,were tried by Justice Sloan ves.eway at his home her e had had Wachneton that President Wilson ee Sue winnt.<1 all }oan terday for breaking into the Farm-hich tlood pressure for some time 1 order gevernment control o ap ae il ame pters’Union warehouse June 20 and and occasionally suffered a pain riuc Hina ienal pL a bewinning.We are buying ull the sound,ripe Tomatoes we can get,stealing several knives.Probable his chest,but was always able to at.70),abies crak nas ac re :.and will use all you bring:us.Morning deliveries preferred. cause was found and they were com-tend to his duties and iooked so well 4.5,ie Fa sad The eerie The prices may seem small,but Mitted to jail in default of $200 bond ‘hat few @f his friends knew he had,Ne is coat a ee from the a t considering that we take your whole BEANSeach.|;this trouble,.CE CUROTATEL RO MMCOnE URC load (just so the fruit is sound)you ie ...In the mayor court Saturday Phi,severe attack of heart trouble j0.,,will come out winner by selling.to Nice,tender Snap Beans wanted.Will can on shares if Chas Zikas,proprielor of the me Suncay morning about 11 (Gh }Pom era wianien ne ;‘.you have a bushel or more,or will buy as many as you can bringSt.Charles hotel,was discharged on o'clock.and :a twe ho i omer ame om us instead of spending the day from a ,-.VF .a 't ‘,.‘‘‘id ‘(he th food contro t s he resi 4 .Ye +ootMewe |=elemachargeofallowingdisorderlycontensesufferingMr.Math -:get et i a house to:house.t loe Sy ‘yY Was “sed vA }aye ERt a nile .:oe a .ak pl :ae A §a “:ay N t te .we (ae ican in with powers “to fix.th If you could see the waste from CORN }ag maiele a ot oe ‘a I is J a fot he ;ict “The ae e ef coul and coke,regulate pro so many of the Tomatoes brought to ".aos *“BSS a hegr wy ‘!rely >funera a :..sea n ==a "Sta Gas mCTtnGE NOCH CBa RICE ic ara li che CEnULC MECC HIT,on sale,shipment.distribution,Is,you —a how we could For lack of cans,no corn will be canned'.aa 1 Cece ri atid ppertionment or evorage —theroof pay for them at all.x ®havieur,So Precdacterian church,of whieh he {PPY a al Acie a .tiil further notice, Blaine Williams apologized in 4 Rais CONE IT rtd e boyhood.yoo foreign.”,,We are offering the farmer a mar-Mayor's court vesterday for refu ifternoon at 20,by the pastor,os oS ket for his surplus stock and we so-I R A c 0ingtoobeyPolicemanAllixonantRev.I 1 Moore,and the interment ,:.ici i "O-j N E R M ELWEE’S T BACCO WAREHOUSE ,mae daha To bve othe Pack ‘a Li se "De Cust of Soldier's Out fit.liecit his co operation,7 ised ow i member of the Mason It s the United States ust:2 ,A >.See Sy ms <cc .‘r iman.¢~Seholarships For Tredefl.fre and the dr.O.of UC.A.M.,2138 o equip an infantryman for 4 INTERESTING PROCESS:!France Figures mace The county superintendent ha 'wid these oped will have 1}how thal oPouRi toca:Did you ever think of the labor OPESOOOEA.O10: eeived the following letter fom BoB SOMTIR)BET Nee ;eee S101.01:fiehti [Dat is necessary to be certain that §9 eOwen,revistrar of the Ni rth Caretina 0)Mathers ;"a Mi :de Loser t £47.86 and eatin ten,be bottles we use for our drinks are M Moses &Son S of Btate College of Agricultuce and J ‘{’»Matheson and ;The :vsolutely safe,sanitary and clean?@ °i ::¢¢af Abas ;soldier rt n ;>gineering:ays ke the Ist of May ar ’Pea The first operation is to place the “leedell county.has of ny -Nise iooren Sloan,ao nis steel helmet 85,ae ttle in.the Soaker,which cleans &Seiural Acholarehip and fothe tate BC.Soa :ee il sterilizes it.with acid for 10 @ ———Will be atReeringscholorshipsvnVeerSUECe)eA ae |equipped with wih a “,minutes,then the bottle is brushed -Bos Gece Ged.;Vt Matheson oof Gree ,fri piel nul the ;oroughly inside,it is then placed g Johnston Belk Co’s Thursda Friday andrieultureardEnginecring7,nichters,Mis.Glene P it cara ther MaAnheli..1 a conveyer that automatically §y, of the scholarship i<S45)4 yi xtc wil Mise I eprites .ses the bottle twice more inside it continues a ne hokler eae mother,Mrs.W eee d outside,with absolutely eee,5 Saturday,August 23-24-25remainsincollegltisayosenpre;at Pe ‘herk T';sh water,and then,and not unti im your county.Techni sal eieeatio ie,1.Mavens of Che ie Wirwet aut uf the war os ot a ee ee ee With their full line of Woolens,forMakesastrongappealto«!nd washing,every bottle is inspect-a a Woe totes two sisters,Mrs.FOAL Lin he provision inserted by th so that we are absobately certain i Fall and Winter Suits and Overcoats.n Cn pe Shese times when production nore ght Home and Mrs HC.Payne ‘ance committee for a ont «+!there eam be no foreign substance inh This is a high-class line and verykindfallsshortofdemandandpricOeeeeeeawlifcatesof.ee oe he bottle.wa lt asooreNighertieevelafosam.He served the county as sher-certificate :.of ores"The fury In other words,the bottled drink §re nablein pr ice.Moin HS Ue and the town as may an os ‘—tig Mg et as clean,pure and wholesome st If you are contemplating a Fall or‘state Deals i the unexpired term of M (he Test Reverse tne Naarice cry ible to he made.You could §-=Estate Deal CG.Viel mei tee's “revision wd met.Opp Te meee parecer we pene oan Wi:ee -_or Overcoat buy ._ Moesars,ayner &Jenkine,eal The exemption board sent ao sum is based primarily o ta ale pe q i.as t ese con t @xtute dealers,have sold fur M Ro mois to GO move men barday’in Oy toulenee of chile tax ticd h me.x oolens are stan y B.McLaughlin.attorne thre r t :im a .’,will ©bank |deposit ;1 use o!.=a ere ket cea 3 vancing in }°We guarantee toee.i.>.""it 2 ’peers :ie jal q he a ae king facilities nd fF ~~nee oe ,fit you pe ectly.Also weguarantee ,r Hale Wake 1m EN eee.De Vig ae ‘“,;*re with which our drinks are bot-|geetie-og ‘ze i i *a ‘re ry ey 1 s -tel gone MARSHAL WERE’tod.It will be a pleasure to show §th e price, c Ss,mr.7 ¥Wie)Ee t ‘t imlber whe y 1 th prs The ashingtor correspondent .ow : ihe 188 acres and Mr 4 J Lon ren nation «id ;claim cy caswaler pe:AS a ‘Bias A ::| of Elmwood eight acer oe ::Dor Nev ha ited eae Mint Colo Bottling Co.,|g Mr.KR.V.Brawley 1 ?,|time recentiy that United No,628,N.Center St."Phone No.82.!r.pa OY»=:\entertarrimr ocal talent tt Marshal Webb of this di tries Mint Cola,Oran Crush.3ar,has eold recess ly 1000 acres «Mo be given at the eou house Fr to he displaced and that Mr.W.Cheerwine,Gear Ale,:5 ontgromery tract,nbout even ning,24th.for the benefit of ¢Dowd editor of the Chariott (ocolade Lemen Soda.Miles from Statesville,to Mr.KR.I e Red Cross.News,is his probable successo lites’Reot Beer,Strawberry.Adkins;and a Catawha farm of 25 Misses Laura and Suc Hedri Democratic factional differences One dollar a crate of 24 bottles._to Mr.W.H.Haynie of Cataw <party to number of their th Asheville dietrcet are alleged ad.icounty.iz at the residence of Mr.and t responsible for Mr Woll rrr |pR.J.M.ROSE DEAD Mr H.T.Kelly Thursday evening robable retirement ing hart ver L ES i Ww E F oO RG E*Rev.J.M.Rose,D.D..a Preeby-;™>leurs on is Imetettler and aka ae a eeeSaree cau i _ne See T e Se tuth Fitaverald o exineton were ‘kh J :thetionministerwellknowninthhehonoreewuestsProgressiveAchangeinthewovernment's CureStomach Trouble Now is agoodtime toselectthat forae.4%—“Pandey eames were played at three tables.plans will send part of the New Eng they i>tut Chines te sehen lovedones who have gone.Wee carry andminginahospitalatHamlet©The hostesses served ice and eake nd Guardemen,scheduled for Camp tian —YadanativeofCumbertandcountyMrandMrA.E Watts and (jreene,Charlotte,to France a=from -System,a =varied assortment of both Granite inwar67yearsold,Wife,daugh-children of Patterson are spending »short period of training in’home Monuments,TombstonesandMarkers to select from.amd twe sens survive.Funeral at a few days with relatives here,Mr.camps.Other troops or draftedrinbureteday.Interment at |Mee.T.P.Bumgarner and littl men will be sent to the Charlotte ;Pricesreasonable.teville,Dr.Rose had been dauchter and Mr.and Mra.Elaie Rob-camp.of the Preshyterian courch at inette of Albemarle,passed through heen Barron m<for 19 years,Years ago (own Friday en route to the homes 25 LBS.GRANULATED SUGAR"of the Presbyterian of their parenta,.ote Mes.W.at SMITHEY &FRALEY'S for only iston.He hai been J.Dumgarner and Mr,and Mrs.Par-$2.45.Arirckle,Coffee,200 ;a “.:.iasomeyears.‘tee Russell.Miss Willie Campbell other goods just as cheap.—ad. + ‘ 24,191%, C.,FRI DAY,AUGUSTATESVILLE,N.ST BOAT.|THESOLDIERNOT A SLAVB|ALLIESHAMMERTEUTONS Surrem-|judgeHolds the Draft Act and FrenchMakeNota- Ammunition Constitutional.i eae The decision of Federal District]News From War Zone, Judge Speer,at Mt.Airy,Ga.,that]The on offensiveofthe Italians the draftact is constitutional,was regionofTolminoto thee@ telefly mentioned in the last innaph atin.nt “ArioscoveSesume,“st of The Landmark.The decision was Austrians and the difficulty rendered on epetinetions for ~terrain.of habeas corpus for Albert Jones hile,the British and —The Ed.G.A a and John,Story,held in ‘the jail in|Prench forces in Belgium and on the |thers.ceerctuon wore |i a sale j ichmond county,Ga.,amor with =...of Lens and Verdun in cpening a eae .Ww.and ‘; violating the draft oF .€,gamle have a Poe ,\° ants were n »y Hon.Thos,mst the Germans al ve|!‘bemenphl Shaver’writes The E.Watson of Thomson,Ga.,who coa-eta.notwithstanding most “violent|ina.patriotic songs,:PS the county tended that the law is in contraven-|counter -attacks,all the ground they :was patriotic in |place the of the involuntary servitude|won in recent fighting.were a —September and all class needa F a,in denging tho witiniiins Beaeetak’ct tie on te "writings,|are askedtoget ready forit 7yonar,in denying the nt Russian ga on *4 The battle at 5 a.m.and /}declared org to agree to the conten-Bi.the Germans have started 8 Gettysburg —Mr.John Cagnen,wie been q to train the men are|¥@*waged for four hours at a ion that the selective draft law con-possibly may,turn vut to be ,»“Your Flag|in the :4 of between 7 and 7,500 yards.|travenes the 13th amendment would]another big offensive,and also and My Flag.singing of The|Salem two fe-i fr "statistical report on the op-|The U-boat fired 400 shots,only two)be to conelude that the soldier is mjattacking the Russian lines to Star Spangled Banner concluded the |sume his former a oe , =the draft law will be pre-|of which hit eemark.vee A.=ae cous ibe mare,ab-eeutheast ie the vicinity of prem ig oo ly ————.tor at the station a 7 Seanad _|pana neverthe'was out-ran ruth,”sai udge urther south,near Brody and |;exerc were nded|Miss Ruth the provost marshal pamiwe uns,one four-inch,the oth-|Speer;“nothing ;opol,in northeast Galicia.for a suggestion to teachers for va-|sition in the more degrading to . that indispensable and gallant Already the Italian offensive has =©morning exercises in their |freight office.Mr.Kags Fe- bs of citizens trained in arms,to whose|resulted in the capture of more than|**. y manhood,skill and courage is,and a prisoners and 30 guns and Wednesday morning's lesson was turn to school this suc- i;of the a ngthe Preai|vessel.After the Campana hoisted |must be committed the task of main-|gate of great importance Rave been |*,study of _and hygiene,|ceeded by Me.O. the international signal of surren-|taining the ver:existence of the pa-all along line.Italian|Prof.::a sep Se —der,her last shell gone,the subma-|tion and all that its people hold|warships,aiding in the attack at the|thevphynleal detect of children,of ee 150 the 4 .head of the Gulf of Triest,have|Which every teacher should have ; switched their guns from the battle|knowledge.Defects of the eye,ear,Poon geMh f 4 at aoe ane =Ertan,—a=ag teeth —discuss-|of town.A was I ig Austrian 8 .lesson,’spent d a objective of the Italians.Admission|intermediate and highachool grou a oS J as soon as the mobiliza-,er two-inch,with which the subma-of the first increment of 687,000|°!The U a .rine washs“bencompeted.nome time as fully ap spedy a the Amerie rine nevertheless continued to fire,|dear. 4 re ties nd an.foe RoRac Bruce said,and all hands took to the}Answering the contention of the ss based on actual experienceseee.some|Bruce,which had aboard the Cam-|should be held to relieve them from|is made by the Vienna war office of|Went to separate class rooms to take the first inerement and military service beyond the borders ess of the Italians at several up,peaies —oo i —Mr.J.ipw.ian = will be.shown in the report.boats.netitioners that by the common law a tle same nded "|‘The U -boat commander first ap-|it was their right to “remain with- will be -—vegule roached the boat commanded by|in the realm”and that this right ments of the law will be pana’s 13 naval gunners,and order-: .:ed it alongside.He ther went to the|of the United States,Judge Speer}poi . of Congress.It is thought |iic oat occupied by Capt.Albert}said the common law could not pre-pet only have the Canadians re-.——,=a evening,|©co aut 19 vail against the explicit provisions}pu all German counter -attacks,teachers,12 ye yg fee amily:will|Oliver of the Gempene snd ue L :sapes alt mcounter -attacks,|ctuented we av room enow f an act of Congress,which was em-ore Lens,but ve ta!-|4 y a .z his |p wy thee beforeLens.but they are taieny'in|procramme lasted 45 minutes and,it te odfh,bul,ween Muses 08 4:prigoner. _Pes le the for six additional men a is poyernt by the a =a so —'the’eudianne on it :and support armies.le dec front of the important coal center.everyNearYpres,in Flanders,the British|®*the enth applause testi-|—In the reportof the.E PYTHIAN SOLDIERS —~German sone nate ony ~o 6 H NN §S.|five of the gunners prisoners,Bruce that this power was not restric in -any manner and that Congress may|have penetrated the German line to|fied.Mr.Bondam’s piaying is al-board,in_the Nee said.'These included the chief gun- i By Their Brethren—|rer and two petty officers.One of|summon to its army every citizen of|@ considerable depth,On both these|Wey"®treat and {t was a great|ed that Wood Hayes Event of Last Evening the gunners,whose name was Mil-|the United States.sectors furious fighting is still going|Pleasure to the teachers and others|mony had been tr ee +|lor,was included because he could]Admitting that no express power|on,present to hear him.D.C.It is 4 :large gathering of Pythians at)speak German.was given to send armies beyond the}Trtesday night anc Wednesday ee —3 ‘their castle hall last evening paid]The submarine was the U-2.Bruce|sea,he said that there was no ex-|morning saw the German Crown a i tribute to the 20 members of the lo-|did not learn the commander’s name.|press power to enact the criminal|Prince delivering heavy agepest -at-|Outside military men there 4 eal lodge who have ent red the mi'-|'The Campana was sent to the bot-|laws of the United States,building|tacks against the newly -won probably not one in a hundred . ery service.A_receipt for all dues|tom by bombs after her crew had/of the Panama canal or to pu French positions northwest of Ver-|can determine the rank or .the period of the war,enclosed|been allowed to return and get their}Alaska.“This has ali been done,”|dun.At several points the Germans/|service of the soldiers by fm a neat pocket erse,on which is|personal effects.Directions were|he said,“under the great power to|succeeded in re-entering them.These|forms.Lieutenant - the address of the bearer in gilt let-|yiven to Bruce by the submarine)promote the general welfare,just ag)positions,however,shortly after-|L.Flanigan tells us how to do this, “ters,was ziven to each of the 20.|commander how to reach the near-|the selective army will be created |‘vard were relinquished to General|An infantry private wears Only five were preset to receive lest port.He told him at the same|under the law here assailed,“to pro-Petain’s men under fierce on-jolive drab and canvas |them in person.e formal presen-|time that he had heard wireless mes-j|vide for the common defence,”and|slaughts.North and northeast of|blue cord around hat.Cavalry “tation address was rarde by Mr.F.|sages exchanged by two French war|beyond and above ait,is the inherent Verdun the Germans made similar|vate same uniform,with yellow cord EC f;Sherrill and the response was by|vessels in the vicinitg und warned|power of orem nation,however or-jattempts to re-capture lost ground,|around hat.Artillery sam i Col.Flanigan.him not to allow himself to be picked|ganized,to utilize its every man and|but the artillery and rifle fire of the|and red hat cord. its energy to defend its liberty.”French forced them to desist.Wed-|A corporal has two Tee ne rm nesday afternoon foundtheGermans oe =sleeves; Red Cross Meeting Shanrer|stgesentiycued 00»rece ot ete ereeent nae hat toedam Hall—Volunteer Knitters Called efforts,for their infan-|lieutenant a and The meeting of the Red Cross So-try kept to their trenches and only|der straps blank,leather $ jae eats we ccocmule oh tee out the artillery was in action.More /first lieutenant,same except one right sey ee gtteeness oh 480,hes than 6,000 Germans have been made|on shoulder strap;captain,two bars One sean changed to Shearer hall,Mitch.|Prisoners during the three days of|on shoulder;major,gold leaf on H es i ra the same hour.°fighting in the Verdun —shoulder;lieutenant colonel,silver . “"This meeting is to enlist knitters On the Aisne front the Crown leaf on shoulder;colonel,silver ea-|Stewart “4 ry nt a from the town er Prince still continues his attacks at|gle on shoulder;brigadier : owe a og a.bak,of whe are various points along the Chemin-|one star on shoulder;major general, Sitti y 7 gFon .Se ad to vole Des-Dames and adjacent territory,;two stars. or ta ae i.urgent call -—he been able to dent :Crossed =>collar denotes in- if peat a {the French line.antry;c¢sabres cafvary; —Unit oe —yon rg ane |The new territory taken by the|crossed cannons artillery;serpent ne t a ee oss a French embraces positions that have|entwined around staff,medical offi- prt ~~oe goby <_as rican sol.|ivetally weltered in French and Ger-|cer.;a P diers and the soldiers of our allies —oo —Run Over By Automobile.No.11 the ae a 4,—.Crown Prince started his most costly|_Fayette Moose,who lives at the}were ‘rom Major Grayson Murphy,oW|cnterprise,the attempt to take Ver-|Sharpe mill ,was run over by|curred.”a |Following there was an open ses-|up by them.“I am going to sink ‘sion in which informal talks were|them,”he said. “made by a number +f members and|Bruce and his men nevertheless 4 and cigars were followed|took the chance,encounter a and sandwiches.French warship after floating about |"The Statesville ledge is very|in small beats until 6 o'clock that ay of the fact that out of a res-|night.The warships took ent membership of about 100,20/aboard and landed them in France. ;have volunteered for the war,and!Bruce said he was told by an officer hich tribute was paid the 20 in talks|of the war vessel that he had heard ‘by their brethren.Following is the}a wireless message from another list:French cruiser saying that it had Lieut.Col.R.L.Flanigan,Capt.|sunk a German submarine in the vi- RB.A.Campbell,W.C.Ramsey,First |cinity of the place where the Cam- N.C.Infantry;with Troop A,Lin-|pana had been sunk.Bruce said it /coln cavalry—-C.W.Boshamer,Jr.,|was only a matter of conjecture as Geo.Feilds,C.C.Mills,H.H.Nieh-|to whether this was the submarine olson,Paul F.Ward,J.Richard}that wrecked his vessel,but if true |White,Robt.A.White; riedmont/he feared it meant that Capt.Oliver |battery (Mooresville)J.N.Kin-|and his gunners had perished. enid,L.N.Mills,J.B.Rogers;hos-|“When Captain Oliver and the 3 ee —s==f er s ital unit,John Martin Barringer;|other prisoners went below on the]!F ais 1 vers’Reserve Corps Licuts.G.lsubmarine.”onid Bruce,“the U-bent |7 cnmes,S070:ale 1 for ium Which resulted in utter failure|an automobile driven by Jailer H Last winter broke the record for).a military maneuver and cost the Woodsides Tuesday morn 4 C.Kimball,O.W.)ieconard,Weston|captain said they would be treated L.Taylor;second training camp,|as prisoners of war,landed in a few |Fort Oglethorpe,D.¥.Mayberry;|days at a German port,where the under orders for France,Licut.John|captain said they would be given ev- A.Scott;with Kentucky troops,|ery opportunity to send word home Scott Krider Weod.to their families.I was allowed to take a personal message from Cap- Leaving For Fort Oglethorpe.|tain Oliver to be delivered to his Statesville’s delegation to the sec-|Wife... ond officer's training camp are leav-|“The blue,jackets with us were a ing for Fort Oglethorpe.Mr.D.F.)same lot.When the last shell had |Mayberry left Wednesday;Mr.H.|zone they would have tackled the ©.Privette Wednesday night;Mr.|Germans with their revolvers had Raymond Allison,who is in Detroit,|the word been passed to them The Mich.,will probably go direct from captain said his instructions were to sold and misery among people here.|jives of tens of thousancs of his)Painfully hurt.The accident hap-|lives Inex —=——,Lig men.French airmen materially aid-|ened beyond Capt.W.H.H.Greg- acl gy us wit 7 See on ct the infantry in the press forward,|ory’s.Mr.Woodsides was coming a .—_—,uree ao on|.wooping forward and emptying their|‘©town.In front of him were some or aitien wih suffer in the —.—ig ~——aoe as ee es bee an Morrison ‘PS,fights in the air with German pro-|“Mr.Harleefronen,tenchen,and leg thowrards |ecing machines We ogeewat walking lone ti-|who reed Me mann ‘epatriotes being returned through .a canopy of mist the Cana-We to the pasty bus.r-\eree from the University of 4 Par pr cl ee inva one |ans and Germans met at daylight |Woodsides started around bug-lia on June Ist,this year,has q Tt ek —OY |in the open of “No Man's Land,”|by and Moose s out in front!elected to the of 4 here ooks _ee —2 nt northwest of Lens,neither expecting of the machine.e machine knock-|omatics and in a Singet emee Le cee ee,oes their sur-jed him down and passed over him,|Military College,Terrell,, cnt 1 “The:&jee —we re-|prised foe with their usual intreped-|breaking his left collar bone and al-|Morrison will leave September eee h siorag a f short.|\:37 the Canadians put the Germans |80 injuring his right foot.None of |for Terrell to assume the duties cold weather,and in view of short-|.)'the bayonet and forced them to|the wounds are serious.his position. there to Fort Ogi ;M _|take ail American gunners and cap-.’> on 1 Adit —p.F “Wal.tains of armed ships prisoners.ile age of fuel and.discomforts they jscurry for a seeming haven of safe-Mr.Woodsides brougnt Mr.Moose|ft is the aim of this college to es- lace will leave today or tomorrow,|said,however,he was sorry the bo lp goes sa =ae inside their trenches.Here,how-|to Billingsley hospital,where the}tablish a summer camp fext sum- Mr.D.M.Etheridge and family,United States was in the war be-|™!itary and civilian work.ever,the Germans apparently were wounds were dressed,after which|mer in the mountains of western The articles wanted are sleeveless||,more secure than in the open,for|Mr.Woodsides took him home.North Casetine.‘The canse he hated to fight Americans, cadets sweaters,wristlets,muffler or scarf,|:cegeergyretpsemen . y :gain with the bayonet 1 with thei °|again e bayonet anc Iredell Party in Raleigh.er with r cavairy horses,been liviwhohavebeenliving here for some sewhe hed always found them Pek time,Mr.Etheridge having employ-;and socks.The local Red Cross or-.: ment in t .ffice,lef ;-|ly and good sports.Americans,Me ee :TORS OT-|bombs the Canadians did great exe-:"ficers,the faculty and spon- terday ea _th.said,will always fight to a finish..ee —to furnish tion,killing or wounding many of Mr.G.E.Dull,who is in Raleigh!corg,will leave Y correll,by er and children will live while|He had no i.or the —t the};es ok Te Ganke le.(he eevee and putting _.ers ao ~se oe an cats,on June 15th for the Mr.Etheri ,|English,though,especially the Eng-)°":le!sy Might.West of Lens,aided by a/agents of agriou tins,oe and return on August 15th. eridge is at Fort Oglethorpe heavy artillery fire,the Canadians thirteen Iredell boys who are taking =4 Messrs.Minor Adams and James |!ish.” Pressly,who were ai the first camp,|Nothing New in the Stikelenth-Officer in Aviation Corps.alee advanced:pushing the Germans the short course in agriculture at the Lightning Struck House. Lieut.Gilliland Stikeleather of |farther into the environs of the Agricultural and Engineering Col-During the thunderstorm 7 =this week for the sec-er -Nicholson Incident.,sheville has gone to Fort Samjtiwn.To both the captured posi-|lege.They are Cullen and Herbert afternoon,shout §&o'clock,3 Mr.C.D,Prather of Mount Airy|Nothing new has developed in con-|Houston,Texas,where he is assign-|tions the Canadians are holding te-Lentz,Jay Feimster,James Dunlap,ning struck the residence of :q ts visiting his sister,Mrs.T 1).|nection with the exemption board ed to the aviation division of the ‘ig |naciously.Jame:and Jesse Gudger,Virgil MC.Davidson,near town,a Webb,en route to Tort Oglethorpe,incident of Monday,related in Tues-ial reserve corps.-|Kast of Riga,between the Tirul Greer,Forrest and Dwight Sharpe,a hole th h the wall —ie a where he will take the training.day's Landmark,in which Mr.T.M._Lieut.Stikeleather is 1 son of Mr.'marshes and the river Aa,the Ger-|Ray end Key Barkley,McFarland boarding an plaster —about § Mr.Barron P.Caldwett of Lincoln.|Stikeleather and Dr.W.G.Nichol-|Fergus Stikeleather of Asheville.mans in a new offensive have forced Woodsides and Clyde Howard.size of a man’s fist.Three or 4 ton,who lived in Statesville when a|son were the principals;and it is the latter a native of Iredell,Lieut.’hack the Russian advance sruards More than 600 boys and 80 county chickens under the house were 5 boy,is a member of this second probable that the incident is closed Stikeleather was past the draft ase,|from one to two miles.__|demonstration agents are attending |ond a at the well house was a training camp.He in-a con of the|unless the Federal court takes ac-ee ee ee aptet eating Se us the meetingin Raleigh._coastol tne.j ...:m io tery P earned ou V ‘ Rev.D.G.Caldwell and aj tion.reserve corps,was commissioned first)Rritish ="French aviators over Soldier Hurt—One Recruit.a gon in on Ge nephe f Mr.L.C.Caldwell of}Pr.Nicholson stated that the facts Statesville.i =as related in The Landmark were —_—_-_——————correct,but he has no disposition to Bankhead Nationol Highway.pursue the maser.tee.ieteather y _}was in town nesday but he made ne ety et ,or no statement for publication,The of Reidsville,were here yesterday to Landmark learns that hesaid he had stir up local’interest in the Bank-|2°,Purpore to attempt to bribe Dr. head national highway,which the Nicholson and his friends do not Qe ropone %tobuild from think he had such purpose. ashington,D.C.,to Los Angeles,Cal,at a cost of |$83,000,000.The|yan =Bs ee.- billas prepared provides for the Mr.James Jos inish,aged6 route of the road from Washington|°°"died yesterday morning at 7.- to L rg,Va.,and on to Atlan-45 o'clock at his home on Seventh ta,The party here yesterday ix street.Death resulted from dropsy, >diese oi agnge Golre™,wn Sas suffered since routing and send the read Rich-last fall.Interment will be today at Cotombia,|Helly Springs church,Eagle Mills ,:.ire.unately no liewtenant and a few days ago re-|German positions in Belgium and in-Corporal J.D.Morrison suffered ¥<a ceived orders from the War Depart-|tensive og fighting is in progress.|broken collar bone Wednesday ~family was In that of ment to report at Fort Sam Hous-|Zebrugge,the German submarine |night.He had been out in the coun-|ro the shock slightly‘no ole wae ton,Texas.As comparatively few tase in northern Belgium,is report.|(ry and was returning a@ the|nurt y men beyond the draft age votunteer.|ed to have been heavily’bombed Buffalo Shoals road.Near tian i, the course of this descendant of Ire-|ngain.In fights in the air the Brit-bridge he sto to take in two oth- dell is of special interest to the|ish Tuesday accounted for 17 Ger-/er soldiers.ec horse jumped and friends of his father in this county.)man airships,but 120 of their own threw the buggy down the embank- |machines failed to return to their}ment.In the fall Mr.Morrison's in- Cars in Collision.|haeae.jury resulted.He was taken to jack Cowan,son of Mr.D.0.!The loss of British shipping sunk|Long’s Sanatorium,where the wound Cowan,who operates an automobile|>y mines or submarines continues at |was dressed. for hire,was in a collision with an-'|the low-water mark.Last week only|One new recruit,Dewey Johnson, other automobile Tuesda afternoon.|~vessels of more than 1,600 =has enlisted with the Blues. Jack’s passengers were Messrs.God-|4 three of less tonnage were sun 7 a ; frey Kimball and Loeke a and|a Oe f=oy a OP me they were en route to Elmwood.|Soldiers May Go Soon.Western dist *»called by They met another car,which ran|It was reported thir week that |Chairman W.B.Gibson to meet here mond,Va.,and on to township.into themon a curve,badly damag-|Compan Id rders t y tobepeapoints |a opm Mr.Minish is survived by a wife,ing Cowan's car and deine sll ht e "sam rrow for Camp Sevier Spee ta Ses lee betel in vse sons —Baxter and —ie damage to the stranger's car.°"1%.Up to Bw night nolthe district will be considered and P —four =_re,»~orders been received.other business transacted wrth vaiting,party yesterday,aa Neiahhorn,Mra d cf Lgperi,rs Eee cone at Shelby a ;a “ that send a committee|Jonn .L A telegraphed|few ago that whileheexpected WESTERN SENT. to »Va.,Monday to sister Campbell of|identi-|orders tto Camp|The 4ist division, in the interest of north i fication theChisTog|",aah Seser Sn ee et :te sin etheryto,arcome|wil ot Statesville peopl |Rice,,and Cowen|Al stntieate thet |ed to Camp Charlotte. % -a’ oy Een —Creek ree _ee camp with camp been aban- el he massesthemoney xcess Baggage For Soldiers mothers,doting sweet-kind friends must notmenupwithalotofcomfortswhenstarttocampber5,ProvostGeneralCrowderrules. men in training for can-I be allowed to take veryareabsolutelytaboo.and handbags will beTheWarDepartmentprefersthateachbringonlytoiletarticlesaoneoflinenandunderclothing,in a neat,small bundle.Seppe of each man’s local boardinspecthiskitjustoe= rejecting everything t hasthereinandreturningthea»his relatives.1! men,”said a draft official, not going on a vacation trip.areRive to study the businesswar.y will be supplied withnecessaryclothingandequip-they get to camp.Allmanneedsis5piecesoap,collapsi nking cup,a few handkerchiefs,an extracollar,suit of underwearsocks.” “wide foodunderthefirst of the foodCongress, survey,au- y by the of Agriculture.for the census show that itilcovernearly100itemsoffoodandwillimeludesuppliesonthefarms,in warehouses and stores,and even the stocks in the familypantry.A _.survey will be tak-en first of supplies of 18 of theprincipalarticlesofdietandproba- i bly can be co in three orfourweeks,to followed by acensusafterthecropsareAllofthefigureswillbeasAugust31.Information gathered by the de-rtment will be turned over to the‘ood administration,«sich will base its operations largely on the statis-tics supplied.Estimates of the foodandfeedproductsonfarmswillbemadeforthewholecountrybythebureauofcropestimatesthrough=picked co-operztors in the Germany and the Pope’s Note. Dr.Michaelis,the imperial Ger-man chancellor,at the convening ofmaincommitteeintherecentpeacepropos-al of Benedict had been issuedly,and not at the wishtheCentralpowers.The com-mittee was informed by the Chancel-lor that thePope’s notewouldbe an-swered =after the closest consid- The preliminary reports of thesessionoftheReichstagcommittee the Reichstag. indicate that the parties are divided i on the Reichstag’speaceresolution.The conservatives,national liberals and Germanicgreapearedeclaredtobereservedtheiropinion,while the Socialists,|radicals and centrists are said to ap-prove of the "s action. SUIT ON ACCOUNT OF WRECK. Suit_is to be entered in Mecklen-burg Superior Court against the railway for $15,000 dam-~account of the death of Prof.;E.Walker,colored,who waskilledinthewreckontheA.,T.and ©.railroad,between Huntersville conis brought by the aw |it the widow of the)dead man.Walker was for some)Beraiets member of tne faculty of|it University in New Or- ES ASNaFORMEXICO.| More than two f |pleading for:financial quuetense,tn} ed thet -_a1 Sia.onothenayconv ere > frowntothe extentShartestsa=catending | summerfamily Rota as man,abide by it after Secretary|president of the Council of National| they | thing like 1,500 men will go to ‘camp for training purposes and ernment has been assur-|days.merican money can be ob-|e to American bank-|Gastonia,in the Carranza | loan.Mexi-|Goldsboro. $2.40,$2.65 and $2.15;see eastern is $2.30,$2.55 and $2.05;on jellico is $2.40,$2.65 and The prices fixed range from 20 tounderthemaximum cials and operators at a conferencejmorethanamonthago.The $3 agreement,however,did notoperatorsrefusedtoBaker,as Defence,repudiated it as too high.Prices recently have ranged farabovethe$3 limit.The fixing of prices was the Pres-ident’s second step in the directionofcoalcontrolandwastakenunderauthoritygiventheExecutiveinanamendmenttothefoodcontrolbill.’ The President's order apparentlymakesnoprovisionforapoolingar-rangement,which had been suggest-ed,under which mines would havebeenpaidfortheiroutputonaba-sis of cost of production plus a per centage of profit.Under this plan all coal in a district would have beensoldatthesamerate,but the mineswouldhavereceivedcommensura-tion based solely on costs. The plan adopted,officials admit, will work hardships on a_great many of the smaller mines and may force some to close down.This,itisclaimed,will not reduce the totalcoaloutput,as miners released from the small mines will go to the large ones and more cars can be suppliedtominesoflargeproducingcapaci- ty.Operators from all the bitumin-ous cea!-preducing States met in Washington and organized thetionalCoalOperators’Association,to promote co-operatrve effort on the part of coal producers and co-opera- tion with public officials,especiallyduringthewaremergency. LAARTO Aviation Camp For State. Wilmington and Fayetteville are making a fight for the aviation school which will be established at either Morehead City,WilmingtonorFayetteville.A few days ago theWarDepartmenthadpracticallyde-cided to give the camp to Morehead City,but now it appears that eitherWilmingtonorFayettevillewillget the prize. It is considered that an aviatoin school is really more desirable for a city,from a financial point of view,than a cantonment or National Guard camp.The moral and finan-cial effect is not so bad.There are not as many men in one of the avia- tion schools,but as a rule they areofahightypeofmenandthereforemoredesirable.It is estimated now that some- the in- cluding those who will work around the place something like 3,000 menwillbeonhandatalltimes. SALRATENTERLSTIE Negro’s Gift to Orphanage. Raleigh News and Observer. Handy Wilder,a well known col- ored farmer of Franklin county,has ,donated $2,600 to be held in trust by the Raleigh Savings Bank and TrustCompanyforthebenefitofthecol- ored Orphan Asylum at Oxford.The asylum is to get the interest of this amount for 25 years and at the endofthattimetheprincipalgoestotheasylum, is gift,it is thought,was actu-ated by the gift by C.8.Vann,manufacture;of Franklin,of $10,-000 to the Methodist orphanage at Raleigh as a loan fund for orphans who may wish to continue their edu- cation by going to college after fin- ishing their studies at the orphan- 70;Kentucky jel-|Tennes-| Na-| out his threat to stop this State is 25.In Penn-work.sylvain,Maryland and West Vir-\"'in order to ascertain what“|ginia,run-of-mine is $2,prepared|services the Navy League donesizesslackandscreenings$1.-during its existence,a of the[es eee Rover (Wee uecoal financial statement of the for i slight)gher —ae,“8$1.90,:.Kentucky coal teal >Ana March Si,WEY,wa: This report shows the remarkable{fact that the League,during the|year ending March 31,1917,collectedthesumof$129,822 from patriotthroughoutthe‘ ts In cther words,the Navy League’sofficialreportshowsthatduringtheyearendingMarchitspentingiftsofficersandsailors$1 out of approx-imately $165 collected.This reportshowsthattheNavyLeaguehassetanunprecedentedrateofexpensefor the expenditure of moneys on so-called charitable purposes.New Yorwasastoundedrecentlywhenitdis-covered that so-called charitable or-ganizations were spending $1.50 todispense$1 in charity.The NavyLeague's records appear to be abso- lutely unique.Here is the balance sheet:berships,$61,665;renewals,$14,-706;contributions,$51,673.54;as-sessments,$711.75;miscellaneous, $1,065—total,$129,822.Expenses:State committee works,$10,574.18;speaking campaign,$8,- 277.61;membership extension work. $23,124.17;woman's section,$4,706.- 24;comforts committee,$286.25; salaries,$10,776.62;traveling ex-penses,$2,577.57;printing and sta-tionery,$23,946.20;postage,$9,956;rent,£4,383.50;telephone and tele- graph,$2,132.37;office books and di-rectories,$918.22;freight and ex press,$457.50;legal expenses,$500; publicity,$1,193;conventions,§8,- 831.46;war relief,$500;naval re- serves,$125;general expenses,$3,- 796.46;Sea Power Magazine,$18,- 328——total,$130,391.69. At the end of the year the organ- ization had a deficit of $569.51.As far as can be ascertained theonlyitemsonthislistofexpendit-ures that can be charged against the so-called charitable distribution ofgiftstosailorsandofficersandthoseundertheheadsofcomfortscommit-tee and war relief,aggregate $786.-oF60. Perry Belmont of New York,vice president and director of the Leazue,has resigned because of the League'sattacksontheNavyDepartment. Mr.Belmont says tne accomplished great good in the past, but on account of its attacks on the Navy Department in time of war hecanhevenofurtherassociationwith it.STS Senate Votes to Increase Income Taxes, Senate sentiment for higher taxa- jtion of incomes and war profits was given initial expression Wednesday by the rejection of the finance com- mittes recommendations and_tenta-tive adoption of provisions $72,000,000 to the war tax bill's levy and on AmericanandthatMr.Daniels will not dareto! ing in popularityeveryyear wit Forfurtherinformationregardingguns in gaugesrangingfrom 8to23,address,PARKERBROS,MasterGonMakers,Meriden,Conn,U.S.A.N.Salesrooms,Y.Warren Street. Fifty -ppl:License_Fifty -three candidates for law ii-'cense appeared for examination in|igh this week.The examinationiscolbyChiefJusticeWalterClarkandAssociatesPlattD.Walk-er and Geo H.Brown.The lawpassedbythe1917GeneralAssem-|bly put the examinations in the|hands of the Chief Justice and two!associates.The work is done the week prior to the convening of theSupremeCourtandthejusticesget$100 each fer the extra work.iThreeyoungwomenandthreeofthemaleapplicantsarecolored.|Some of the applicants are soldiersinuniformandmostofthemarewithinthedraftage. LEMON JUICE 18 |FRECKLE REMOVER! Girls!Make This Cheap BeautyLotiontoClearandWhitenYour)Skin!i Squeeze the juice of two lemons |into a bettle containing three vunces’of orchard white,shake well,and|you have a quarter pint cf the best!‘reckle and tan lotion,and complex-ion beautifier,at very,very small cost.Your grocer has the lemons andanydrugstoreortoiletcounterwill supply three ounces of orchardwhiteforafewcents.Massage this, weetly ‘rarrant lotion into the! face,neck,arms and hands each day and see how freckles and blemishes disappear and how clear,soft and! white the skir becomes.Yes!It is} harmless. te Big 25c.Clearance SaleWillContinueAllThisWeek ———Or until we close out. 1 lot Hats,sale price,-25e1lotMiddys,price,-25e.1 lot Collars,sale price,:25e.1 lot F sale price,-25e. 1 lot sale price,-25e.1 lotBaby Caps,sale price,-25c. We also have a nice line of White and Colored Skirts we are offering at a great sacrifice.See our line and be convinced. MRS.MARY SIMS. The Cash Store. m realize the utter weakness|ambition,destroys appetite,|Then that ro,and makes work a burden, League has | ' ' adding! on individual “incomes”to surtax.|After three days’spirited discus-sion of tax increases,the Senate re- turned to consideratiqn of —commit-tee amendments and voted 74 to 0 for Senator Gerry's amendment to yreatly raise sur-taxes on incomes | exceeding $500,000,estimated to se-! cure %46,225,000 more revenue.Itquicklyfollowedbyvoting,with small majorities,to retain the House sur-taxes on incomes from $60,000 to $500,000,including the so-called Lenroot amendments.This is esti- mated to add $26,175,000 in revenue,As the revised House bill former-ly stood it was designed to raisefromindividualincome$417,764,000 in additien to theunderthepresent law. That the Senate's decisive standforinereasingincomeratesmaybe the forerunner of further materialincreaseswasadmittedbyleadersopposingdrasticadvances. age.Orphans may borrow moneyfromthisfundontheirpersonal note,to be paid back after securingtheireducation. Transferred For Duty in France the rance Steps preparatory to sendinentireNationalGuardtoweretakenthisweekwhen420 men|in the various companies of NorthCarolina,South Carolina and Ten- nessee now stationed at vier,Gréenville,S.C.,were trans-ferred to the One Hundred and Sev-enteenth regiment,United Statesengineers,with intimations thattheywillbeinFrance Among the men trans$erred wemembersofNorthCarolinainfantrycompanies,om —are roldsboro,ayettevRaeford,Clinton,Durham: engineer company at Wilmington a the machine gun company at _SETAEATTN MOBILIZATION DATES. ate annonrementraft hasheenfromfeptember15toincrementfromSep-t 30 to October 3.date for the first inerement is‘o—_-=five GRA Camp Se-, within 60) ib ;hasrethroat,diarrhoea,full or } | { jamountcollected. } |' ALL CHILDREN LOVE “SYR.|UP OF FIGS”FOR LIVER,AND BOWELS! Give It When Feverish,Creve,|Bilious,For Bad Breath or| Sour Stomach!|Lookat thetongue,Mother!If]coated,it is a sure ~~that yourlittleone’s stomach,liver and how-els need a gentle,thorough,cleans- ing at once. doesn’t »doesn’t eat or act nat-jurally,or is feverish,stomach sour,veut bad;stomach-ache,sore teaspoonful of “Calif in";a‘wu _orn yruFigs,”and in a few hours all osifconstipatedwaste,undigested\foad and sour bile gently moves outofitslittlebowelswithoutgriping,jand you have a_well,glastl childagain.You needn't coax sick children totakethisharmless“fruit laxative”; ish,cross,listless,pale,| on ae SSae Pe eswaysongot sk your for a — |Torestorethat strength andstaminathat |is so essential,nothing has ever equaled |or compared-with Sectt's Emulsion,be-| cause it:strength-sustaining nourish-|ment invigorates the blood to distribute energy throughout the body whileitstonic | value sharpens the appetite and restores health in a natural,permanent way.If you are run down,tired,nervous, overworked or lack strength,get Scott'sBumuisionto-day.It isfree from alcohol,|Seott &Bowne.Bloomfeld,N.J. OSTEOPATII. Dr.S.W.Hoffmana.OFFICE OVER Merchants’&Farmers’Office ‘Phone,324;’Phone,279 Green. Doors,Windows,Mantels, Locks,Butts,Sash Weights and Cords,Sash Locks and Lifts,Hinges,Pad-Locks and Hasps and Staples.C.WATKINS,N.Center Sstreet. Bank. House ————— “TOBACCO FLUES. Don't take chances on curing your Tobacco with old flues,for the price of Tobacco is the highestthisyearinhistory. We can make you the best price on flues., Write or _—us.We can make delivery the day you order! STATESVILLE TIN CO. "Phone65,114 EB.Broad Street. SLACKER And nobody wants a slack Tire. Unless you keep your Tires re-paired you have a slacker with [ | THE || i you at all times. &SUPPLY COMPANY. Phone 201 Full line Tiresstock. Court and HAVEYOUBEEN SICK? The Thoughtful HusbandSupplies ‘His Wife With No man wants his wife to work her fiHewantshertohaveeverythingthat will make her workeasier—save her time —give her leisure—for this makeshomelifebrighter,happier,sweeter. she is all fagged out by needless work. McDougall Auto-Front should visit this store withoutdelayandlearnhowitcutskitchenworkintwo. Modern Kitchen Helpers.) to the bone! No wife can do herself and her family justice,when Eve woman who does not know the value,of the wane _Eucomuce louse. A Regular Picnic For you if you carry one of our new Thermos Bottlesonyourouting. We have large,small and medium.You can servebevjusttherightandyoureerighttemperature, Keephot or cold indefinitely.Indispensible toautomobilists.° We'll beglad to show them toyou. POLK GRAY DRUG CO.“Onthe — wet Gre“TRINITY CC :DURHAM,N.C. .%,. eS ee es ly anetae”now a "LA TEa leia | os it »E CAN ota _—,—Poa a .. res of How DoDieonthe The fiercest engagement on the | the Lanamark:Canadian front since the beginning ad-'of the war is om a triumphant by ofenemy,says the Associatedonecoroneneunderdateof Since the capture of Hill No.10_St.Laurenton W morn-|theiree.7 pe to #military and vocational.E+!cessation to sek the counter-at- man,when he comes in,is tacks.The leaders of the German in some special line troops are utterly regardless of the has a dozen lives of their men and as soon as one i division has itself in a frantic and futile effort to recover the lost ound,another is sent forward to’> aeonson andjustquit teking the dizzy spells,..1 took time nor I've never For a bag of Davis Bros. Graham Flour,fresh lot right from the mill" Don’t forget that we have anything you want in the way of Spices,Vinegar, Extracts,Rubbers,Jars and Jar caps. Phone 89. FINE LOT COUNTRY MEAT. Miller-McLain SupplyCo. ./many acobson were in in New 4 gun.are over a sacrifice, York this week ¢nee con-different trades in the navy w#+The fourth guards were cut to —The man who buys one of these opiring inst the ¢elective draft evy man must know his \pieces in counter -attacks,and dur-©: act.n was a seluphaty battleship is one great machine and|ing the night a new division,the ©machines this year wil)get it for " anaes o *exemption hones oe -of experience to _=brought a.at ay le j in a ti :a gece to nt of Justice them,which is true of all ships.nrough their own lines without »lon agents ev e against these to a little submarine.You would be!stopping,these fresh troops attack-©8s money than for 8 es ome to a men will show thav Jacobson acted surprised at the machinery it takes|ed at 4.30 Saturday morntng on the ;come,as prices will be much a as a “drummer-upphysician,who is vranting exemption to JafterJacobsonhad accemarkedmoneyfromLevy.Seligman,|@rmem-‘t is stated,wasnot aregula of trade”for the |to run one. charged with|acquainted with Levy costing $20,000,000, $75 in it costs When one whe isshipsreadsof onehewonderswhy so much.lgokshipshe would begin to see. w not|Bois Hugo sector,north of Hill No. If he could take}#*». at some of the latest battle-|tive barrage 70.The attack was accompanied byaprojectionofenemyliquidfireandOurartilleryturnedaneffec- upen the Germans,which caused heavy losses,but theycontinuedtoadvancewiththeut-, & it i s : Sl a i n ! |‘TheSouth Fallsin Line.of |the rate of 40 \tronized Paw +Paw was unknown in|You will see |Vi a,ig and South Carolina|™ hada‘the old reliable Paw - Harmony High School. A FarmLife School For Girls and Boys. —SPECIAL COURSES IN— Home Economics,Agriculture and the Manual Arts. Prepares for Collee and Universi- ty entrance. Fall term opens TUESDAY,Sep- tember 11,1917.(En;rage board now at Dormitories. For further information and new iNustrated announcement write to R.H.LANKFORD,Principal, ter of the board bat had volunteer- led his serviees. jadded these two important items to, 'treduced this great and new remedy \nave the remedy at hand -you! —na aSeR aVICTORYeeeASSURED.a A short time ago the name accustomed to hear of 'Paw Tonie.‘ The march of progres:and science breught fren a Nux to universal use,then our chemists got busy ane the original Tonic,m use for thepast25years,making a compound of three powerful forees into one,now known as Tronized Paw-Paw. Since January 1,1917,we have in- nto nearly every city and town in ovr preparation.Remember!“IT IS Paw for the stomach.Don't trifle with your health.If you need a tonic,are run-down, nerves disordered,or stomach weak and troubled,seek no further.You lronized Paw-Paw,whick has stood the test of time.|fremzed Paw -Paw Remedy will ido more to brighten the world;to \dispel gloom,to make happy homes and strong iron bodies,than all the medicines that have been compound- ad.The evidence we are publishing, € Your druggist probably keeps it,but if he doesn't,it is sold at the vromptly attended —to.Statesville Drue Co.,Inc.,New York. WOOD SAWING Am ready to saw your wood,-Please see me or '‘nhone me—421_Black. T.G.WOOTEN. NOTICE! Commencing today we will discon- tinue the Jitney Service in the usual way and establish Schedules on the different prominent —streets.First to be operated will be a line from | } Harmony,N.C. Ntcceremeantnaitaniaenenemanreg—~ Material,,Pain C.WATKINS,‘phone No.43. _ WANTED!peraeataPr opourd.FOR SALE: andsecond hand machinery gale and all kinds of boiler roomsupplies. Cc.H.TURNER. fredeli "Phone No.74,Bell Neo. ‘Bloomfield (at W.T.Sumpter’s Store)via Front Street to Square and Southern Depot.This car wil! run every 30 minutes-—on the even and half hour.Others will be put on tater.Nu Schedule on Sunday. ‘of how much a dozenjeost—guns 63 feet long and that|m a|wei|she ithink of the engines a ‘takes to drive a 34,000-ton ship at berta {ment took over at the beginning of jiour war with Germany. Vaterland. heard of it as being finest ship long,100 lecks,nine above water. nest,or lookout,is 195 feet from the water and yet it lacksreachingthetopofthe mast. pool with marble engines,total is over 90,000-horse power,vessel has four propellers with guns ost determination.One of the most heroic deeds put the,Canadian corpsnisthatofa half a millionweighing1,400 charge of 375 Ibs. pene.fire a 3.,that takes|on record in of ;/since the warndboilersit}runner of Colonel Ormonder’s Al- battalion.The company to hour and|Which he was attached was hotly en- Uncle’s gaged near the chalk pits and he 'was given a message to take back to I will try to tell a little of the ship}the battalion headquarters,over am on at present.It is one of the ground on which shejls were falling Jerman merchant ships the govern- miles perwhereyour oney goes [Puy mn emnty:He had not gone far when he was the|-ecn to fall,and another runner was it once sent out with a duplicate of the message.The second messengerwaskilledmidwayonhisjourney, but two hours afterward the _first one arrived at the battalion head- juarters,with his left arm blown off near the shoulder. His terripnle wound had isread orlargest,is 950 feetandhas13 The crow's Ithaveall theYou afloat.It feet wide 30 feet of been Virginia and are now completing This ship will carry 3,500 passen-roughly dressed in the field and the North and South Caroiina.ou-vers and has every convenience and|messenger,tar spent from loss of snds of bettles have been sold and luxury that can be thought of —win-blood,had then staggered on to do in not one single instance has any ‘r garden,dancing hall,magnif-his duty,He was removed in a dy- |dissatisfaction n made known.icent.dining saloons,restaurant,|‘ne condition,but he carried his We stand or fall on the merits of amoking rooms;a large swimming|Message to its destination. trimmings;fineand|Christmas Cheer For Soldiers.\NOT A CURE-ALL”!We point the paintings,electric elevators,fire road to Health —-Nux for _the police alarms and many other things!fyery American soldier and sail- nerves Iron for the blood Paw-that go to make a ship ¢‘lor,whether at the battle front in The propelling engines are over 60,- 100 horse power. electric France or in training camp at home, ‘the mn ships at sea or stationed ashore, lis to have a Christmas remembrance ‘from “home.”a Cross . ,t :have just completed lans for e 18 inches in diamteer.It takes 48)05);\stmas cheer and "anaenense oilers to furnish steam and a ereW|wiil he worked out immediately. of nearly 1,200 men.|Red Cross chapters nearest the There are many more large Ger-army camps anc cantonments man liners we have taken ovef and).ij]probably arrange in their towns if the war does nothing else i®will|community Christmas trees with vive us a merchant marine.of which}.,rols,pageants and holiday movies we were badly in need.We will al-!+5 which the 600,000 men in training o have an army and navy of which).jj)be invited.For the men_in we will not be ashamed.:7 Including anchor motors,ete., every day should =te conclusive ;;:*ranee the Red Cross will see that proof._We are tied up in Hoboken,N.J.,¥every soldier has his Christmas |‘There is no guesswork about these just across the river from NeW}package with its message 6f good statements,they come from your York.I like New York and Brook-|will,There will be serprises in ev- ineighbors,from people you can go lyn fine and there is nothing like Co-|wry package,but all are likely to and see and from people you are Ney Island,the great amusement contain writing paper,pipes,tobac- ‘Lound te believe.place.Hope this will continue to be co,cigars and cigarettes and other A system that is overtaxed or run MY home port.trticles.The work of finishing down reauires a harmless stimulant.,Why don’t nome of the Irede}!Christmas allotmenses of comfort ‘trouized Paw -Paw hits and holds boys Join the navy?Are they afraid bags is going on rapidly.Most of T\them are made of khaki and are fur- of woolenofwater?Come on in,boys! have had eight months of it and like ‘nighed with extra pair Polk-Gray Drug Company's.it fine.The “chaw,”as the food is)\oeks,needles,pins,thread and but ironized Paw -Paw,price £1.For-called,is good and the pay is reas-'tons,Detailed suggestions of how mula on every bottle.Mail orders onable,The work is light,yet the +o wrap these Christmas packages ‘_for shipping will be issued by the tt is fun to see a “rob”‘that iS Red Cross,which wil:weleome co- what you are ealled when you first jperation.Gifts will be bought from some in)try to wear a sailor's uni-contributions especially given for form.It takes a month or two to'the Christmas greeting.—The Rea earn how toe wear one.But don't:Cross war fund will not be used for. let that bluff any one,for you can:that purpose earn anything if given time,and!Last year the American Red Cross tinele Sam will give you four years ‘ent presents of various kinds to the H.C.SHERRILL,U.S.N.men cn the Mexican border,and the narines-at Haiti and San Domingo. Juniors in Asheville.——$—$ At the meeting of the State Coun-|Heep the Food From Germany. ‘il of the Jr.Order in Asheville this)Manufacturers’Record. week,patriotic resolutions =were}ae lof eeeeneeae government and pledging the sUP-/6)to neutrals in izurope helps to vort of the Juniors to any movement 4,,‘Se,F f undertaken by the government for lengthen the war and i bring death the raiaing of troops or other action ‘eereen setter,;igo =peril necessary to the winning of the war 7 —_eat fu Mt .woti.°aS ~|(ering oO these neutrals.Mos o _ee —,—,"<hem have contributed liberally to .Uatatel .Mat int ee of those |Germany’s success by selling to Ger uniots calle!into service.many the stuff that has »cen bought life will make a man of you! rr . — t.RIDE THE JITNEY. JITNEY TRANSFER CO. Statesville,N.C. ~~SALEOFLAND.ne ue fopenoe ag iit will be}csom ous,er using the stu*bought ’:‘rin —«an ;a from us and selling their own staff w <ele aSt ate oa “3 ‘.>et me ae ‘hevi‘aq?m .e és ”~ac ”ar f “;~t \ag ,vd . Woodus Kelliam of Wilmington ment _=e vice councilor,W.A.Holtshous'r! gouthern cotton seed oil cake hasoftewaselettedouts'le¢jeen used to fatten the live stock of se PR i beneath Holland in order that Upe live stock | ~«@ at ae sh boone eee se might be shipped by thousands intoivcouncavebeeninsti-Germany.It is true that the Hol- uted in the State since his last re-land buyers did not ship the cotton NORTH CAROLINA,IREDELL COUNTY. Under and by virtue of an order of the clerk lef the Seperior Court of Iredell county,made in ing entitled “R.T.Weath- undersi OnMONDAY,SEPTEMBER 3,191°. |at 12 o'¢lock,at the court house door of Ire- l dell county,sell at public auction to the high jeat bidder for eash,the following described ‘treet of land,to-wit: |Firet Treet -Lying and being in Fallstown jtewnship of the aforesaid State and county. and beginning at a stake or small doywood in Keetler’s line,and evrner of let No,3 thence forth 14 degrees east 182 poles to a stake in the old tine;thence with said old line north 77 degrees west 31 poles to a stake or pine knot,corner of lot No.6:thence south 18 degrees west 182 poles to a pine knot or A t thence south Ti de-ing,contain.fot No.4 ike Josey 2= |#7 3k Aii Hl 'go to France. vort.Five have been reinstated, ‘five have surrendered their chart: two have been consolidated and nin: are subject to suspension,The pre ent number of councils in the State is 366 and the memership in the State is 39,282. Prank of Youngsters. Three youngsters of traveling in a pony buggy,drove up to Hon,W.D.Turner's Tuesday and asked for something to eat and feed for their pony.They stated that they were returning from =Fikin. were hungry and lost.All their re- quests were granted but Mra.Tur ner svon thought she recognized one seed into Germany,bul they shipped he cattle fattened on ti.covlon seed cake.If we are to realize the full mag- nitude of the war in wien we are gaged,we must rigorously,re- gatdless of the individual losses of nippers in this country,cut out all supplies to the neutrals which can by any manner of means be shipped through them to Germany or be made to take the place in these neu- tral countries of local stuff which they ship to Germany.We have not enough food for ourselves,and our allies are in danger of starvation. a 3 tie Lown, FAITH IN WARTIME. of the party and by questioning S00"Throweh ead unrest the world must had a confession from him.They||But growth remains whe Through war and ne and woeyeintehadgoneoutfor_” all live in town and ee Rternal wood woes marching on! ;9 drive.e‘or tyrants count!heron dle ORDERED TO COLUMBIA.janocent whed precious blood ;A generation marches | Local men recently commissioned ~And lof it war for brotuerheod! at Fort Oglethorpe have been order-a piltion wakened men may learn m ueiive duty teredtoreportatColumbia,8.(..°°Ang one soul's miners oe the 20th.It ia supposed that all A world to bronde spathy have been lered ‘el As well we know that cerry long ve ordered to Columbia ex Dark howr but make lowe the ligne, jeut..4 So we mast trust that ©-ery one ag Lieut.John A.Scott,who is to Will somehow bring us to the rivht The right which cannot be deniodThoughalltheworldecemmad and blind;SS Was the ain wher downs died,what a blessing to mankindt Be ever nite the world advance Alona the path of eaerttie:Vet aver heroes seize the cheneeproudlyfullypaytheprice 'faith that in the after years, :ine,se rng ai ea 740 Archie L,Stevens,a sergeant in the Raleigh motor truck company, which ix en route to a trainingkilledyesterdaynearbeingranoverby@ pywr=Es . i eee ee ee ee ee ee And Hay Rakes,McCormick Corn Binders and Shredders,These Machines you will need for the Hay and Corn crop now growing. higher later. WaySaghessSpxing a4 u meery A bedspring that can'tsagbecauseofthe patentédflex-j ible hollow strand construction; that doesnotroll you towardthe that isabsolutelynoiseless,havingnothingaboutitto thatconforms to theshapeofthe body; that basno loose strends,open links orsharp corsers Quartercentury guarantee.30 night's {ree trial. centerbecause it cannot tag;ail creakorgroan;, totearbedclothes.. ne STATESVILLE HOUSE FURNISHING PEACE INS1 : For the EducationandCulture Women. ¥ of Young ote Classical,Literary and Scientific Coprses leading to diplomas,, Graduates credited by State Department Education for Paint Certificates.Special diplomas awarded in Music,Voiee,Art andExpression.Excellent Commercial Course,Domestic Science, Domestic Art.INSTRUCTION:Specialists in all departments.tlh SITUATION:Location in capital city gives special opportunities. Delightful social advantages. ATHLETICS:Supervised indoors and outdoors by athletic direc-tor.Special attention,individual development.Climate permits out-door life all winter.For catalogue or further information,write at once toMISSMARYOWENGRAHAM, Sener eeseentntoeaacaeannusmareermeaietemnanicaeeeaaatana eee iain eae YOUR FAVORITE CIGAR.” e 2 ——In Condition,—— That’s Fit To Smoke. That's The Way We Keep House.” STORE OF QUALITY. Statesville Drug Comp’y INGERSOLLWarprice$1.35, DOLLAR WATCHSeemeifyouarein |of any kind of a Watch.I can_supply that need.In stock,Hamilton,South Bend,*¥altham,Elgin,New York Standard, iicliance, |Hb.We YIODWARD Jeweler, —— \NEW SEED BUSINESS, TurnipSeedinpackages and in bulk,Also a. y of other garden and FieldSeed. TN BiB cece ee nn eeDR.VANCE HASi\DENTAL SURGEON.Ronma 6-7-9,Becond Floor,FIRST NATIONAL BANK BUILDING, srpcial at 70 can Dee's Base,Case and ' ’ ey Fe niee sce }©.WATKINS. ot i td KS OF |oa a Dad a a F rant ,, sid a ae @ eh a 1 a i,ae a tonjail,He Iclosea.to 4lecthahog,so | The coloredpatients hatSTpenemete,cot oS set |teat te taliow,tet stoppedess’ did not 5 eget cine,wnat nesta tae sledingena‘haveteendeprived of reason —New-|and.damag-|o town |1,News.will be askedtown|F } ifue ,.andofbusi- thize withany effort to take in @ room at MorgantonasalackOfmon.They are more rare ness,the citizens of should°actual payment of big scope of country simply to make jeans to food those nov:there.The|:he regulars,‘who are better discipe|welcomethisnew addition to its businessmoneytomembersofexemptionashowingastopopula’;but it Legislature provided ample lined.district... a,TheeayetGao senna om —that ae neues ing funds.but,under the When troops were revurning from’’ a personal influence.In man settlements are m t ey f Ss %gcaseepuiitiendetbtlensfiguredtoantownboundaries,whether tho Snain.,wolgernau off |whe,Sen cansEiamine too ie one!Your Presence On This Occasion Will some extent in the appointment of purpose of the settlers was to be i to providetheseboardsandinsomecasesper-near the town and have its advan-aa:owl “Ke support.sonal and political favors may se-tages,without being part of it 80 practicable to take people to Mor-|every time the North ina Na-eure exemption which is not deserv-far as municipal burdens are con-ganton,even when room can be!tional Guard went to camp at More-—ed:and few of these cases will come cerned,or for other reasons,that it :pia e We to the name of to light,because evidence will be is unfair to expect that the town —of toe ee ©res Pomel gaycitizenship;ct |—_ne qos, }lacking to support a charge of dis-will never extend its boundaries.'we ‘ors of the Morgatiton|possi group on _this day—a record of friends andcrimination,although it may be ap-The settlers must know that some iscttieel ame a careful estimate |pon seas noms fe the|who.will|business associates that we will cherishrarent.In such cases the Governors time the boundaries will be extend-the needs of the institution for 1917-\be guilty of concuet.Some for all time to comeofStates,who are resvonsible for ed—as they must be if the town is jg and presented it to the Legisla-|jook at it as a joke;a few are vic-sdtheappointmentoftheboards,will given an opportunity to spread—and ture The estimate took into consid-|ious.The conduct,it mmouid be re-be held responsible-—and they should when extension comes they cration the higher cost of e ‘membered,is not peculiar to sol-, he.Any sort of favoritism by ex-should accept the situation.and it was figured that $262,450 per|diers.College boys and other groupsemptionbeards,for any reason what-It is said the extension will im-annum would be necessary for main-|cf men assembled for various pur-vvever,is an unspeakable outrage.pose a hardship on the industries tenance.A new building that would|poses are frequently guilty of suchForeverymanwhoescapestheserv-just outside,The Landmark does ,oommodate 100 women just |onduet,beeause,as said,there areiceassignedhim,another must serve not think so.There are many in-peony completed and the above esti-always some i ”every group who| and suffer;and the sending of one dustries in town —prosperous in-mite was for a population of 1,450 can't,or won't,conduct themselves Show Your Appreciation Of OurveSpirit, frequent-,ernment paid for property taken oritteeldestroyed”Im Garter pears almost “Look for the Garage with the Green Roof.” “WE NEVER CLOSE” nat entitled to go in place of one «ho should go,is a wrong so great thet it ean't be properly character- ized, TALKING TOO MUCH.The Greensboro News finds it dif-ficult to shed tears over the contin- ved J “outrages”perpetrated against Cae Wood —-every change of theeoneralbeingan“outrage,”accord-ing te Gen.Wood's extraordinarily vociferous friends.“Every time Wachington makes a move,”saystheNews,“it is to humiliate Gen. Wood.Every time Washington _re-fuves to move.General Wood is out-raged.Of course,to the mere civil- ian.civing a man a little more de- giralle job every few weeks seems a curious method of heaping contume- ly upen him;but perhans it’s a way they have in the army.” The Landmark doesn't know enovgh about military matters tosaywhetherthechangesofWood are promotions,as the News says,orademotion,but it has failed to see any evidence that the War Depart-ment is persecuting Wood,as hisfriendsallege.Gen.Wood's friendsave,in this paper's opinion,making themsel ridiculous by their con-tant howls,and they're doing theweneralnogood,for the impressiondmaybecreatedthatheisinsomeeasureresponsiblefortheconstant ticism,in which event his'etanding will suffer at headquarters.#t is the business of a soldier to obey borders,to accept any duty assignedhimwithoutquestion.If he doesn’tdothatheisnotrewarcedasagood‘soldier.After awhile the impressionjwillbecreatedthatWoodisn't anfidealsoldier,which may be a greatinjusticetohim,but it will be theifauteofhiscarpingfriends. EAA ONIN SED ,MR.POU NOT A CANDIDATE.i The Landmark mentioned in itslastissuethattheywerecharging‘that Mr.James H.Pou of Raleigh,'‘who is rendering the State and the7splendidservicethroughispublicaddressesonthewar,with being a candidate for Govern-jor on a war platform.The Land-mark stated that it had no idea thataPouwasacandidate,and the0)liowing letter from Mr.Pou to the!eae of The Landmark settles the “I write to say that your surm’seiscorrect.IT am not,and will not be,candidate for Governor;or for anyesofficeinthegtftofthepeople f this State.Over 20 years ago Irenouncedallpoliticalambitionsandspirations.I wonder now thattheyeverhadanyfascinationforz.The office of Governor is an onerable one;but its functions would be peculiarly distasteful to Were it ever to come withinmyreach,1 would deetine..,"You may make my renunciation ‘of all political ambitions as explicitesslanyuagecanexpress.Iam aprivateintheDemocraticranks.1desirenooffite;and IT am in no one’spray.” As strange as it may seem to gome folks,men can voluntarily ren- aier a public service without hope of ypersonal reward —-Mr.Pou being‘one.The Landmark regrets,howev- er,that M-.Pou has renounced allliticalaspirations.‘The =State y need his services in a public ca-pacity. *Lieut.Gov.O.Max Gardner,who is anid to be a candidate for Govern- r,can qualify as a farmer candi- te.The Shelby Star of last week "Lieut.Gov.Gardner is perhaps the biggest individual farmer inelandcountyandthisyearhe 165 acres in cotten and 168incorn.His erop in two sep-farms is the best all-round I seen.He has used fertilizer .his fertilizer bill for this $3,000,but he will make *of cotten and trom2100 ss to thrwe thousand bushels of dustries —that pay city taxes.They do not suffer on that account;the burden is not so great that it will be,a hardship.One of tnese industries,the Statesville Cotton Mills,is builtonlandthatwasformerlyinsidethecorporatelimits.At the requestofthepromotersofthismillthissitewascutoutmorethan25yearsago,to allow the mili to be outsideduringitsearlystrugglesforexist-|ence.As The Landmark views it,this enterprise has absolutely nocauseofcomplaintifthetown,af-ter giving the mill this favor for aquarterofacentury,now seeks toreclaimwhatformerlybelongedto it.The industries at Bloomfield may have,some ground for complainingthatthetownisreachingoutratherfartotakethemin,especially astheyhaven't been in existence so long as the Statesville mill,but thelatterhasnoclaiminequity.More than 25 years ago the townboundarieswereextendedquiteadistanceonthesouth,this beingdonebythepromotersofalandet.who wanted their property inside,believing it would find morereadysale.The growth of that sec-tion shows that the nea was correct.Where they could get cheap build-ing sites,settlers have located in-side because they wanted the advan-|tages of the town.On the north side the town line is within twoblocksofthesquare.That it should, be extended will hardly be denied.)The extension takes in much vacant|property,some of it farm land.The owners may think it a hardship to have to pay municipal taxes on this land,but bringing it inside will in-crease its value.It will soon brchangedfromfarmfandtobuildinglots.The families brought in willhavetheadvantagesofthecityschoolsfortheirchikfrenandbyandby—not within a few months butsoonerorlater—paved sidewalks, gradedlineswill begin to penetrate the new territory,and once they have these advantages,most of those who now object will be glad the exten-sion was made.There is much vacant property intheoldtown.It may be said thatshouldbebuiltupbeforethelimitsareextended.This is not possibleforthereasonthatmostofthis property has so appreciated in valuethatmenofsmallmeanscan’t af-ford to buy it for home sites.Thosewhowanttobuildhomesintown should be given the advantage of cheaper property now on the out-side.For the reasons stated,it iimpossibletobuild»town compact-ly,as desirable as thar may be.It must be given an opportunity tospreadout,and this wf?be accom-plished by the boundary extension. SSSI EENTOREYSPEER ESDonce RE EE TT Mr.W.J.Bryan is a pacifist,but he is also a patriot and he knows the duty of the citizen whose country isatwar.This he has admirably ex-pressed in a recent issue of The Commoner,as follows:“Before our nation enters a war it is perfectly proper to discuss the wisdom of going to war,but discus- sion is closed when Congress acts.After that no one should be permit- ted to cloak atatacks upon this gov- ernment or aid the enemy under the claim that he is exercising freedomofspeech. “No sympathy,therefore,will be wasted upon those who have been arrested for unpatriotic utterances.They abnse free speech,and this ap- plies to attacks upon the allies aswellastoattacksupontheUnitedStates.We can no more allow ouralliestobecrushedthanwecanaf-ford to be crushed ourselves.The de-feat of our allies would throw thewholeburdenofthewaruponus.We must stand together and fight itthrough.There are onty two sidestoawar,E American must beonthesideofUnitedStates.”The New York World well saysthat“since we entered the war nowordshavebetterexpressedthefirstdutyofanAmericancitizen.” LS HogsNear $20 Per 100, streets,water and light! people,a per capita cost of $181,The |estimate was cut down $25,000.The!directors protested knowing by|past experience that their estimate|was conservative but the protest|availed nothing.The cost of food}products went so far bevond the di-|rectors’estimate that if they hadbeengiventhefullamountasked|it would have been insufficient.As)a result the building that would ac-commedate 100 women patients isuntenantedandthecostofconduct- ing the institution up wo August Isthadexceededtheappropriationby about $17,000.e directors areforbiddenbylawtomakeadebt,but to take care of the veople in the; house,to avoid turning them out atofillallvacancies,they have had to|run ahead of the support fund,which| is inadequate. Under the circumstances,it can readily be seen that the directors, faced with a deficit for two years,with the present population of the,Hospital,could pot open the build-| ing already finished and add 100 patients,to say nothing of construct-| ing new buildings.The Legislature | issued $3.000,000 of bonds to provideadditionalbuildingsforStateinsti-tutions.The State colleges got thelion’s share,but the State hospitalswerefairlywellprovidedfor.TheMorgantonHospitalhasattemptednonewbuildingthisvear.What'stheuseofprovidingformorepeoplewhenvoucan't feed what you have?It is the purpose to begin next year.with the money allotted for the pur pose,the construction of new build. ings,which will be finished by thetimeanotherLegislatureassembles |—and it is hoped the next Legisla-ture will apvrovriate enough to supportthepatientsthatcanbehousedThesefactsarestatedforinfor-mation.One hundred additional wo-men could be accommodated at Mor-ganton right now if there was pro-vision for their maintenar.-e;monev\is available for new huildings andconstructionworkwouldhavebeenjunderwayhadthesupportfundoftheHosnitalbeensufficienttocareforthosethatcannowbeaccommo- dated.People who can’t secure admis- sions to the Hospital for friends andkinandotherswhoarejustlydis-turbed by seeing the insane in jail, where it is an outrage to keep them.will understand why.And we hopethatthesepeoplewillinterestthemselvesnextyearinseeingthatcan-didates for the Legislature arej,|Dledwed to make sufficient provisionfortheinsane.This is rarely if ev-er mentioned when it ought to bementioned—when men are beforethepeopleascandidateswhowillhavethepowertoremedythecondi-tions of which the News complains PAALLLCLD Publicity agents of the StandardOilCompanyhavebeenurgingecon omy in the use of gasoline.They'r pointing out that every gallon of gasolinesavedinthiscoantrywillhelpto win the war for the Entente allies bysupplyingpowerforarmytrucks,ambulances,ete.;wherefore joy ride: are urged,on patriotic grounds,to cuioutsomeofthepleasuretrips.Thatwouldbeallwellenoughandthere-quest should be heeded if it wos madebythegovernment,or if it was gen vine.But some suspicious body has unearthed the fact,or alleged fact that the Standard oil people get 40 cents a gallon for all the gosolinetheycanshipabroad;thet the reasontheydonotadvancepriceshereisfearoftheadministration;and their patriotic plea to save gasoline meanstosaveitforthemtosellabroadat40centsagallon.amenRAITT More Pay For Guardsmen. The Secretary of War has receivedfromtheComptrolleroftheTreas-ury a decision that will give to Na-: tional Guardsmen all over the coun-try from $10,000,000 to $20,000,000moremoneyeachyearthantheyhaddecisionoftheComp-briefly,is that men of the i roperly at all times.'While the publie will exercise qome degree of forbearance,it mustterememberedthatsoldiers,whomallhonorfortheservicetheyareex-pected to perform,must respect therightsefthecivilians.Commanding.officers should be strict and punish.ment should always follow these ex-|cesses.Wearing the uniform does| not give the privilege to commit ex-|cesses.On the contrary the uniform. ic disyraced and all the soldiers,thetoodaswellasthebad,suffer bybadconductofafew. Barring Treasonable Publica- tions From the Mails. =Masses,a Socialist magazinepublishedin’New York,was de-nounced by Postmaster General Bur- leson,in a communication to theSenate,as a leader in organized propaganda to discourage enlist-ments,prevent subscriptions to the)Libert®lean and obstruct the draftact.e mentioned the Jeffersonian,ef which Thomas E.Watson of Thomson,Ga:,is editor,as in thesameclass.'Mr.Burleson declined to givemorespecificreasonsforbarringtheMassesfromthemails,saying suchinformationwasincompatiblewiththepublicinterests.In response to the Senate’s resolution to inquiry,presented by Senator Hardwick,thePostmasterGeneralwrotetoChair-man Bankhead of the postofiice cem-mittee,saying:“From matter received by this de- partment from various sections ofthecountry,I find tnat there is anorganizedpropagandatodiscreditandhandicapineverywaythegov-ernment in the prosecution of thiswarwiththeclearandunmistakablepurposeofdefeatingtheobjectsforwhichthegovernmentwillprobably be called upon to sacrifice millions ofdollars,and will probably be calledupontosacrificethousandsoflivesThepublicationsformingapartofthisBDpegeroinmanycasessocuardtheirutterancesastheeditorsthinkwillkeepthemoutofprison.They are nevertheless united in pub-lishing the same class of matter.” EEE STELTEShirtLocatedDrowned Man? Here’s what they're handing FEd-_itor Sam Farabee up at Hickory,asherelatesitinhisRecord:‘““Mr.H.F.Deitz,who has finish-, ed a job of painting for the South- ern ilway Company at Catawba,related today how he recovered the!—of a negro cook who was drown-|ed in the river there.For two daysthestreamwassearchedtonopur-'pose and Mr.Deitz thought he would|try something else.He had heard,that a drowned man’s shirt wouldfollowthebodyandhehadthene-vro’s shirt placed in tne river where|the man went down,shirt|floated down stream and sank.Next|morning the negro's buy rose to the|surface where the shirt sank.“It was said today that the bodyofayoungmanwhowasdrownedintheCatawbaseveraldaysagoa” | recovered in a similar way.’ The campmeeting at Ball's Creek,Catawba county,began Wednesday.and will continue through Sunday. “NOTICE TO PARENTS. Notice ia hereby civen to all rents —,hildren of school axe that ¢intend to |end to shoo!in September,that it will be>necoanaty to have them vaccinated before en-|tering school unless they have already been|uecessfully vaccinated against smatipox.By order of the Schoo!Honrd.¥.A.SHERRILL,Chairman.3.C.POWLER,Secretary.Aug.24. NOTICE.| To my person who mayknow the where |]5 er Se,toes $e ae yf|ji Carolina Motor Company. Whether you drive your own car orchaffeurtheconvenienceofacar cannot employ a well be estimated.To the theatre,toa friends’,on a business call,anywhere and everywhere you want to go the car will take you quickly, directly and with ease, Nowdays The Car Is The Thing and Here Is The Place To Buy It. =o ee A Furnace With No Think of it!Stands in the cellar directly underoneregisterandpoursheatthroughallthe house.Warms to the fartherest corner andmaintainsatemperaturetherebuttwoorthreedegreeslessthanintheroomwheretheregister Heats by natural air circula- tion--scientific men say the most efficient and healthful way in theworld.Far more cheaply installed than any other sysiem,anddoesn’t re- quirethe labor and care. Phone or write for deserip-, }the interest of Mills Foston. Mise Aurctia Vance of Gainceville,Fla.,q@uest of Miss Margaret Brady;,from near Mooresville, Statensthein.Davidson,spent Wednesday night in »and left yesterday,accompanied by Mr. married last werk,have returned from their home »trip and are now at the groom's, Shiloh township. Mixa Greenwood of Elkin is spending, a week Miss Lucile Tharpe. Mine Cilla Summers is visiting Miss Lily Rostian at ber home hear town. Messrs.John D.Foard and J.H.Bostian and Mr.Fox,all of whom live near town,have gone to Biltmore,Hendersonville and ChimneyTheymade Mrs.J)DeWitt Ramee: Tuesday for Russellville,Ky.,to visit rela- tives.Mr«.W.G.Lewin has returned from a visit/ ‘to her daughter,Mrs.H.A.Miflix,at High’ Point.Mr.C.G.Prosperi left Tuesday for Natches, Miss.,on «business trip. Mr.Tom Boyd is ut home from Hopewell, Va.,where he had been employed.He will return to school at Erskine College,Due West,8.C.,this fall. Mrs.W.J.Bisaner of Ackworth,Ga.,ar- rived Wednesday to spend a few days with Mra.A.J.Durham at Mr,C.3.Tombin's. Mr.W..Tomlin and family and Mr.Ross Mitls and family went to Blowing Rock Wed- y.They will return home i Mra,A.J.Durham went to Charlotte yes- terday. Mr.H.P.Grier,Jr,of Charlotte,spent Wednesday here.'re.J.C.Dye and daughter returned Wednesday from a visit to relatives at Da- vidson. Mr.C.BK.Wilkins of Goldsbobo apent Wed- here.Mary Fuirley,who apent a few days MinswithMr.and Mra.Clarence R.Stimpson,re-! turned Wednesday to her home at Laurinbure Mes.C.W.Stimpson,who spent awhile at Black Mountain,returned home Wednesday. Notices of New Advertianements Auction sale of furniture,Saturday,25th. S13 west Sharpe street. Man wanted to handle motor truck.FP. Bex 194 .or phone 515. Old false teeth wanted.-F.Terl,Baltimore, Ww.A.Mil-Md.Bighty-five acre farm for sale holland,Staterville. Agent wanted for National Life Insurance Co.,Box 473,Salisbury,N.C. Josephine Massey is arked to return honge. Long,Kannapolis. Bryan Simerson will ayply for pardon. Wood sawing,T.G.Wooten,‘phone 421 black.Jitney will now run on schedule. MeCormick farm machinery at &Mont vy Hardware Co's *Souvenir day at Carolina Motor Co.,Satur- day,ember lat. Lazenby- Statesville Motor Co.is the place to buy your eur.+Pipeless furnaces.Crawford-Buneh —Fur- niture Co. Satin-faced sitks for tall.Ramsey-Rowles- m”».Get what you want.©ora-Cola Bottling Co School children must be vaccinated States- ville Sehool Board.Fresh mitch cow for mle.WStatesville,R-3.Fresh Jersey miteh cow for anle.W.T Watker,Barium ‘ings.for rent.-L.C,Lewis,aee Cc.Kyles at Harmony—Change a z ? CorrespondenceofTheLandmark. Harmony,Aug.22theMethodistchurchinterestisbeingmanifested.tionshave beenmadetothedifferent¢!A Young People’sattheHarmonywillbeheldexchTheofficersare:President,Miss Grace White ‘ist enureh,The Stacy Hayes crore a omnt librarian,Mies Mattie Mac The farmers of this community are wearing |‘Ot a &ee a oi a Powell cordial!a long smile,A fell.Monday |up with dirt as come A a te lt le an Bn i |chaneine Sontenatl te ee of corn and notatoes w,the yield would be a ja hoped that these meetings will be well at-|cotton.eae barrel —,couple of .There Cantata at Troutman.bushels or so.y people tried mut the plan and in every case the \vield is about the same as that re-| sorted by Mr.Heinzerling. |Who started that barrel -potatoe Mr.and Mrs,Kenneth Raymer. ie end mast Soleman Raymer. .sion were Mr.W.B.Berker of Greensboro,| Mrs.Tealrill,Miss Zula and Mr.Bon Sherrill and Dr Coleman Raymer of Catawba. |home. Rorden and Susie Fulehum of Goldsboro,and Mra.Aaron Clarke of Jacksonville,Mla. his forty-seond biofhisrelativeseat dinner at his wood things were many and great Those present were:Garrison,Mr. 0.| Sept 5 j New fall suits and couts.Mills @ Poston.| The.revival meeting atfeinprogressandmuchSeveraladdhurches.Union has been organizedmeetingsturdaynightat§o'clock. Pearl Powell;secretary.weamarer Wright (an Misstreasurer,Lankford;Ruth Grose;rian,Clyde|™ |Wednesday for % leounty,to attend a reunion of the Falls family there today.Flag For the y. The Piedmont battery was present- ed with a handsome silk flag Mon- day evening by the citizens of urtiums decorated the house and the in the dining room was of nastur-An excellent six-course din-and Pr.on this occa- of Charlotte,Mrs.W.L.Sher-| |street from the armory and halted |before the Commercial h =[iM fie Thomas N.Hall;—_*joy Mr.s N.Hall. My.Brest Apa cave celebrated|spoke for 30 minutes,recalling i .The triumphs of America in past ly enjoyed.and holding up before the batteryBr.ond Mrs Morr g|nish ideals of the great cause for| .EM.Land,Miases Rachel and Mrs. Fl e Fa 5> |Sugar/McIntosh of the faculty of the Uni-| versity,Chapel Hill,is -with his sister, mie 'Mrs.Jane Herman,have moved to B.Miller,for her at Sparta.My.oe itewn.The presentation took ;: oesto Agariafor Mra Miller and’wars.M,C.Wood entertained Tussday af./on Main street and the boys in _ee hepee on —Main | 1 Tee Beene Sa"thus deeattere,|torneen,in honor of Mrs.We.A.Walte|made a splendid appearance.street,recently vacated by Mr.and) Loulse and Ruth,of Savannah,Ga.,are visit-Kridge was phayed at four tables and Mes-|neople were proud of them and the Mrs.T.H.iNer.| ing,Hire,Burnhom's sunt Mrs,PN,Raynal.dames HO.and A.1.Steele tad for the|towd that thronged the Second Lieut.A.G.Carson,whe wd.Ayers and children are visiting in|hikh score.There were no prizes.hastens|©:spent 51 rs in the | Charlette and Monroe.wienjl candwiehes and tea.Asters and pink|broke into applause again and again *pent 5]years in regular army | Ie and brs.Kenneth iiagmer,who were|rasee were used in the dveoration of the pretty!4s the battery marched down |has returned to Bismarck,N.D.,from Out-of-town guests In addition to Mrs.|la visit to his brothers,Messrs.W.H.otel,where and J.R.¢| = 7 we PE : ¥ | . ii i g F ¥i ‘ |h rs.|home be president of 1 ,States- |home next |ville;Messrs.L,C.Stevenson,Harvey |the Mr.Lathan Mills,who |Stevenson and Mrs.Jane Vickery of Slate a le ,from Montreat last night,|Loray;Mr.and Mrs.J.M.Carson of| Tere Team|was dame of honor,and Miss Mary Boy Scouts are having a time.|Statesville.A large number of Ma-| return today from|meld of honor,=ea nares |—c =|sons andmembers fsthe Junior onder | .coe on th |were present ai charge t Raleigh snd Mire!citecin,“both,of LackeyandMiseine Mee /and it had eleven rattles on itetail!|burial service,‘The floral tributes Citi ‘at the home of Rev.J.H.Prewly|Mr.Joseph Stewart of ©|were many and beautiful.| todayfor Sylva,|Wednesday afternoonat 3.30 o clock.ot|Ohio,camehere Saturdayto |Mr.William Sloan of Polkton ar- sister,Mra,D.ey =ot oe '!sister,Miss -MaryStewart.Thay rived Monday night and is spending| 1 cur of cieere an BlBeene es ome,eBoy noche “Sr.John Reap.a.|Hesigmes’d.We Wattn,A C.Pane ©Genetot Reeves |Miles Rests May Bhorrit!:Mr.Pred Rev.L.A.Falls,pastor of the Mesdames J.W.Watts,A.C.Payne :leon and Miss Eva Thompson.and R.L.Matheson.Dr.Henry Louis| eae,ae ce CateSf Geet esis Metediet aa,oie his 584 smith,president of Washington and| sail "|Mew,Laure Ray about 26|birthday last Su with a ‘Lentnart | ;tas and Mrs,Mattie Short lett|euests Twenday st her home in Shiloh town-|reunion,when his children were |Hved Tosedat ie ond Is .ending | Wedeceday night for the Northern markets in Ship,in honor of her so and at home.The Falls famity left here .oy aan 0 his “one Saeed te!in| Loaf township.Mr.A.c.! ors a fewrs.Lelia Bo- Mr.R.M.Herman and his mother,|a ‘THE FIRST NATIONAL BANK, The U.S.Government,know finan*°. cial condition and the character of the MEN behind our our bank as a member of theFEDERAL .. anebankaccepted RESERVE SYSTEM. Weare oneof a VAST ARMY of responsible banks =.which STAND TOGETHER.; On our securities we can get MONEY when we- want It. When your money is in our bank it is absolutely sofe and you can GET it when YOU want it. Make OUR bank YOUR bank We pay 4 per cent interest on time deposits. ery &% van arson.U.P.Wilson and W.H.)MessrswasMr.Hall Carson are attending the Statecoun-| the =*the Jr.O.U.A.M.in Ashe-| ville.| |Misstheir brother,Mr.J.G.Chatham,in go forth to battle.Keysville,Va. Mr.R.W.Chatham and sister.|Mattie Chatham,are visiting| of rook Wednesday afternoon.Miss Margaret |Banner”and “Dixie”and el roney of why guest of honor,M ..Meroney of Murphy,wa Tutivhest score and snthusiastic cheers for the Piedmast|. received @ box of correspondence cards.The|battery.Mr.and Mrs.W.&.Harris and | ion,Billy,left Tuesday to spend @ A party of young people enjoyed a picnic week in the mountains.While away at the park Wednesday evening.A number ef|hey will visit at Morganton and pooner ~~after which supper was |Blowing Rock.were accom:| Bee coer nna |xanied by Mr.and Mrs.Fred.Culp.|el Harris returned Tues-|Concord,where she spent| 1 week with relatives.Mr.J.P.! -Mills is spending his vacation Master John Long had a number of his;Montreat. young friends in Monday afternoon to join Willis,the young \son of Mr.a guest-of-honor was presented a pretty hat pin. A salad course was served. A number of the young people of the town|Miss Rach and a number of visiting youns ladies and gen-jay from tlemen took part in a dance at the States-: ville Inn Wednesday night.oe! -in| nd | him in the celebration of his birthda :oan | wooed aa)Ned ocean tarantel ol nied Galea |Mrs.Paul Barger,ix seriously ill) Mrs.Ro B.MeLauchlin will entertain at/with searlet fever.veral other| bridge thie afternoon in honor of Mrs.E.M.cases are reported in the wn.| —Death ‘ Miss Minnie Baxter,daughter of Mr.M.W.Baxter,died at her home ‘Troutman,Rel,Aug.22.Mra.J.R.Neai|in Mooresville at 2.o'clock this | <=ons ee |ea <Pgs acngannce She had wee *’'*a1 }..Jo ohMr.C _'|been afffic ‘or five years or more. |ae Ee foroutnng—=nn |She was about 28 years old and has) K.Ostwalt,Mr.and Mrs.L.E.Johason of|een confi to her home for two Her mother died of the same Personals —Birthday Dinner. Corveapondence of The Landmark. ed under the shade of a big onk tree,was en- joyed,Mrs.A.M.Johnson and daughter, Vivian White,were the guests of Mre« Shar w ohn-| eS an xy somos |la Fathe furniture.Saturday,25th,at 2 p.m.,325 Mr.Dewey Douglas and sister.Mins Minnie|isease last summer.ather a West Sharpe St Aug.24 -1t%,| Douglas,spent several days last week with|four brothers and four sisters sur-—pe he their aunt,Mre.T.H.Dagenhart,near Stony|vive,One brother,William,lives on js BAL ine Jersey milch cow.Good for | —bree eS so a farm above Statesville;Clyde|tk an ners wW.T ee a | a)Mk. Siggapdpg hacy oar’Ray.Baxter at High Point;Clarence at,:‘ae coe wer ut Mooresville ave vwiting Mrs.Raymers|No.2 mill here and Lonnie,the |"ore mitch cow.W.C.KYLES,| pore.Eto,se 8.Se Mites |youngest son,at home;Mrs.Ed.|tenville,R-i.Aug.24 ~-1t*.\{ the wech-ead guest of heresualn,Biss ‘ima|Poston here,Mrs.Elba Boyd in}FOR RENT—s-room house on north Center|| Kennerly.Mr.and Mrs.Knox Hoffman and,Charlotte,Miss Hattie in Asheville |street,Large lot.1.C.LEWIS.‘Phone| |eae howe earns to ther homeot und Miss —the 11-year-old)'7%Green a |Sp deine corneal ears ee fae,|eager,at Rome.|WANTED—Old felee teeth;don't matter if eee austen 7 a Eos ton mt)"The young woman was a faithful)broken.1 pay $2 to $15 aeae ee | iting relatives here,Miss Bertic Beaver is|member of —the Methodist church!parce!post and receive cheek by return| visiting in Landis,Mre,J.L.Cloaninger|here.Funeral at 4 this afternoon)a THRE,08 NB."cee rd | and.two tons,Mr:Wade und Meter Jamet|and burial in the city cemetery.|2 | tives and friends here |Mr.Baxter and children have the|PaneED—Agent,we represent jNatienad Late | |illany,telatlvesand fricnda arent a mons|‘ympathy of TeeNIE GOODMAN.|ioiming countion Literal comtraet for|wd ie 8 Weapon.or hale ie ae RAN.|ae man.Address BOX 473,Salisbury, Wadoner’s birthday.A tempting dinner rerv-Barrel Potato a Humbug.oni _Aue a ae | |FOR SALE—*5-acre farm,&miles out on Friends are mighty kind to Thebringingitgood things to eat,but little did we thinkMelLeaninMooresvilleMondayand‘Tuesday ,man was good enough friend to ving in and turn over to us hisMeeting‘at New Amity-—Some |, Personals.f Irish potatoes.Thisjentirecropo\'s just what Mr.J.B.povtnserting Browning has done.He adopted the plan Irish potatoes in the barrel. Miss |nL Landmark about wreanondence of The Landmark Scott's,Aug.23.Messrs.RW one —gE.?came a are va growing ashington,D.C.,to spend their vacat .* »Ocoee Oot el trom|ae aaa bia or and eax “er, Stateavitie and Miss Lonien Bradford from|od it over to e ndmark.e Eufola heSaturday and Sunday with Mes.|first counted it and find seven pota- ..|tees,ranging in size and appearance A protractd meetingbegin.at w Amity!|asm,Gattiep Gita fee.3.8.Posreen mits from a jaw-tooth to a stewed prune. |oe osaet by the Rev.G.L.Kerr of King’s|*=—welgns one — mantain.e barrel pota usiness has |.ir.John Sree,free indies.svent ©|turned out to bea failure.Some lew days here w r.y ow.©J;nthe back the story got abroadDawenhart.Mrs.Mary Hartline of States.Mo ville .spenting a few @aya with her winter,that if one would plant a few pota- 2 it was,itw ,“The Trouble atForthisenter- osed with for produce on the local market: were paid yesterday bag ory onthe Foc mar , ———————————___eeeWANTED—Experienced man to handle motor or .: ukwe Se eee ee daughters,Mrs.J.A.Stewart,Mra.J.8 which they shall go Mrs J.1.Kimball returned Wednesday Messer of Charlotte,Mr.and Mrs.Ed.Ayers!He was heard with interest and was)The |FET WarIgeny | from @ vivit to friends in Concord.and family,Mr.and Mrs.Geo.Ayers and)frequently interrupted by applause.|.~.'"ast big beet was from Mr.| lie.lang Gaither lett Wednesday night |femély,Mr.and Mra J.W.Ayers,Mr.and|he cle Miss C.C.Hartness of Elmwood commu- for Philadelphia to begin his final year in the|Mrs.Emile Ayers,and Misses Alma and)\t the close of the speech Beat iy It weighed f .\ medica!college.:Bustace Ayers,all of Statesville;Mr.and!rice Hall stepped forward and_pre-he ele our pounds, ties!cote":setter of ctveenville,8.C.,o|ie,U.8 Greer of High Poi;Me.and Mm.|sented the flag to Capt.Reid Morri-—| spending u few dayw here with relatives.N.B.Ayers of Monroe,Mr.and Mrs.A.G.|by whom it was formally ac-MARKET REPORTS. Mre.Hugh Bryant went to Hendersonville |Melehor and Mr.H.P.Deaton of Mooresville.—»y who te ma}:y a |Scaler | w.y to spend a few {a |epted.in a few we -chosen words,Statesville Preduce Market. y and little aon left Miss Allie Ramsey entertained wt four tables|‘The crowd sang “The Star Spangled |The following prices were paid yesterday Spring Chiekens,18¢.per Ib. Statesville,N.C. Our repair departrnent is in skillful hands.ee We do our repair work “right”. Yet we charve only a moderate price for the good we do. Briny in your watch.It should be cleaned every year to : preserve it. When was YOUR watch cleaned last? Let us fix your glasses and furnish all your optical goods. R.F.HENRY,Jeweler. —« < o - ~ work, Hens,lie.per tb. Euws,Ste.per dozen.Roosters,Te.to Se.per tb. Tub Butter,26c.per tb.Dwiry Butter,30c.per Ib.Beeswax,30¢.per Ib.Green Hides,18c.per Ib.Hames,28.to 30e.per Ib. Bides,tHe.to 2He.per Ib. Shoulders,26c.to 28e.per tb. New Red Honey (strained),16-i8e.per Ib,New Red Honey Comb,18e.to 20e.per tb Seurwood Honey Comb,22.to Z5e.per Ib. Extracted Honey,22¢.per ib.Auto Rubber Casing,4c.paz ibhPotatoes(new)$1.60°perGrain.The following j |!| | t ‘Corn,$1.90 per busheOats,#5e.per bushel. On the loen!market yesterday 25 centssepaidforbestgradecotton. Write Pit®truck.O.BOX 194 or ‘phone 5158. Aug.24 N BALE of household and kitchen| ||| Turnersburx road.In wood state of cultiva-| tion.Deep well,geod house and out build- ings.A barenin.Kasy terme.W.A.MIL-| HOLLAND,Statesville,N.C Aug.24 1".\ WANTED—Girls to wait in dining room at)Hotel Iredell,Apply to MRS.JNO | GRAY.Aue 21.|— OCTAGON SOAP Sc.cake,with package N.| R.G.Washing Tablets at RASH'S Store.| Aug.21 2t FOR SALE—Two sixty-saw gins,25-herse- _—Boiler,and Engine,Wagon Scales, ress,Suction,Line Shafting,Belting,in gvod condition,at a barvain.ERNEST G. GAITHER,Statesville,N.C.Aug.2!%t FOR SALE—PFall-blooded Jersey male calves,| entitled to registration,three to «ix months old,J.E.‘fovp.Aug.21 @& WANTED—1500 colored men,preferably mar- ried,to work in aluminum plant §hours per day,7 dnys per week,Wases for stendy work $14 per week to start.Inc ceases geanted after one,three and six months of service,Fine new houses with water,tofl-| ets and electric light.Cheap rent.iy) all year round.pei Bmploy-| ment Bureau TALLASSEE POWER COM- PANY,Badin,N.C A mt. PORBENT—Storeroomoreroom formerty eccupled byP.Alilieon,R.A.COO)Aue.10. WANTED—Konitting Mi Help.We are now operating oer new mill cool,sanitary Street cers every five minutes. Good wartes | | {|} = Will gladly give their customers what Gn for,ALL folks call for what they WANT.”Whee YOU call for “ In bottles,and our other re products, that you GET them.If the dealer tries to.SOMETHING ELSE over on you that he“just as good”he has paid OUR product thecomplimentpossible.Our uct metfractionmorethanmostIMITATIONS— BODY knows they are WORTH MORE —still ALL cost YOU anickel. GET iw YOU WANT—THAT’S WHAT WE | SeethatOUR nameis on thecrown.. BOTTLING:COMPANY.. A Call For Women!| The President of Mitchell College has issued «call for seventy-five Boarding and one hundred Day pupils. Earnest,ambitious young women from the twelve to twenty will be in the first call. The enlistment will take place at the Office of the College Wednesday,September 5th.Thesacrifice will cost something but it will be worth the price and more. Superior Officers will be in charge of the training. The advantages will be great for the . age of of aricher womanhood.Failureto enlist a reproach. Bearin mind the date of enrollment,September 5,and the place.Mitchell Coll a 3 * ’ jSine saved in the State,and itgwill be to the advantage of the to aid in this work.. erop report of the United Department of Agriculture for June estimates the 1917 wheat ef North Carolina to be 9,169,- bushels.Compared with the ° 1 crop,the present crop is short by 1,176,000 bushels.At this rate ¢ of;production,the State will « for food this year about 3,719.- bushels of wheet more than it uces.ee the past ten years the Ex- periment Station has conducted com-| pa¥ative test with more than t tests on all different types © shows that in the mountains ’s Prolific,Dietz -Mediterran-|¢T 4%Purple Straw and Fultz have|made. vidkied best;in the piedmont region le Straw,Fultz,Leap's Prolifie a Stoner Miracle have yielded er best.The est seed of these varie- ties should be used for seed. In comparative tests also, in other States,the home grown s have given the best results.Drterscallaattentiontothefact the millers of the State could ease may be ra good service by stressing the seed this point,as well as by holding over Proper steof the best seed for furnishing indseedthisfall.to’ BLOWS FOR THE PACIFIST. {)“This circular is respectfully re-rned with the assurance that thesidentnodoubtwilldiscoverthe|lredelfirstindicationofadesireon|ties:part of the Kaiser to quit fieht-|Straw,Leap's Prolific and Fultz,andandmatepeace.The pacifista,of the bearded type,Fulcaster.The above varieties are good stand-ard varieties and have shown up uni-\formly to be our best average yield- Generally speaking wevrefertosecureourseedfrom somelocalfarmerwhohassvecialattentioninsafeguardingthe quality of his meddling.brought this war upon,because they made the Kaiser be- ve that the American peopleuldnotsupportthePresident'stentions.The pacifists are nowfrotnginsthewarandmakingityandexpensivebynag-fine the President and the adminis-ion about peace when they oughttobépreparingtowhiptheKaiser.’ -is,if they don’t want to helpKaiser.If they really want to the Kaiser,I presume they are rsving the proper course,as theyndehimmoreservicebystirring an they could by fighting in the rman army.” .Speaking at a patriotic mass meet- ir dissension among our people| fng at Union,8.C.,Representative|uel J.Nicholls,member of the use committee on miiitary af-irs,said “traitor is the appropri-word to apply to those who are ing about the country criticising government’s war policy.ThoseWhoconsiderthewarintheab-t.”he said,“or that is not as-iated with the nation’s full pur to maintain American rights,not with as.” The Russian Dilemma. 4 When the Russian emperor waserthrown,said Mr.Elihu Root,de-fering conditions as he found themRussia,the Russians had no insti- _*of national self -govern- nt and were bewildered,all instru-ts of authority having beenweptawny. “Then came the propaganda of arr groups,one corresponding to e 1,W.W.in this country men©seem to believe the worst is the t,who seek to destroy national-in the world.They swarmed k to Russia from the Unitedtes,villifying the lund that hadthemrefuge,declaring that government in America was asmaasthatof<ussia underr.“Into this confusion was thrust aeatGermanpropagandathatspentneylikewater,using millions up- miltions'to bribe the people andbuynewspapersTheywent@thesoldiersatthefrontand:“Phis was the Czar's war-—whymakepeace’?The soldiers were ir -weary and it seemed for a timeiftheGermanpropagandistshaduredRussia.”Gradually,he»the provisional government hasconfidenceunderKerensky.Seen . a visit to his parents in Vir-He will leave in a few days Chilters of Danville,Va,isgtPp”oo »Mr.W.9. ;Tr camewiallyfortheThirdCreckhome. yester- Mr.Mre.W.J.Wren ofreaa.,and »W.dS.Wren,|roots Falla,Perey,4 acres Benton,Mra,C.EB,77Combs,Felix,5 weres ......... lion bushels.|It should be planned this year to in-|devoted to this!Particularly is this so withsectionsoftheStatewherewheatis specially adapted. Generally speak-jiedmont and mountain sec- State are best adapted forcon-|the growth of this crop. |At this time it is of the highest invportance to secure seed of a good 53 acres ..Woods,R.E.,96 1-4 aeres .. Sowers,Mias Jane,102 aeres ...‘elored.Davidson,Lemuel,2 acres ..Allison,Jno.,5 acres Cenith,30 sere Bailey,Vietoria,16 acresBrocher,Ellen,6 acres...|Calvert,Wiley,1 1-4 aere .|Cowan,Julius,|acre Bo,|Chipley,Anderson,1 acreDavidson,Will,46 acresLyneh,Dock,18 1-2 acres In order to getseeditisordinarilythepart of wis-25 va-com to buy ~_.re this ;of Plan one will usually be al to getofwhet,An sverage f not only the best grade of seed butalsothepricewillgenerallybelow-than if delayed Again,there may be consid- Honeycutt,Mrs.G. Gabriel.Mra.Amanda, acresBass,C.S.,82 1-2 acres ordering is put off until later.Anoth-advantage is that if the seed are not up to guarantee they may be re- if bought with this under-with a and me will be a oe!se grewn for getting seed elsewhere.ecau-soly gets af'neme und Sheet e500"|ican shaukl be then ta sor thet teseedarenotinfectedwithdiseases,especially the smut. |Moore,F.L.,244 acres MeCoy,J.W..11S meres |MeCoy,T)FB,108 acres Poteet,W.S..100 acres Somers,W.N.,229 acres This latter dis- evercome by with formalinconcentrationand in the righttreatingthe may be secured from the Ex-periment Station.Varieties to Use.considerable difference on the War and isin the yielding powers of WPrlneinn It—The Traitors. §Pacifists are prolonging the war at our different brane!and making it more bloody and ex-well as at the central station at Ral- nsive by nagging the President eigh varieties of wneat and Bod the administration about peace crops for a number of years.As ainsteadofaidinginthe fighting.|result of these tests we would rec-This statement was made by Repre-|ommend for the mountain section of tative Adamson of Georgia,in|the State,based upon results at theplyingtoanEastOrange,N.J.,)Buncombe Test Farm,the followingifist,who sent him a circular,varieties: ing him to support the La Fol-|Leap's Prolific and Fultz,and of thepeaceresolution.Mr.Adamson bearded wheatsForthepiedmon:‘the State,based upon several years’ at the Iredell Farmcounty,the following varie-Of the smooth wheats Purple| €.son,Malinda,190 aeren ..........M.J,24 1-2 acres. Lonnie,10 aeres ..White Mitehell,J.W.,125Murdock,Austin,821-2 acresMcLain,J.A.111 acresPhifer,J.P.,1-2 acre 43.00|deyner,JOS,45 acres ‘29|Steelman,Hardin,70 aeres Whiting,Mrs.Annie,60 seres Abner,{7 serves 6.48 Campbell,Emma,65 acres Avery,Hordy,4 1-2 weresChambers,Arthur,1-2 acreChambers,Mack,1-4 acre )varieties when grown under the same been studying >> Patterson,Foyett,1 acre N.A.,24 acresPatterson,Herman,1 1-2 mere Pearson,Richard,1 acreRobertson,B.D.7 1-2 acres BR e e a e a e c s e s emooth wheats, |Island Mills,35 acres Lippard,J Marion,61 acresry _2- er er sa p e cs sotmoreland,H.D.,4 aeres Chambers,Sophia,3 1- Gray,Jno.and Guss,2 Robinwon,ZR,estate,1 lotM.Henry,Lina,1 acre White Delinquents.Brown Heirs,105 aeres .WN,50 acres johnson,J.O., Ohividsen,Charles,10 scree»Houston,Lewis,1 lotfamsowe,J.L.,1;Vanderburg,Peter, Jentz,Mrs.Jerry,36 acres character and It is our plan to give the peoplefromtimetotimedemnitetionwithreferencetotheputting:injofthiscrop. _AEST EUR ESE ARN AARNE Supplies For An Army. Buying the things an have,getting them to the camps and,later on,putting rcross the sea, merchandizing Uncleeverattempted,saysjdispatchtetheCharlotte Observer. Consumption of food,clothing,bed ding,hardware and other necessities by ar army of 1,000,000 is cnlculated to be three times as great for the same number of menpeacefuloccupations. Aside from arms and ammunition, White Delinquents.Shaver,Mrs.Jno.F..98 neres Howles,Mrs.Amanda,estate 4.a ..acFrasier,Mrs.M.C.,161 neres “me ean Matheson,1 A.1 lot 3.90 Holtsclaw,W.M.,1 lot.S32 Mitehell,J.8,10 acres...3.26 |Howard,W.A.1 lot32°Mott,dames,1 lot bees be King,Bell,1 bot i 244aS4Mosteller,G.Do 1-2 weres on.0 Turnersburg.+06 Morrow,Annie,1 bot oy |Douwhit,Mo L.,60 aeres ;4.446.96 Mott,Dr.J.J.14 1-2 weren ze Danner,J.A,1 were 13.606.02 Orr,Mra.C.K,107 acres Fowler,8.A.,31 1-2 acres 2.04492Patterson,T.8.1 3-4 acres Green Sisters,65 1-2 @eres 3.98544Phifer,BE.L..4 acres Gaither,JA,28 néren 12.664.19)Phifer,JOP.2 aeres ooo...|Gaither,KR.K.,5 acres 17.89 ae Phifer,J.G1 lot ;6.17 |Gaither,WL...69 acren 12.40525Phifer,Roo,1 lot Green,CW,38 acres 16.88Pool,8.A.,1.let /Gailther,J.A,78 aeres 740Ramsey,JS,1 lot...Granfleld,A.F,1-2 acre .31620|Rewan,R.R,1 bot...Harpe,W.ML.358 neren .Meee 60.86 C89 Sherrill,W.F.,4 acres ....6)Speake,1 T.,6 aeres1.04 Sowers,G.N.,2 acres ming,K Bo;lot‘\.\tton,Mrs.Logan,1 acre Harnbrip it,Tom,“62 |Steohecker,Rev,catate,4 acres<<!Summers,W.V..7s acres ;oe -o 49 Templeton,B.M..1 lotliedellFarmers’Warehouse,2 lots "42 ‘Thompson,Wo A,1 let ‘5933 Warren,W.O.,44 acres 2 42°White,C.N.,1 lot511)White,W.A.1 lot Walker,T.7...;Shoemaker,L.W.,Kennesty,J.P.,61 1-2 ae ,Coto~yumpbell,Andy,3 acresasson,Joe,&1-2 aeres 3.66 Woodward,Roy W.,1 lotrpesbuHeekham,J.H.,67 acres »|Bowles,Mrs.Jane,1 acrepliedtoequipan rapidly completing vurchase of enough *ems to supply ae ".,estate,D4 acrea .men and 936 civilians for a year. Manufacturing andthismountainofgoods business channel.prosperity,but also Everything men life,except extreme luxuries,will be Following is part‘he army's demand,for a year: transporting ||96 acres,1 lot..Frank,147 acres Fool,W.8.40 1 Davis &Wiley Bank,104 acres Hailey,Billy,estate,97 1-2 acresKeanett,Thomas,22 acres Martin,Charles,25 Williams,Martha,sy Matheson,James A.1 fot, pounds;soup kettles,89,091; hats,2,291,109;small!Witesieox,A Krandon,Mre.Lydia,: Johnmon,do J., bags for horses,72,240;brooms,54,-"utter.Lee 1 ~ \vley,F,J.,142 acresblacksmithshops,344;camp chairs,8,532;tooth brushes,3,054,818;face towels,3,054,818;complete company barber shops, Dropped Bombs on Hospital. The incendiary bombs,which were dropned by two German aviators on twi hospitals behind Verdun on Sun- Crawford,Jennie Teor Bes:Houston,KE.M.,estate,15 acres aon Knox,Will,38 1-2 aeren . Stewart,Mrs.Isabell,76 acres |” aClark,Frank,2 acreslene,Uke te:Sherrifl,J.A,74 eres ‘Torrence,Chartie, White,Leroy,|lot .male nurses and inflicted further in-|Campbell,Martin,1 :suffering fromwoundsreceivedinbattle,manywhomrushed jfields in an attempt to from the bombs rained down. men,one woman nurse and 19 train ed male nurses.They wounded PI . 6.16 White Delinguents.|;Dalton,Cama,1 gere ............:6.50)Alexander,M.C.,3 84 meres oo.2.0¢/Current,®8.27 meven ............3.45.06 'Bowles,Annie,15 aeres 240 _Unien Grove.13)Bost,Mrs.D.R.,93 acres :14g)|Bennett,H.C.,123 aeres ..........4 oe rows.—_a LM .....ou Ss .——peut :,A.RK,...4!eins,;“2 aefes .......ees 4.73 awn,.K.,30 acres .ul i Fraley Bros.@ Holmes,1 acre ......41 ‘=Brown,4%B,1 lot au on —"*7 1-2 acres ..666.54 Bradley,es ‘iek,:.20 on ‘4.62 |Benne,[ss a Jurney,M.4.100 1-2 eeven ss...sere 32 Brandon,G.H.,1 let ..(6)|Morgan,Will,2 1-2 acres ....:26afte|Grom Be tee Rg me geen ec teS813Cashion,R.L.."ye 1.96 ee <i :.1.60 Cashion,Mise Louise,1 lot ae 1.94 Ce ee,Pee 16 sors ue ‘2aM1Robertwon,J.J,66 eres 4.96%,a ke a él Snow,W.F.,&acres ...:16.78Craig,8 He,1 tet oo...i 7.46|Summers,N.T.,119 acren ..18.401.40 ..1 bot ;eo a,Templeton,Mrs.Mollie,71 acres 4.1729 he.th eenen eee war 'Templeton,James M.,10 acres ..3OnJloti.79%Templeton,J.C.,#1)aeres Lae 12.7612o8.t bet :isa Trivett,Levi,3®1-2 meres .......,7284a|.N.,belra,3 acres.|)asso Walker,J.R.,60 acres .........10.8718s|dt tet ee,:794 yuan,A.heirs,54 1-2 aeres 4.81‘ety ie 161 |Wooten Heirs,98 acren ........6.76 1.72].Dd,:8.79|a ee a eeeinsRBwere476|MORTGAGE SALE OF LAND, 4.34)2.71 -“|lot 1.22|Under and by virtue of the power and au-14.20 |the,|lot 9.36|thority contained in two certain14.98 wa 6)|deeds an follows,towit:Ist:One9084)re ee gz deed executed by J.A.Maiden and sie11.94 |1.22 =a oe oeeii :recorded in Book44,at page266;2d:aan|nes \je deed executed on the 30th day ofneeit.“a |November,1914,y 4.A.Maiden wife,17-58 Pons wee 1.89 |Lala Maiden,to Elisabeth ‘adkinne:county,N.C.,in the sum of and‘oe Seice eeeaaeas+Guwyn to Charles ©.Tharpe,we ==made in the ..note 26 we terest thereon,mere14.83|Shoomaker,T.W.,1 lot...||ewes,the <aell cash “1 “4254 Fe B e d = 25 8 find shelter Moore.Charles,1 bt || |Osborn,C.A.:|Pinkston,Walter,1 lot ..aviators|Reid,Wm,&lotscireledaboutintheairforhalfan|honr,firing theirorderlies,who were endeavoringextinguishtheflames. and Mre.J.B.Roach,S-.,and wendRareGinteaniente.brought direet from the battlefieldbéenvisitins.'*.and had gone to bed when the bombsweredropped —s Sa e z = _=S2 s machine guns ‘The nurses —- - Bs §e e z e e a e 3 s : cs Pere COR OHee. Seer renee eee 142Btater4.08|6.79 A ry.eae 4.906.91 Allison,mma.ft 4.88i...ee.eee 6m22y.Annie and Alfred,1 lot ......8.05 1.07 mart,Ane.1 Wb ...........-4.68 T]Bennett,G.W.,1 lot ........eneeee 326gCowan,Lela,1 bet ..........,..,5.29 Dalton,Andy,3}lot ........tobe-ate 8ggDavidson,Nannie,1 lot ............244 6.27 Kecles,Krider,1 lot .............,.1.1.48|Gray,Jno.H.,1 dot...ewe,12.04‘Green,Margaret,1 lot ............2.442.69|Hampton,James,1 lot............tz26.16);me,8 OE ote 40 1.68‘a4,Howard,Emma,1 lot ..............4.27 aT16.49|Howard,Houston,1 lot |......+0!10.96)Campbell,WM.1 dot.|8.064}9.60|Johnson,James,1 lot ..............12.49|Carson,M.L.,1lot ......000.oo...Saypig)Kerr,Henrietta,1 lot 0.00...2.44)ee"16.84)Kimbrough,Will,1 lat...4.10 1.22 |4.n2 Marsh,Susan,1 bot ................1.83 Feimater,Luther,|lot ..............122 | 3.00 Moore,Richard,1 lot ............6.23|Feimster,Nell,1 lot...rr '2.90 |Moore,mE WM aes sa eae 6.1)|Peimeter,M.8 A.1 lot ....0.....aa|Murphy,J.Pt bot...:16.91 ‘él op|MeKee,GC,1 lot .....ei...:1.46 |Gentry,Mollie,|let 6.00.0...a16.ag |MeLelland,W.BP.1b bot.o.oo.$89|Hampton,Mary,1 lot...ot#30 Niebelson,Josephine,Lilet...00...8..(eo eeayyPearson,Jennie,1 lot ............1.83 :tree ee ‘6126g|Sherrill,dno.A.,4 bots ...........,13.64)H 'Roe aneome eee 2.4412.63 Themay,Ed.1 lot feet 1.88 |Ce 6a6.59 White,Joneph,1 lot ................1.88 |925bWoods,Dave,1 lot —.wine A aren 4.88 1.87ogg|Woods,Vina,1 lot 198 244aWoods&Carson,i lot a4 149.0g Griffin,Tom,1 lot.,oa 2.664.29 Stevenson,Jno,|6.62 1.28“°"Webb,Rey,1 lot «Owe eet ‘9.29 1.689.77 Woods,Richard,1 lot .........5..6.23 a61=oT (Outside)..I :x74.68 rohart,M.T.117 acres.......25.36 50 We x 1.22’o14 robert,E.J.FE.8 acres ....z 2.44 |Murdock,Addie,1 lot .........0....,7)ese rhiey,H.A.,5 acres 4.02)Myers,H.C,1 bot...1.22=Barringer,A..1...64 aeres .1.70 |Myers,H.E.,122Benton,C.E.,1 lot 148|Roteend,E 4.68 Bowles,A.KR,1 lot 5.Me 1.22_—>-:hota ‘13.80 S a 1.22vers,Carl,at :4.88|MeNeely;Jane,rear :Carter,W.W..2 acres 19.69 |O'Bryan,Naney,|lot :3CarterBros,6 acres 2.44 |Patterson,He a8 Me as,8.70Cashon,J.T.5 we 12.91 |Phifer,Carrie,1 lot .ee 246Carapbell,J.Wo.1 bet 1.28 |Phifer,Hall,1 jot 66eeC.,1 let 641 —1 lot 1.83Conger,F .It nerves 65.02 ot,Massie,|lot...;Sent In,(FL 8)neres Bae 62.40 aoa.Naney,|lot es>|Oey,BP.&,2 xeres a a 2.66 |Spann,Jack,i lot YPavia,Hoy,1 lot ”5.01 |Stoweneon,Henry,1 lot 3.Gellinger,Bow.1 bet,:9.20 |Stevenson,Rebecen,1 lot 2415gPOX,Mes.Clermisx,1 mere 2.05|Stewart,dno,1 lot.a15pean:J :-arren :11.58 —yea iM...:1.83 oa ns vy.i ow,61 acres .By 36.85 8 m,Francis,estate,1 lot 727.weer,J.1,34 meres '4.53)Stockton,H.S.,1 lot ..3.061040eeJ.F +2m aeres :14.84|Summers,Malinda,|lot |.1.22beeenry,RF.8)acres re 18.99 Summers,Lettie and Lena,1 lot 1.22go,(enking,FOL 21 nerae ...6.14)Summers,David,3 acres .6.84ay,fehnsen,KO 8.1 bot sees 2.44)Thomas,Ellie,estate,5 acres.2.48.abe dolinaen,J.ON.1 Jot Sanwa 1 |Turner,Will,1-2 acre .‘2.79,1450 Késtler,Wo ALP,6 acres ;9.86|Turner,Maggie,1 bot 1.2mtae|Cmehey,ve blot Cosas ba vr,1 0.1616.66 Lippard,T.1.1 tot ;10.17 |Warren,38304Lippard,J.J...25 aeres '2.96 |White,Rep.1 WM cs.ke :1.22guyLyons,S.C,M.afd M2 acres :.54|Wilson,Lewis,1 lot :it Mayberry,8.Po 1 bot ?5.u7 Witherspoon,Maurice,1 tot i 10.34 i Mayberry,S&S BR.1 lot £19|Allinen,Tom,1 lot ’ “9!Maxwell,Mian Julia A.42 acres 5.0)Bennett,Ho B,1 lot Keller,O.A.,100 aeres .Maron,Roy,|acreNichols,Rebecea,estate,211 acresStrowd,N.E.,64 aeren ....Shaw,BL A,,28 1-2 aeres Summers,J.W.,57 aeres .. West,C.Jd,40 acres© :Sees ; ‘<Statesville Development Co.,4 lots '*4)Stevenson,D.B..1 lot -@:: eS ? = Sk S S = S S E Campbell,Jim,10 1-2 acren .. Foote,Orne,37 acres ‘Gaither,Lauran,56 acres .Jobnaon,Frank,31 aeres .... |Nichols,Diek,6 1-4 aeres .Turner,Geo,27 aeres ........4.furner,Rev.J.BB,15 acres»Turner,Stokes,16 acres ....anTurner,Sandy,6 1-2 aeres ......... +3:Watts,T.L..1 bot _Williams,D.S.,1 lotooWilliams,Carrie,1-2 acre $0 o4 98 10 . 9 0 -2 DS 20 B2 e S¥ c e s n s k e n s York,LC,2 aeres [t 3*§ ye -i g t a a a FF F ti t <Z et ; f a Hi r e i i_. BS S r % e r e E s . eB - s a e 8 ep . SS I S S E V I S T S S A V A B K V A S s S S 2 - 2 28 2 5 3 5 Feteeeeeeeeeee Seeneereerrnes Are not tied fromcarryingoutyourex-pectations and desires when you havemone'‘IN THE BANK. Your Bank Account depends on what‘you save, It is not a matterOFGOODFORTUNE. Acquire the saving habit while your in-comeis small a it will be casieras your income increases to IncreaseYourBankAccount. Nowisthe opportune time to open an Account with us. People’s Loan and Savings Bank. “MONEY MAKES THE WAY EASY.” GEO.H.BROWN :President.0.L.TURNER -Cashier. ee = FOR SALE 206 acres,level,productive,red land form,fronting quarter mile on the most traveled,public,sand-clay road leading into States- ville;niee two-story,frame seven-room dwelling,lecated in a beautiful grove;barn ond out-huildines,fine well water,two branches;abundance of fruit;quarter of mile from school and ehurches;86 acres in cullivation,46 acres in meadow,balance in woodland,part ef which is inclosed in pasture.An exceptional opportunity to buy a fine grain and stock farm.Will take in part payment,small farm if well located. ERNEST G.GAITHER. Insurance,Stocks and Real Estate. Phone 23..Satesville,N.C. THIS BANK Js essentially an institution for allthePeople.tt places at the dis-posal of the Farmer and laboring Man as well as the business maneveryfacilitythataconservativelymanagedBankmayoffer. Merchants and Farmers’Bank. Of Statesville,N.C. “The Bank For Your Savings.” C.S.Tomlin,Pres.F.B.Bunch,Cashier.L.K.Lazenby,Vice P.J.A.Knox,Assis’t.C. DIRECTORS. C.8.Tomlin.-W.S.Page.L.K.Lazenby.-bk.G.Gaither. E.B.Watts.-J.A.Knox.*J.L.Stevenson,-J.R.Hill.Clarence Stimpson.Herman Wallace.KR.T.Weatherman. Every good citizen at this time shoulddohiasharetowardstvReserv COMMERCIAL NATIONAL BANK. STATESVILLE,N.C. Booklet,“How Doesit BenefitMe?” || couniry in brought face to face with the judg-iment seat of Christ.He said fur-ither in this connection that the timehadcomewhentheChurchhadjtheconsciousnessofGod,hadthepowerofprayerandsomeminis-ters had pushed God into a seconda-ry place,and that no Church or no 8 nation can prosper when it crowdsGedoutofitslife.Dr.Chapman has expressed theopinionthatthepresentwarwillnotenduntilthepowerofGodinter-venes and brings it to an end,and heurgesthatthegreat.question before.the Church in this regard is how to-secure the favor of God to the ex-(tent that He will bring His power tobearinthenearfutureandendthetragedyofbattle.He insists thatHisfavorcannothesecureduntiltheChurchsohumblesitselfastogiveGodthefirstplaceinitslife,which is His rightful place,and livessoclosetoHimandinsuchharmo-nv with His will that He will assertHispowertobringpeacetotheearthandwill“in wrath remember merry.” More Doctors Wanted For the Army. Of the more than 2,000 physicians n the State,about 277 have accept- ed commissions with army medical BEV’,This faet was brovcht out at the |meeting of county auxiliaries ef the medical session of the State Counci!jof National Defenee,in Greenshore ,this week.The dom-nating note in the discussion was the urgent need for trained physicians in the medical |recerve corps.The doctors can con-jtribute just as effectively to winning of the war as the aelitwaspointedout,and thousands wil)be needed.Distinguished visitors present!were Lieut.Col.Robert KB.Natle ofWashington,D,C.,and Maj.Joseph©,Bleedgeed ef Baltimore.These two men occupy exalted positions inthemedicalcorpsandtheir utter- ances were listened to with creat re-| spect.When war against GermanywasdeclaredbytheUnitedStates,Cel.Noble stated,there were 3,000jcommissionedmeninthiscountry'smedicalreservecorps.Now thenumberhasincreaseeio8.992 and many more are needed.The names (of 14,800 doctors have been recom-imended for commissions,but manyofthesewillnotacceptanditixes-jtimated that 12,000 commissionedmenwillbesecuredasvolunteers,|Earnest appeals for vatriotic services‘in the medical reserve corps weremadehyCol!Noble,Major Blood-rood and others. Soon Be Ready For Front. An Associated Press report of the‘19th =shows =that the American|troeps have not yet been engared onhehattlrfront.The report says: General Petain,commander-in- chief of the French armies,paid hia first visit feday to the AmericantroopsinFranceandexvressedhim-self ax delighted with what he saw. “Iam exceedingly pleased andrratifiedwithwhatIhaveseendur-‘ne this —insepetion,”he said, “Training has progressed so wellithatIfeelcertaintneAmerican troops will form an excelient fight- ,ing force in a very short time.” The French general was accompa-_nied by Maj.Gen.John J.Pershing,the American commander,and both left for the French front,where they !will remain several days. ETDSHAEREITCRNANG For Care of Soldiers. The extensive scope of prepara-tions for the health,comfort and re-creation of American soldiers in{France is indicated by reports fromMaj.Grayson M.P.Murphy.headoftheRedCrosscommissioninFrance.Thirteen thousand selectedtrainednurseshaveenlistedfordu-ty in the fully organized base hospit-/als in France,and great quantities\of hospital supplies,drugs,and in-struments are already in FranceSixinfirmariesreststationsinchargetrainednurseshavebeenestablishedalongtheroutetak-jen by troops from portstocamp.Canteens with andfacilitiesare*Deing es- a = ' pated "ot ‘hie,1-|Desensjotoanyentire familya50centhottieof|Give it to your «‘one,|teas;coe ’:tinues:an Me!“Then T left and |Mr,Ashetate|called to me and said:‘I will be,men eed =a _—oo Soon,ae =|d—d if you don’t step talking as youdo,you will get a fight on yourhandsrighthere!’with still morevituperouslanguage,and when hemacethematterpersonal,I feltmuchliketakingahand,so I curs-,ed.The editor beat me so far I stopped.”|Editor Asheraft admits that hecussedsome,and what's more,hesays,he hasn't repented.He sayshehasattemptedtomakeremarksintheMonroecourthouseonformer|oceasions and has never been satis-|fied when he finished that what hehadsaidwastothepoint.This time,the editor says,he ras entirely sat-isfied with what he said.He thinks,he did a good job.He expects toanswertotheLordforprofanityandhethinksDr.Armfteld will an-|swer in the Federal court. Want More Destroyers. Immediate expansion of building|fecilities of the United States to doubl>or treble the output of de- stroyers during the next 18 months was the object of a conference be-7tweenSecrataryDanielsandrepre- sentatives of 25 or more ship and engine builders, ‘If we get whot we want,”the Secretary said,“the United States will have more destroyers than any|other power.They are the one thing|a submarine fears.”The Secretary indicated that all the destroyers the builders would orednuce would be ordered.Every ef-fort of the department will be laid, on speeding up the large number of contracts now nding.Every as- pect of shipbuilding that bears up-|on destroyer production was taken! up at the conference.There is no}shortace of material or plant facil-| high power engines,boilers and re-|duction gear.j LIFT YOUR CORNSOFFWITH FINGERS Tells How to.Loosen a Tender ‘orn or Callus Se Ht Lifts Siemensee eee Halls Drug Store,to ev SimpleSanitary SharpeSaf The Ideal Army Razor. i SS meeeme =e emeeneemenne= eae A he ‘The Economical Home Razor. ities but a difficulty lies in obtaining||The ao —S oe Se Come and get yours,HALL’S DRUG STORE, Phone No.20, ery man one ety Razor. Out Without Pain. You reckless men and women whe| are pestered with corns end whehaveatfeastonceaweekinvitedan awful death from lockiaw er blood|Poison are now told by a Cincinnati authority to use a drug called free- none,which the moment a few drops are applied to any corn or callus the soreness is relicved and soon the on-tire corn or callus,root pnd all,iiftsoffwiththefinger.Freezone:dries the moment it isapplied,and simply shrivels the corn ot callus without inflaming or even irritating the surrounding tissue orskin.A small bottle of freezone will cost very littl at any of the druy |Stores,but will positively rid one’sfeetofeveryhardorsofteornor hardened callus.If your druggist hasn’t any freezone he can get it at jany wholesale drug house for you. wars,or no wars,SO BUILD NOW!) PINE SHINGLES! SUNIPFR CEDAR SHINGLES! RED CEDAR SHINGLES! Nails,Ridge Roll,Valley Tin,Brown }and Green Shingle Stains. 1 C,WATKINS,Shinyle King of Ire- !dell County. For sale,"6 acres Good build- ings;well fenecd and watered;high ;State of cultivation.Good read,/2 1-2 miles from Statesville. i W.J.MASON, BAGS. Trunks,Suit Cases and advantage to give us a look your purchase in this line, Steamer Trunks,$5. TRUNKS,SUIT CASES AND HAND| We have just received a large shipment of Now if your vacation needs requires a Trunk, Suit Case or Hand Bag,it will be to your ‘Trunks,$5.00 to $18.50, Wardrobe Trunks,$20,00and $25.00. Suit Cases,$1.25 to $8.50, {Hand Bags,#3. PHONE 838, SHERRILL-WHITESHOE CO. Hand Bags. before making 1 ii 00 to §8.50, 50 to $12.50. Aug.21—4t*.Statesville,R-4. The Brady Printing Co. Has taken over from R.P.Allison the agency for various Magazines and Book } Publications and wants your orders for sub- scriptions to Maga | zines of all kinds.Will |. orderany book wanted. All Magazinesoncoun- ter soonas out,— Composition, gin one,two and "©,WATKING. eeIE.++ET ee mentee are St Appreciates the very liberal Our office is an open one,and customers and those who will of over seventeen Srey hoagie,oF8ororov We do NOTARY PULIC work also.J.F.CARLTON, ny os THE STATESVILLE REALTY &INVESTMENT COMPANY friendade and policyholders,both NEW and OLD. to use the same when theysodesire,As in thepast,we will strive to give the same et EU GRADE SEBVICEaswonforthisCompany “WEINSURE ANYTHINGINSURABLE”endPAYALLHONESTLOSSESINCASHWITHOUTDISCOUNT. tronageof its we invite all ourbecomecustomers callat ourofficeNo,54 if our eee agarose ,died on the 20th,Native of Virgin- now recalled,thequeensquotes’appeared under apictureshowingrowsofmagnificentcorm,with pumpkins tying in’the—rows,and father and mother the childildren in the foreground, ine the promising prospect a the greatest contentment.Thjs rather lengthy preliminaryistoemphasizethestatementthattheearththisYearisproducing“ex-wberant crops”—especially the corneropinIredellcounty.It has been a little dry,but if nothing hap- pens to cut the crop short,such a corn crop will be mace nn irede!! this year as old timers never dream od of, A Statesville man who owns a furm and who takes note of and ci lights in the growing crops and ir all things in which nature plays a part,is of the opinion that the farm ers will have to pull down their barns and build greater;or at least that new storage houses will have to be built for the cor re thet the present facilities will bh. quate.And when one goes out ink looks over the waving Metcs corn,such a picture.in was never before seen in thishecanreadilybeliev eribs and bigger ones wilt + sary. A few days ago Laughlin took The Landmark edit- or a little way on Feuct t look at the corn crep.A few ago the creek botionis were brakes and swamps.Here at smal!meadow —patche coarse hay;the creek botton ld ed nothing else except malaria.Ther along came the dredge,swamps were drained,canebrakes and tim- ber cleared out and the land cult vated.This is the first year the dredged creek bottoms have had a good opportunity to show what they could do and the result is magn/fi- cent.Along the cre ‘kare acres an aeres and acres of the finest and the yield will be immense. locality mentioned is just one About 45 miles of ThirdFourthcreekshavebeend Tredell and the corn 01, this vear would convin tie—if any there be now —of vintage of dredging,simplytheeconomicstandpoint And the corn isn't conf bottoms.It is on the hiltsid the ridges and everywhere,a nificent crop,promising a record yield.There will be feod tor theSteckinabundanceandbreadfo man;and the promise -«smut the price will he worth while for theseller. {i ' Mr.R.#.Me- Veal kep- P the ad- from mag: It's(Olive Drab. olive drab,aid a milit The Landmark the oth to the uniforms of the common!designated easier to call it “olive “khaki.”the Inst lifficult to prenounce “Call it ry man to day,referring soldiers, khaki.It's drab”than being both to spell. Col.Webster,who an authority,says the sumnformsofthearmy,of —cottor cammonly des ted kin: the winter uniforms,of wool.are ol ive drab.As it is vot a trifle warm it is supposed the boys are we: the cotton uniforms,which according to Col.Webster are khaki.Bat Th Landmark going to a substitute of the military ig a captain and a ce dent and an author:it’s the fo by-—not Dr.Lincle Will¢ Dr.Thomas W ulty of Davidsor known i States Pranted a year’ from college wortNewYorknexthewil!mor fare in Y \ French soldicthatthefF) asked forDr.Ling aa alaeceptodbe in the Fre Dr.Ling short Lirne route to Monty Yori will word ind aemethine iWin “olive drab" the ‘kh: Mar is know in Bei} mari of wh thresh. quart« Beeded, Was thre der and For f on the =three sacks of Ba @ tack of then Proad ent price:; Which afte:1 Would show a fairy Viciousness at the Warning Evers lect afe pu broke: pie v4,af dix;th breaacs The been nunoved se ofte of thing that patience Bome of theee dave th perpet of these art«of caught and when they ary pr tie sere and eertain Mt ive ol is determined to make an © of the people whe ime,wed The Landmar? to sound the warning. Vv)POUNDS GOOD ROAST. at SMITHFY &FRA iy ane dollar.For Sat. ff th a,ts Orth iPartat .ooag been let.3|d gynewcourtanbuildingwillcost=cise of $400,000,and a number of army Mrs,Cam pewife Rev.Dr.At R,F,Cam*resbyterian at a railroadNieaeci@htoftheK..®four adults and four?-yoar-old girl escaped, Publishers of Biblesmandfortheewlenees ost ever known.-oeARdemandforpocket soldiers 80 prreatcan't keep up with the Charges that the been defrauded out of000,000 in income taxes ¢ wealthy were made in t Senator Lewis of clared the Treasury had A general strike of Leilermakers and blac a.Husband and son survive. At Norwood,Stanly county,Sun- lay night,Jesse McColl,cotored,wasshotandkilledandJonesWall,col- wed,is in jail,to answer for the heoting.Probably a gambling row. The State meeting of the independ- ent Order of Odd Fellows,at Dur- ham this week,elevied Col.J.C Bessent of Winston-Salem grand pa- triarch Next meeting in Winston- Salem In Goldshere Oscar nd killed Neah Bethea. cd.‘The second homicide infownwithintwodays.In the ase a negro killed a white Wel h escaped, At the conelusion vo a jury”in the \sheville,Judge tlickory suffered a heart trouble,the ertion,and was ill for hot color that other man. Welch Both New York and vicinity of his address Federal court in W.B.Council of ordered this week,but been put into effect and slight attack of Charles A.Wall,Jr.,-esuit over-ex-Hl.Mead were burned a few days Buffalo, ler,Glenn Lone,who left Newtor which they |‘N moke bombsralweeksagof<«vow Ve tethat)«>rvice jn Both men wereiheunSpPo has arrived “where pee ,;according te 4 able Although Americn’s ¢ ¢eave 'put this year shows a 2 ‘rense over last year ¢kery,who grad-dange vhortave, an t statementbythe De ieulture,whieh ur; ther materials as Smith cf lenied in the Senate American cotton is fine ito Germany and lnred that 4,000,000)ba eine exporte 1 from th: Surepe now than when of caught fir 'dead wLatior ir am 1 Niken ¢of the At! he nor Yoon Sali governm i anta,being one of men out of from at the a a clas.of 18 Atlant port will enter one choals to com- much Senator rajece,where herenchflying +training Howell w Capt section United Stat: active Way Waynes- Joseph Hi.Way officers’reserve S army,Was as-fan duty by the War c at Washing Augusi OW at the ba hospital, »Charlotte. af ntracts for boo, have just pl government for army a mrements at a price te food administrate to Depaartment ton been mt sor Wh exempted munty buard the ent market lependent wife and child tal between aged in disyraceful con-(000 found himself police An attempt was made hereupon h exemption ourt house of Acomaoked,on the ground that his wife this week,the flames |better off without him | Stedma The attempt is cha a tour of }isters It is said i that h Ibe a candidare turning the court he Counc rw draft records Johnson,Jr. His denied exe ice,which wife's ! by was vould be Corgressman red Haram “tates Senate {pport Mrs Johnson is an Cie Hutchinsonby} Intion of ( to Tiiteer wre lission in Washington ited Ch: me ure of cuon-hh rutu n and apprectati to Pres-Umited Wi sor 1 from the emperot ard November VELCOME 'ke s RNNOW with wa fupunese * Japan’n beart:x a ission to the U; :will and rmth |Ass ti for the Tubers 33,000, “Wed crnme that Hlinois, there according partment of Ag- paccers te use Austria. aced price the §12,000,000 before much damave they am Joh Jase rmans were coun feral off continuetedby roe= Saybrook Junction,freight engine pee os ratte theiheseat po Bnorders, government had he Sena who de- the proof, machinists,ksmiths en-aged in marine work in the port of and inelud-ing the navy yard in Brooklyn,was)it has not may not be, and Richard to death atN.Y.,when an airplane inwereexperimentingwith‘e in the air.|the air-|hen fell to the ground.; in plate eut- )per cent in-| is still a! to a as possible, South Carolina reports thatlingitsway He de- les less are country tothewarhe- of su- hy the navy re- fixed by At.the order will and =$18,- tons nd »be yn. to burn the county,Va., cing diseov- was done to draft re- hoped by e to destroy United nef Cal tion from t ed on ndency mp der al arrested at ty.S.OD, Reers,charg- pionave act. Yankton,S (erm ted in the at misar Cross th benefit of movement in begin about to Janu the Nation Study and ThOu, nt has transferring provert team ment ships es of war of the issemble Ned off It 0 who was al speake v letters.% ised)the ous ‘parks for had been take }\ Geory anti ederabl court wuilty Kalman Gruher, Rert members ophe for enteneed t dhet of S.J adead granting .iuita;afendeine School Counts.Superin J ‘ ‘need t penitent ans to draft at Macon Was to have The t of the meet n to pit xWee re "Oo -bret feld ar “exen pt »tweeire.Th 0 two ved ee EE ere a Chronic tNTESRESTING <evel think the ration is Soaker t with ithe bott aide,it} that twice then y in0Much CmvVveye the Lottlhe 'cle : water,and then, he bettle read all this rir washing,everyhappeneduy©that we are abeoypedoutoftheerecanbeneforvign office eized wietth Sharpe,other tel clean,he would be Tuesday and that gihle toeretyhimwie\h ot be more{him.Sreed turned Tan:homeandbethwaivediorCome around to ourvebend.how vou2=nd you will thenMORELIGHTS,care with which ourThemunicipalauthoriti:believe tied.It wit!ting the lights shine.Twenty-you,idditional street lights have “Statesville Mint Colanstalledand25moreorderedNo,628,N.Center St.stallation,The Landmark is Mint Cola,thorized to aay that citizens who Cheerwine,vit more lights are needed on (CoerstreetsshouldpresenttheirHires’Root Beer,aime to the light department for’One dollar a crate of)hvertigation.ud 2es ja f¢ uyery coming N ft N few mile the and words, pure he partiewar med to be guiftte i ay with absol arn bottle marie, the diferent drinks are be a plensure Constipation. the4 ail ary ait le ij the: automatmore itely aa 1 y for vg.=br lutely ec sul uty nee bottled dri: wholesome You could fh yeur ow and let processe ypreciate —the bot plant Rettling Co. "Phone No.82 Orange Crush. Ginger Ale,Lemon Soda.Strawherrs. 24 bottles, . to show | Shingles,Doora,ing,Moulding, etc.Next Planters’Wh, FOR communities; outbu ilebingen ; mails daily.One ha f nearly a milv with ownership onaveut160seresincultivation,iture,remainder tenant house rtile,dredged ereek opertios are s by owners, but prices: If nterested, ‘RK OB entrely under Those Who Know Better Than C.WATKINS won't he cheaper end eros Lime,Cement, ‘att.SALE. tivh-class farms ef 200 aeres each, went residences and allfineshadetrees.Mostadaptedtoal!crops;accessible to| and her ino on tep-sot romd: un:whred fer pasture; especially suitable No forced sale and no} McLAUGHLIN, for many Ne SALE,.| ' s.1 bta =3 MILLS *araded top-soil | in-woodland;newn. about half in good meadow;bottoms,| to fair and rea-these conditions, Attorney. say Lumber) years—| — from evet-heat, fencefwaterPwo cullivation, ber acre, trike waren TOMLIN,tesville,Red. Are the bestbeenforyearprices.Give Pump to lelp herwork, Myers Pumpforallmakes. ;W.E.MU: |Your Plumber Phone an 114 ao. VouE cae they 3.Also the have wife a with her 1 repairs DAY. E.BroadSt. C.i.Lis LEGISTERED |Statesville,N.C.'Phove Ali PreK, “HITECT 240 Green. Battery lnspecti We are to recharpre stock a full line of ssories, STATESVILLE MOTOR CO. thoroughly Patteries on Free. equipped and have Battery ac- at moreattractive than .Al materialsadvancedsinceabovelineswerepurchasedlastspring. Yourstruly, &POSTON.& TheStore With the Quick Parcel PostService. Satin Faced FOR FALL. Our autumn stock is full with the new styles. 40 inch Crepe de Chine,Black, White and all colors,$1.50 yard. 40 inch Crepe Meteor,Black, White and Street Shades,$2.00 yard. 36 inchall Silk ‘Goetz’Satin, especially adapted to street wear, in Black,White and about ten colors,special value,$1.75 yard. 40 inch heavy lustrous Char- meuse,Black,White and Street Shades,$2.50 yard. 40 inch Georgette Crepe in fifteen to twenty shades to match all the silks and woolens,$1.75 yard. Navy and Bleck Taffetas,Black Peau de Soie,Duchess Satins and Messalines,$1.25 to $2.00 yard. f New Fall Novelti.s coming almost daily. in Ramsey-Bowles-Morrison Company. The Store That Pays the Postage on Mail Orders. DR.J.M.HOL DENTIS OFFICE MILLS BU Over Mrs.Sins Statesville,N|HOURS 8 to 6. - RESALE OF J vet hip,Teed @ the inne nad bone 4 ranting a ee south 3 thenejemMultis’tir tine 76 pole thence noril wles to 4 erow's Hine ¢! nining S32 1-4 2» rm of sale CastD.Turner,Atty July 27,191 labelheGuarantee nourtes the quality of the paint.The a ot your property againstraintatDon't you need Millinery Store. phen ©0r bes RX.JOWNSON, LAND.iP Cc. ‘PHONE 31 AND. ommenece at nion Groge ofina,mad. t and oth- erow's land: poles to a to a stake inestwithMul-aid Multis’ Mullie’lineitwithTf8.the beginning, Commissioner. on insurance of “M.Moses&Son's of Baltimore ———-—Will be at Johnston Belk Co’s Thursday,Friday andSaturday,August 23-24-25 With their full line of Woolens,forFallandWinterSuitsandOvercoats.This is a high-class line and veryreasonableinprice.If you are contemplating a FallorWinterSuitorOvercoatbuyitnow,as these Woolens are constantly ad-vancing in price.We guarantee tofityouperfectly.Also we guaranteetheprice. isti zf [ i l l s : on September 2d.religious services be held inchurchesintheState,and letmenprayforthesafetyandmenwhoaregoinginto lasting peace may comeFE L L E Fy ;and.Third,that on Labor Day,Septem-ber 3d,appropriate patriotic exercisesbeheldineverycountyscatintheStateandletthemenwhohavebeendraftedintothepublicservicebetheguestsofhonorattheseexercises. T.WV BICKETT,Governor.The people should heartily co-oper- ate in carrying out the programmetedbytheGovernor,or onesimilar.The county councils of de-fence should take action to arrange alocalprogramme;and the Red Crossandvariousotherorganizations,endthecitizensaswell,should lend ahandinmakingitasuccess. Former Iredell Resident on theBattlefront. In a business letter to a Statesvilleconcern,Mr.Thos.Anderson ofEdinburgh,Scotland,gives some in-formation of interest concerning hisson,Mr.James Anderson,who for-merly lived at Elmwood.“I am gladtobeabletosay,”he writes,“thatJamesisstillsafe.He went throughthecaptureofMessinesRidgeonJune9andtthebattleintheYpressalientonSlat,and is still safe.He is a sergeant and seems bright and happy and often speaks of going backtoNorthCarolina.”Mr.AndersonsaysifanyofJames’old friends go to Edinburgh he will wefeome them.HesaystheyaredelightedtohavetheUnitedStatesarmyfightingsideby side with them. Mitchell College Faculty. President J.M.Moore yesterdayannouncedthefacultyforMitchellCollegefornextyearasfollows:J.M.Moore,Bible and pedagoyy;H.M.Parker,D.D,philosophy and Bible;Miss Ruth Todd,modern lan. wes;Miss Grace Anderson,Eng-ish,expression,reading;Miss EthelRodman,mathematics,science;MissInaAnderson,history,English;Mrs.Sara E.MclLin,home economics;Mrs.W.A.Eliason,preparatory depart- ment;Miss Ina Anderson,primary de-partment;Mr.Karel Bondam,direc- tor of music department;Miss RoseGillespie,head of voice department;Mrs.Nola Sherrill Carpenter,headbusinessdepartment;Mrs.Sara E.McLin,matron;M.R.Adams,M.D.,college physician. Blues Wait Orders to Entrain. The Iredell Blues are ready forCampSevier,Greenville,8.C.—justawaitingorders.Cars and equipmentarealreadyhereformovingthecom-pany to Greenville. Clint Ball,Major Ball and Roy AShoemakd@rhaveenlistedwiththeBlueswithinthepastfewdays.Capt.Westmoreland recommendedtoCol.Gardner the appointment ofthefollowingnon-commissioned offi-cers for the company,which appoint- ments have been confirmed:Grats PMillsapsandWem.J.McDade,ser- geanta,being promoted from corpo-rals;Frank F.King,Baird S,Bark-ley and Samuel Miller corpo als,pro-moted from privates. WILL INVOKE CLOTURE. Efforts by Chairman Simmons to obtain unanimous consent §agree-ment for a final vote on the war rev-enue bill at 4 p.m.next Saturday,failed yesterday.Efforts to fix atimefordisposingoftheincomewarprofitssectionsalsowereunavail-ing.Cloture may be invoked. ASK REMOVAL OF NEGROES. A petition,asking withdrawal ofallnegrotroopsfromTexas,signedbyall——of the ——tion in ©was ‘orePresidentWilsonyesterday.WhiteHouseofficialsdidno:indicate whatactionwouldbetaken. TO ANSWER POPE SOON. . changes.«the newofwhitemen,with company organizationssetupagoingconcernintowhich therofthetote!quota can beabsorbedwithoutconfusionasthey reach the cantonments.The next 40re cent of the quotawillgoforwardSeptember19,whenthesecond30percentoriginallywasscheduledtogo;asecond40percentwillPBpeesOctober3insteadof the 30 per cent,and the remain-ing 15 per cent will be called up as soon thereafter as practicable.Local boards are directed to disre-gard r of liability numbers tosomeextentinselectingthefirst5percent,as men of experience,suchascooksandformeriers,are de-sired at that time.Warning is givenagainstgettingintothislevybyrea-son of his experience any man whomightnototherwisehavebeeninclud-ed in the first increment of the dis-trict at all.*About Married Men.At the direct suggestion of Presi-dent Wilson,Provost Marshal GeneralCrowderhastelegraphedtoallGover-nors a supplemental explanation ofregulationsgoverningthestatusofmarriedmenunderthedraftlaw.Nochangeinregulationismadeandthepurposeofthestatementistoclearupmisunderstandings.In a_letter toSecretaryBaker,quoted by Genera! Crowder,President Wilson states his opinion that the regulation directinglocalboards“to establish the fact of dependents in addition to the fact ofmarriageoughtnottobeabrogated.”This leaves the regulations as theyare,and the supplementary statementisdesignedmerelytomaketheappli-«cation of the rules uniform.The President says: “We ought,as far as practicable,to raise this new national army withoutcreatingthehardehipsnecessarilven-tailed when the head of a family istakenandIhopethatforthemostpartthoseacceptedinthefirstcal!would be found to be men who had notyetassumedsuchrelations.“The selective service law makesthefactofdependency,rather than the fact of marriage,the basis for ex- emption,and there are,undoubtedly.many cases within the age limits fixed by law,of men who are married andyetwhoseaccumulationsorothereco- nomic surroundings are such that nodependencyofthewifeexistsinfactPlainly,the daw does not contemplateexemptionforthisclassofmen.The regulations promulgated on June 30 1917,should be regarded as controll-ing in these cases,snd the orders issued under that regulation direct- ing exemption boards to establish thefactofdependentsinadditiontothe fact of marriage ougat not to be abro gated.“The attention of this office hasbeeninvitedtothefactthat,in a fewinstances,local boards have certifiedtodistrictboardsasheldformilitaryservice,men whose families are actuallydependentuponthemforsupportonthetheorythatthewifeisabletoworkandshouldbeputtotheneces-sity of roing towork to support her-self and children.We do not concurintheviewsuggestedinsomequartersthatincaseofwifeandchildrenact vally dependent on applicant's labor support,and where there are no othermeansefsupport,the wife should beputtothenecessityofwroingtowork to support herself and children.Bonafidedependencyofwifeandchildreronlaborofapplicantwhereinhisab- sence they will be left without rea- sonably adequate sunrort,after duly taking into consideration soldiers’ wages and support available from rel atives,as stated in the rulings of th« Provost Marshal General,is ground of discharge.” Officers to Camp. First Lieut.Alan R.Anderson,Second Lieuts.Godfrey C.Kimball,Harry Gregory,Owen W.Leonard, Philip P.Dulin and Herman G.Baity leave today for Camp Jack- son,Columbia,8.C.,where they will be stationed for the present.Second Lieut.John A.Scott leftSundayforanAtlanticport,whencehewillsailforFrancetotaketrain-ing in the artillery service.All theabovewererecentlycommissionedatYortOglethorpe, Messrs.Maurice Dunlap and Ray-mond V.Allison left Sunday for Fort Oglethorpe to enter e -cer’s training camp.Mr.Dunlap isasonofMr.and Mra.J.C.DunlapofBethanyandhadbeenatworkinCharlotteforsomeyears “I returned yesterday afternoon from the hardest trip |have had #o far,”says Mr.Julian Morrison, writing from “Somewhere in France”to home folks,under date of July 31.“We were gone from camp over 36 hours,drove continu- ously for 24 hours without sleep, and when we finally did get time tosleep,it was on thesideof thereadinthetruck,with the floor for abed.”Notwithstanding his bed wasthefloor,Mr.Morrison said he nev-er slept sounder in his life.Previoustostartingonhistriphehadlostsleep,first by a German air raid onthequarters,which forced themcrawloutofbedandhikeforouts.Then in arranging fortriphehadtogetupat2o'clock inthemorningandseethatthegotoffallright.As firsthehastheoversightof18andforthistriphereceivedat9o’clock Saturday night,to11trucksreadyfortwo-days’by midnight.They drove fromo'clock Saturday night until 8 o'clockSundaymorning.when they arrivedattheplacetoload.After loadingtheydrovecontinuouslyuntilabout11o'clock Sunday night,whenarrivedattheplacetounload.Af-ter unloading they were allowed afewhours’sleep and then set off forcamp,where they arrived about 1o'clock Monday afternoon.The night.drives were without lights —so much as a_tail light,”says Mr.Morrison;“and you can’t i rheadds,“the strain on one drivingforhoursthroughpitchdark.”Whileatriplikethatdescribedisunusual-ly hard,the men are always givenextrarestwhentheyreturntocamp.Telling about the German air-plane raids he says:“As a ruletheycomeatnight,although on someoccasionswehaveheenraidedinbroaddaylight.Usually in daytimethevflysohighthattheyarequiteinvisibletothenakedeye,but thesoundofthemotorisabyaysaudi-ble.That makes it all the worse.You can hear them very plainly andyouknowtheyareGermanma-chines (French machines have,tothetrainedear,quite a differentsoundfromtheGermaniandonelearnsthingsofthisamazinglyquick),but you can’t lo- cate them because they're out ofsight.The moment they are heard, however,the soldiers on duty at the anti -aircraft guns find them with the aid of powerful glasses,and im-mediatoly a deafening roar starts up on everv side.after the first report from one of the guns you see «white puff seemingly thousands offeetintheair,and you know theGermanplane,or planes.as the casemaybe.are near that puff of smoke.The puff of smoke,of course,comes from the exploding shell;an)we are in as much danger from the fallingshrapnelfromourownshellsaswesrefromthebombstheGermansdrop,for an exploded shrapnel cov- ee ers more territory than a bomb. The bomb is more vowerful,but more concentrated.Therefore, un-less you happen to be very near the anot where the bomb explodes,youarenotlikelytogethurt;whereasvoumaygethitbyanieceoffall-ing shrapnel a good distance from where the shell explodes.“It 1s a sight never to be forgot-ten to see one of these battles.The whole sky in the vicinitv.of the plane is covered with the white vnaffs of smoke.and yeu can follow the progress of the plane by thenuffs.At night the sight is more interesting.As soon as the sound of the wlane is heard several huge searchlights are trained on it and immediately the guns start theirroar.The shells are also shot hich un in the air to aid in lightine the sky.All of this is of course very weird but at the same time it is 9 heautiful sight.Thursday night 1 was sleeping very peacefully when 'was awakened by ‘*:e roar of the vn s,one hatteryv heing only about ‘OO vards frem our camp.T must have been sleeping very =soundly. hecause every one was in the ducout ry about,when T got there.In going from mv bunk to the dugout,a dtanceofabout200yards,I had mv frat experience in passing =throuch felling shrapnel.In falling throughthetreesitsoundedlikerockswere]M.‘eing thrown through the leavesWekeepoursteelhelmetsathandotalltimes,and since I had mine on |felt secure enough.The next morning several pieces of the shran- nel were fourd right aroun’thisnlace.It isn’t considered a coward lv act to wet into a dugout while wne of these raids is in prorress.InfacttheFrenchmenarefirsttoget there.Friday night just as I wae shout to give the order for the mentowettheirtrucksontheroad,one these battles started up,and when'looked for the men they were gone ForaunonAetendance—DayatTeachers’ The last session of the teachers’institute,Friday afternoon,was aneducationalingandanumberofvisitorswerepresent.The prelimi-nary exercises were patriotic.Amer-iea and the Star led Bannerweresungbythebodyand“Keep the Home Fires Burning”wassungbyachorusofteachers.Miss Annie Lee Kincaid toid the story ofthefirstflagandMissHelenBaileyexplainedthemeaningofthecolorsoftheing.Mrs.R.H.Lankford sang“The Kaiser.”This poem,which isthesongoftheHarmonygirls’can-ning elub,was composed by Mrs Lank-ford.It refers to the work of thecanningelubgirls,who are doing their bit to help in carrying on thewar.As an illustration of some oftheinstitutework,there was a dram-atization of the story of “The SheepandthePigs”by some of the primaryteacheré,Following the reading of the poem,“Your Flag and Flag,”by MissClaudiaCashwell,Mr.C.B.Webb,chairman of the county board of edu-cation,spoke briefly to the teachers.Mr.Webb said that ignorance is thegreatesthandicapofAmericanciti-zenship.A great responsibility restsupontheteachersbecausetheyhavethetrainingofthesefuturecitizens.Iredell county is making progress,but must continue to go forward.AschairmanofthecountyschoolboardMr.Webb has but one purpose—edu-cation and qualification for futurecitizenshipofeverychildinthecoun-ty.He congratulated the teachers up-on the splendid work done’during theinstituteandsaidthathehopedsoontoseethedaywhenschoolteacherswouldbebetterpaidfortheirwork.Prof.J.H.Highsmith of Raleighwhohasbeenconduct'ng the insti-tute,addressed the teachers on theeducationalproblemsinNorthCaro-lina.The first great problem is themoneyproblem.Sufficient moneywiselyexpendedwillsolveanyedu-cational problem.We spend a littleover$6,000;on our schools inNorthCarolina,not as much as some States spend on their universities.The school have two sources of rev- enue,appropriation and local taxa-tion.r money problem will onlybesolvedbylocaltaxation.The prop-=eS tax £ problem is the problem of com-pulsory attendance.The compulsoryattendancelawisn't enforced.Pub-lic sentiment must be created in favorofthatlaw.There are 800,000 chil-a of school age in North Carolina.»enrollment is 600,000 and the av- erage daily attendance is only 400,-000 or 66 2-3 per cent of the enroll-ment.There are 121,000 white illit-erates of ten years and over in NorthCarolinaand49,000 illiterate votersOneoftheweakpointsinNorthCarolinaeducationisthenumberofome-teacher schools.In Iredell countyyouhaveatpresent35one-teacherschoolsandthereare3,268 whiteschoolswithoneteacherinNorthCarolina.The most important educa-tional problem is the teacher problem. Seventy-five per cent of our teachers are women.The number may increaseto85percentduringthewar.How- ever,well trained women are betterthanpoorlytrainedmen.The greattroublewithsomanyteachersisthat —have ceased to grow.They are as big as they'll ever get and a gooddealbigger.We need teachers whe will grow,who know how to teach what to teach aud Knee the childrerwhomtheyareteaching.Teachersshouldbebetterpeid.The average annual teacher's salary is $242.69,1 want to see the time when evermanwhoisoualifiedtoteachwillgetnotlessthan$75 and-every‘well trained woman not less than*}0 a month for twelve months.The fear I have for the people ofNorthCarolinaisthattheywillbesatisfiedwithsomethinylessthanthebest.The teacher's creat problemsolvoblebutalwaysunsolved,is the problem of holding before the boys and girls the notios of freedom andtherightsortofidealsItisagreatthingtobeacaptainoffinanceora captain of industry,or to be the lord of vast estates,but it is a far greater thing to be a good teacherTheteachersadoptedanumber ofresolutionsbyarisingvote.Appre-ciation was expressed for the courtesiesshownthembyMr.and Mrs.J Moore,Mr.Karel Bondam,MiseCelesteHenkelandSupt.Mitchell ey also expressed their gratitude to Miss Annie Lee Kincaid of Cleve land,who had charge of the musicduringtheentiresession;to the peo nle of Statesville,especially the Ja dies of the Civic League for theirkindnesstotheteachers;to the man- agement of the (Crescent theater,entertained them,and to Prof mith and Miss Fulghum,con-luectors of the institute.Certificates of attendance were therpresentedtoeachoftheteachersand‘he exercises were closed with the money collected.The second R-4 draft act,the actionboardbeingstated first andtionthelocalboardlast: a“oe intilnings,exem uacbylocalboard.Has wife.Herbert Parker Clampitt,States-ville,R-3,exempted until December1;accepted by local board.Has wife.Preston Stewart,Eufola,R-1,ex-empted until December 1;acceptedbylocalboard.Has wife.Melvin Feimster,colored,States-ville,accepted;accept®d by localboard.No claim for exemption..zone n,ee -2,exempted;accepted byboard.Has aged parents.Harry Augustus Alexander,Mt,Mourne,exempted;accepted by localboard.Has.wifi Knox,colored,le.well.sows accepted by lo- ipe,Eufola,R-1,by local board. theac- accepted;Has aged father.Lonnie Hunsucker,Statesville,R-2,exempted;accepted by local board.Has wife.Robert Samuel Overcash,Moores-ville,ae ;aceepted by localboard.Has wife.Samuel Copeland Troutman,Statesville,accepted;accepted by lo-cal board,Has wife.Otho Andrew Clodfelter,Moores-ville,accepted;by localboard.Has wife,';Reuben Washington Johnson,Har-mony,R-2,lo-cal board. er.nlengine cmeneiytam-4,acce .board.Zetiie brother.Walter Lindsay Woodward,Statesville,R-5,accepted;accepted by lo-Hcalboard.Has aged parents.:Frank Burette Freeze,Moores-ville,exempted;accented by local onboard.Has a mother.James Morrison Bustle,Loray,ac-—accepted by local board.Has wite.James Abner Guy,Stony Point,ex-empted;accepted by local board.Hasagedparents.John Thomas Gillespie,Statesville,-4,;accepted by localboard.Has ie cl;aaeaiel b “—ville,:board,Has dependent family.Carl Maston colored,Statesville,accepted;accepted by local board,Has dependent family.Troy Garland Shoemaker nee,R-1,accepted;accepted by board.Has wife.——AbrahamStatesville,accepted;local board.Has aged father. parents.Kistler, by Samuel Japtha Westmoreland,Mooresville,exempted;ex bylocalboard.Has wife and children,Otho Eugene Sigmon,Statesville,exempted:accepted by local board.Has a wife.Archie Richard Stroud,Harmony,R-1,accepted;acce by localboard,Has wife.Ellis Munday,Statesville,accept-=accepted by local board.Has wite, James Walter Grover Brown,Mooresville,R-3,accepted.Has notbeenpassedonbylocalboard.Dallas Turner Holmes,Houston- ville,exempted.Has not been pass- ed on by loeal board.Ravmond Belmont Holmes,Hous-‘onville,accepted;accepted by local oard.No claim.James Burton Brown Murdock,Troutman,exempted;accepted by lo-cal board.Has wife.Parks Weatherman,Jennings,ex- empted;accepted by local board,where he made no claim. John Reid Winecoff,Statesville,exempted;accepted by local board. Has dependent parents. Ortell Landers Mayes,Moores- ville,R-2,accepted;accepted by lo- ‘al beard.Has wife. James Coleman Gailliher,Harmo- mony,accepted;accepted by local board.No claim. William Humphrey Johnson, Troutman,R-1,exempted until De-comber 1;accepted by local board. Has wife. John Henry Nicholson,colored,Statesville,R-3,exempted until De-cember 1;accepted by local board.Has wifeJames Floyd Clontz, R-1,accepted;acceptedhoerd.Made no claim... Raymond Thomas,colored,States- ile,accepted;accepted by local board.No claim.Carey Olian Caldwell,Mooresville,accepted;accepted by local board.Has aged mother. Sanford Bailey,Statesville,ex- mpted to December 1;accepted by ‘oval board.Has wife.John Barnette Patterson,colored, Houstenvilie,R-1,accepted;accept- ed by local board.Has wife. George Norman Sloan,Statesville, Troutman,by local ’ev Only about five of the 22 1 had with of Carolina.R-5,accepted;accepted by localChangesiaRevenueOffice.ad nape on the job.As I had heen ae hoard.Ministerial student.Mr.Hugh A.Love,who was nar-ordered to start them off at =mid-country for miles around is shot to Troy Lee Sherrill,Mooresville,R- cotic clerk in the revenue office,har]vient 1 wag forced to stay on the}pieces,and the rest is a network of|!,accepted;aceepted by local board.been transferred to the tobacco!js).at least 1 wouldn't consent to]trenches with shell holes interspers-|Aged parents..desk,succeeding Mr.D.M.Ether-|quit when I had been given an order]@d.All villages and towns within|Edgar Grier Waugh,Statesville,idge,who has gone to the to carry out.I had to co what |could|fame of the cuns have been exempted;by local board.t at onan]iththefive men and =_—See ae thats eters‘eee "UL conte Mason,Eufola,R-1;the }r silent streetsand no rly n,Eufola,R-1,ruled thatthe narcoticclerks are un-|“My work carties me over o[stan of lite.accepted;acceptedby local board.derthecivil service,and as Mr.Love}inrgo area and 1 have seen things I wroteyou in my_last tortee |he Se ee teehadn’t the serviceexam.never hoped to see.I can’t im-howworn out French|Walter colored,States-ination,he was .Porthe}agine a more iat thanone are,There is no glamour]ville,+,accepted by localbyMr.Collector|of the bie ‘ot a sign of about this war.oea -wife.has .RB.Ljlite andvery jon left killor be killed in Small,Mooresville,of 'county.higher than one’s waist.whole ‘(C on Eighth Page). eo Sie oe i ii:z ;7 i [: :f te & E z il f a la e | ‘iE is e i s ni t E:2?5isi t HE it t ‘a:EH= b u t e d 2&. f ieiZs§eé z ff iE EF i ra u fe f iE Ht z i l e o f t a f a ge : “1 :i °Fi ie salesman with the WhShoeCo.He succeeds Mr.Theeawhohasenteredtheservice.-James Lazos of H ls-and ane business asorniaitCompany,yfiledwithDeputyClerkGilla_volun-tary petition in ban ze - ties,$2,615.10;assets,$1,700.’Pearson,Morganton,is referee. —Peter Houston,colored,was much in evidence in26and80yearsago,is in town ¢ ing on his friends.PeterhasbeenaresidentofNew Yi18yearsandisem)electrical department of a railroad company.-No one from Statesville wentLynchburg,Va.,to attend theineyexterdayintheinterestBankheadnationalfs ;ville people are in inhichwaycomingthooNorthCarolina,but pot terest later would be more b Appeal For Volunteer Knitters.At the meeting of the Red CromFridayMrs.Clarence Steele waapointedchairmanofthecommittee.It was decided totaketheknittingof100 socks,50 sweaters,50 wales.50 naires of wristlets for the soldiersinFrance,and all ladies in ,ville and the county who willwiththeknittingareaskedto noti-fy Mrs.Steele.The society will furnish the woolyarn,the needles,where desired, directions will be given for work.An earnest appeal hasmadethroughtheRedCrosszationforfthesecomforts the alliesthusfar is less by $425,-authorizedcrednloan,ag-re than rst issue mainingEntenteheAmeri- at the time the credits of raising and maintain-|army and of in-naval forces and main-|naval establishment hassenfromthecomparativelysmall'amount expended at the time war wasdeclaredtothepresenttremendousdailyaverageandisnotyetfairly With the new national army underarms,the ship building and aircraftconstructionprogrammewel!under will soon reach greatly A conservative esti-8.Treasury daily expendi-beginning of the new year|at from $35,000,000 Administrator Appointed—Coal Prices. ident Wilson has named Dr..——of Wil-,fu administrator,anthracite coal _for pro-jobbers and set a limit onbemadebybituminous anthracite scale for railroad-mines,which include practi-big producers,andeffectiveSeptember1,$4 to $5 per ton (2,240.0 b.mines.Jobbers areaddaprofitofnotmoretonfordeliveriesofnotmorethanBuffalo.The job-bituminous is limitedtonof2,000 pounds,vered.prices are fixed as fol-:White ash-broken,$4.55;egg,.45;stove,$4.70;chestnut,$4.70;pea,$4;red ash-broken,$4.75;egg,$4.65;stove,$4.90;pea,$4.10;Lyk-valley-broken,$5;egg,$4.90;stove,$5.30;chestnut,$5.30;pea, $4.36Other producers may charge anadvanceof75centsatonof2,240overthefiguressetfortherailroad-owned mines.Those whoincurtheexpenseofre-screening itatAtlanticorlakeportsmayaddanadditionalfivecentsaton.The‘s order forbids railroad-mines from selling to otheronabasisofpricesfixedformines.coal administrazton will be or-as soon as Dr.Garfield hashisworkofrecommendingfoodadministrationagovern-ee the 1917 wheat crop.announced that heinstitutealicensingsystemcoaldealingsfromthemineretailerandthatifpricesfixedforretailersthelicensingbeextendedtocoverretaildealings.SE War Management Good. Greensboro News.For the first time in history,theUnitedStatesgovernmentissettingaboutmakingwarinabusiness-like.Up to date,noi a single “po-litical general”has showed his a ithatis,not since the most illustriousthemall,Mr.Roosevelt,stuck hisupandhaditneatpunched.Up to date also,althoug!green men have been ring into thearmybythehundthousand,notasingleseriousepidemichasbrokenoutinanyconcentrationcamp.Bythistimein1898,we had let.more mendieinChickamaugaparkoftyphoidfeverthantheSpaniardskilledinthewholewar.There have been 25,000menatChickamaugaparkandnotacaseoftyphoid.Up to date there hasnotbeenabreathofscandalincon-nection with army administration.It i cb Ee l ia t i l i and expeditiously is necessary only to say “embalmed|beef”to bring back a vivid and nause-ating recollection of how different itwasin1898.The first-mentioned ofhappyconditionsmaynotbethe t cause of all the rest,but con-nection is not altogether absent. +Ee-ee cae eee Suspended. ames E.Ferguson was suspendedfromtheofficeofGovernorofTexasshortlyafter9o'clock Friday night,when the board of nine managersnamedbytheTexasHouseofRepre-ited to the Senate 21,alleging offi. ,Lieutenant Governor,|succeededto theytheSenate.The gov- jh isters of 1 i ce n Uy fi g HlFf |aii i; te ti i li HG ; gr e E : 4}a th : Iti ci t ru z a iLr s==Tt FF eri at if . aE‘ | i F Z3 £2$ i EEE i enoughof these ,“All Germans have ized who istheinstigatorofthiswarandwhois|ithe chief enemy-—-England.Every one3,000 advanc-knows England is our most spiteful dig faster than a modern‘adversary.She spreads the hatred of|Germany over the whole world,filling||her allies with hatred and eagernessitefight.Thus every one at homei|knows what you know still better,|that England is particularly the enem‘to be struck down,however difficult/it may be.Your relatives at homei,too,have made gv-eat sacrifices|thank you through me.|“A difficult struggle lies ahead ofus.England,proud of her stubborn||resistance,believes in her invincibili-|ty,but will show that you can at-|tain still greater things,for the prize‘of the war is the German people'sfreedomtolive—freedom at sea andfreedomathome.With God's help we shall see the struggle through andbevictorious.” Another Loan to Russia. Another loan of $100,000,000 toRussiahasbeenmadebytheAmeri-can government.This brings the to-tal of credits extended so far to theRussiangovernmentto$275,000.000.The credit has been subject of re-eent conferences between SecretaryMcAdooandAmbassadorBakhmetieff,in which the ambassador hes pointedoutthenecessityofspeedyaidsothatneededsuppliesmightbesenttoRussiabeforetheclosingofherportsbyice.Some of the money probablywillbeusedtopurchaserailwaysup- plies and equipment.aApproximately2,500 locomotives,tens of thousands of freight cars andmanythusandtonsctsteelrailsandotherrailwayequipmentareneededatonceandeffortsarebeingmadebyAmericanproducers‘to hurry shipments.Detailed information ¢:s to the needsofallalliednationsinAmericanmar- kets is being collected by Secretary McAdoo in planning the ext issue of liberty eeiekeCompleteconfidence in the new Rus-sian government was expressed by the|State Department.Secretary Lans ing denied that news from Russia had caused this government to take a pes-simistic view of the situation,declar-ing that instead of there prevailing afeelingofpessimismquitethecon-trary had been created by the confi- dential dispatches that have been re- ceived. Policy Based on Might Doomed, Says German Minister. “A policy based on might alone and not on right is doomed to fail- ure from the beginning,”was the interesting admission made by Dr.Richard von Kuehlmann,Germanimperialforeignsecretary,in his inauguration speech to the main,committee of the Reichstag.Dr.von Kuehlmann laid down the flowing programme:First,the maintenance of cordial relationswiththeallies,and second,with the neutrals,“whose rights and neces-sary conditions of existence we shallbemostcarefultorespectasfarasiscompatiblewithenemy_trickery and our own military needs._“To arrest further defection of important neutrals is an extremelyseriousandimportanttaskconfront-iin "said Dr.von Kuehlmann.us, “We can only solve it successfully by observing the principie that in poli-tices might counts but a'so right and that only if we base our conduet on both can we hope to achieve lasting results,”| Germany has proceeded on the theory that might makes right.Thefacetthatoneoftheimportantmin- the German governmenthasdiscoveredthatthepolicyis wrong is evidence that Germany has‘learned something;and this infor-{mation may be useful to Germanyjandtheworld. |Murphy Family to France. |It is stated that the entire family of|the late Dr.P.L.Murphy,who was|for many years superintendentjoftheStateHospitalatMor-|ganton,will 0 to Franceorserviceinconnectionwiththewar. |Miss May Murphy has already gonejasaRedCrossnurse.Her brothers,||Drs.Alex.and James Murphy,who|have achieved success in New York,|}are members of hospital units and)|will sail soon.Mr.Robert Murphy,|another brother,has offered his serv-ices to his country and is awaiting or-ders.The mother,Mrs.Murphy,in|order to do her bit and at the same.|time be near her children,is planning|te go to France as matron in charge||of oneofthe basehospitals for RedCrossnurses. [ jearlier stages. i KiHl = “i H es 3 ef oE ° S F =f 32 9 43 3 g :eumiirngin.Theypassionforitand an iwell,for the allied artillery neverceasestopoundthemdayandTheGermanbeliefthatthey z can canadvanceisoneoftheoftheirdefensivetactics.Notwithstand-ing all that has been told a!thisline,notwithstanding thefortstorousehisenthusiasm overthepickandshovel,the Americasoldierhasremainedcecidedlywarm.fightHecametoFranceto|Germans,he says,and not to dig a'hole and look at them through a spylass.The French,CanadianAustraliansoldiersallresent theideaofdigginginandwouldnotad- mit the necessity of doing so untilbitterlessonstaughtthemadearly- bought lesson.It is purely a mat-ter of temperament and there seemstobelittledoubtnowthatonlyac-tual battle experience will convinceAmericansoldiersthattheabilitytotakeadvantageofanybitofcoverisoneofthegreatestassetsthemod-ern man at arms can have. “It seems a shame to have to curbthefirstlinespiritofourtroops,”said an American training officer.“But the men must be made to un-derstand as far as possible that im-petuosity must be subordinated tosteadiness.This has become a time-clock war.The men musi advanceingiventimeandgonofurther.Ev-ery step of infantry advance mustfirstbeworkedoutwithartilleryandwhentheplanisarrangeditmustbestrictlyadheredto.“We realize that it will be difficulttoholdourmentothisplan.Ifseeabattlegoingontheirfavoriteimpulsewillbetopushonasfastastheycanandsomeareboundtodo so,just as the Canadians did in theWewillundoubtedlyhavehiglossesinthisway,but themenwhocomethroughourfirstbat-tles will be worth their weight ingoldthereafter.They wil!learnquicklythevalueofsteadinessand absolute discipline under the newerunitsofourgreatarmyastheyget—"final preparation for trial byre.” Soldiers’Insurance Bill. Hearings on the administration so!-|diers and sailors war insurance bill!have been completed by a House com | mittee of Congress and an effort wil!be made to report it today for imme- diate consideration. Vigorous attacks on the measure are expected from insurance company interests who oppose the optional in--surance feature,and those who want no interference with the existing pen sion system.Debate may be prolong-ed several days by the opposition,al though ultimate passage by the Houseinvirtuallyitspresentformisex- pected by leaders.The principal features of the billareseparateallowanceforwivesand a.Negro F states that the yard wasofbothracesatthetime Siremoved.Sims was shot inwoundedinthebeaten.He was morning but couldaceountofthenight’s happenings,except to say that he knew of no ause for his treatment.It is said by members of his racethatSimshadmaderecklessstate-ments about the war and d en-deavored to st up o ition to thedraft;and that he incurred theenmityofmanymembersofhiscon-|xvegation by alleged misappropria-|tion of funds,A white man and a negro were ar-rested on charge of complicity in the mobbing, Si Wafevaees.PARKERBROS,Master GanMakers,Meriden, For Sale RyC.D,MOORE,Statesville,N.C.BRADFORD &HEDRICK,Loray,N.C.And All Good Dealers. SEED RYE. We have a few unfilled or- ders for Seed Rye.In ordertogetthestockinfortheseordersweareoffering$2.00 per bushel,CASH,until theordersarefilled.Get your Rye on the market whileyoucangetthishighprice. J.K.Morrison Grocery &Produce Company. Li4 ae Pe resOSTEOPATII. Dr.S.W.Hoffmann. OFFICE OVER Merchants’&Farmers’Office ‘Phone,324;’Phone,279 Green. Bank. House children of enlisted men of from $47 50 and up;life insurance up to $10,000 at about $8 per year per $1,000,foreveryfightingman;the right to trans- fer this insurance into a more quickly maturing form,at the same rate,af ter the war;$5,000 insurance for the widow of a fighting man who is killedwhetherheappliesforitornot;sup- Doors,Windows,Mantels, Cords,Sash Locks and Lifts,Hinges,Pad-Locks and Has Locks,Butts,Sash Weights and and Staples.C.WATKINS,N.Center Sstreet. port of woun men and their de- pendents Ly the government,while it is bringing them back to health andefficiencyinspecialtrainingschools:adequate cash provision for all to-tally or partially disabled fightinymenandtheirdependents. nate em neeeed TOBACCO FLUES. Don't take chances on curing your Tobacco with old flues,for the price of Tobacco is the highestthisyearinhistory.j We can make you the best price on flues. Write or ‘phone us.We can make delivery the day you order! . ee eee —as Conn,U.S.A Ce eee Will Continue AllThis Week ——---Or until we close out. he. 2he. Ye. 25e. 2he, 2he, 1 lot Hats,sale price,1 lot Middys,price,1 lot Collars,sale price,1 lot Feathers,sale price,1 lot Flowers,sale price,1 lot Baby Caps,sale price, We also have a nice line of White and Colored Skirts we are offerifig at a great sacrifice.See our line and be convinced. MRS.MARY SIMS. The Cash Store. re TheThough HoshandSuppliesies His Wife WithrentdereitchHepes" ‘No man wants his wife to work her fingers to the bone!He wants her to have everything that will make her workeasier—save her time—give her leisure—for this makeshomelifebrighter,happier,sweeter,No wife can do herself and her family justice,whenisheisallfaggedoutbyneedlesswork.Every woman who does not know the value of the|McDougall Auto-Front should visit this store withoutdelayandlearnhowitcutskitchenworkintwo. STATESVILLE TIN CO. Phone 55,114 EB.Broad Street. THE SLACKER And nobody wants a slack Tire. Unless you keep your Tires re- paired you have a slacker with you at all times. &SUPPLY COMPANY. Phone 201 Court Street.|! Full line Tire nd Tubesiniresa _— Williams Furniture 7 House. @ @ARegularPicnic For you if you carry one of our newThermos Bottlesonyourouting. We have large,small and medium.You can serveSpeatthefighttomperedurn,pave andSbudingthescaeéifantee Keep hot or coldindefinitely.Indispensible toautomobilists. We'llbeglad to showthem to you. ee ean oer eemmnceieenentne onan anon Graham Flour,fresh lot right from the mill’ Don’t forget that we have anything you want in the way of Spices,Vinegar, Extracts,Rubbers,Jars and Jar caps. Phone 89. Eagle&Milholland. ee ne eee me eeme ee FINE LOT COUNTRY MEAT. Miller-McLain Supplyo.| Harmony igh Schood. A Farm Life School | For Girls and Boys.| SPECIAL COURSES IN--| ' Home Economics,Agriculture and | the Manual Arts. Prepares for College and Universi-; ty entrance.t Fall teri opens TUESDAY,Sep-| tember 11,1917.Engage board now at Dormitories.\ For further information and new Hlustrated announcement write to R.H.LANKFORD,Principal, Harmony,N.C. omeneeeneneme Builders Hardware,ing Material, mber,Paint. C.WATKINS,‘phone No.43. WANTED! SCRAP BRASS —Heavy Brass 7c.per pound,Ligh.Grass 5c.ver pour d FOR SA LE: New and second hand machineryforsaleandallkirdsofboilerroomsupplies. Cc.H.TURNER. Tredell "Phone No.74,Beli No.7, Battery Trouble Righted. If you have Battery trouble,bring us your Car.We'll locatethetrouble.All work done byanexpert! STATESVILLE MOTOR CO.. frNOTICE! Have left my accounts at Stim-son’s Drug Store.Those indebt- éd to me can see a statement of their account or rake settlementthere.Coite L,Sherrill,M.D. rames will fit the NC-130,ne ‘tate Rev.Mr.Williams,died yester-|line of khaki-clad soldiers,and then, For a bag of Davis Bros.| {' ~ae const 28,PTUESDAY,5_-August 28,,t lb keptit up till 1 | and was wellautomobile wreck near Conover 4)xdmiration. AS B. -- Al #2 #8 BS e 8 8 5 e 8 ta pr.&10.25RASBad IT WAS MR.R.K. dt was Mr.R.K.Murdock,for-merly of Statesville,who was in the| ai |o || week ago today,mentioned in‘Inst Landmark.Mr.Murdock was in|Statesville yesterday.Aside from the 'Morganton when the i }iday at her home at Davidson. ' ‘Sart of town, Mr.‘and damage to his ear he was not hurt.His little daughters comes racti-‘ally unhurt and his -in-law,| Rev.Mr.Shelton of Lexington,was)oruised.The party was en toute to|accident hap-|pened.| Mr.Murdock and daughters are|now visiting Mr.Murdock’s brother,|Mr..T.F.Murdock,at Hiddenite.|They will go to their home in Dur-| ham in a few days. Deaths.Miss ay Williams,daughter of the| Tn terment will be today at DnrvidsonMissWiiliamswasatrainednurse| and was known to Statesville peopleMrs.Dunlap,mother of Mr.Pink|Dunlap,who lived in the southern)died Sunday at the|State Hospital in Morganton.Inter-|ment was at Morganton yesterady.|Mrs.Dunlap attended the |funeral, |the fnice at Mt.Ulla Saturday. MR.LONG AT MT.ULLA. Mr.Z.V.Lone of Statesville wnspeakerattheJuniorOrderpic- The Jun- stand for patriotism,Mr.Long » iors |talked patriotism and found a heartyrexpoftse.They had a good day and a fine dinner and Mr.Long’s onl) ‘seyret was,that being indisposed he‘ouldn’t do justice to that dinner. ‘ORJECTS TO ANIMALHOSPITAL Mrs.M.J.Deitz asks The Land-mark to any that she objects to the location of the hespital for sie ani mals which Dr.Cruse proposes to build on Water street,in the vicinity ff her residence,as she thinks itwilldamageherproperiy.Mr: Deitz will ask that the location be ‘hanged. MR.SLOAN TO BALTIMORE. Mr.©.K.Sloan has resigned his ition with the Ed.G.White Mo- Company and will leave —this seek fer jaltimere to begin work or the John Deere Plow Company, ‘s traveling representative in east-ry Maryland and parts of Virginia. His family will remain here for the resent. ‘CIRST BALE OF NEW.COTTON. th or ‘the first bale of North Carolinaewcropcottonwassoldin)Monroe turday by J.EB.Arrant.The bale vershed 549 pounds and the price was 24 1-2 cents.Mr.Arrant receiv- '$4 ‘or the cotton and $37.50 for he seed,the latter selling for 31 per nel. To help their employes cut the vost of living,the Durham hosiery mis will furnish then coal and ice *t cost. Whenever You Need a General Tonic ..Take Grove's, The Old Standard Grove's Tasteless‘chill Tonie is equally valuable as aGeneralTonicbecauseitcontainsthewellknowntontepropertiesofQUININEandIRON.It acts on the Liver,Drives out Malaria,Foriches the Blood andLuilGsuptheWholeSystem.60 cents. NATURAL REMEDY FOR PEL- LAGRA! Acid tron Mineral Brings Relief Frem Disease By Removing Cause. USED IN PELLAGRA INSTITUTES ‘those headaches,singing in the nts,Cull,tired feeling,black spots on the skin,burning sensation,red ‘ash,and other symptoms of pella cra,may be eliminated by the faith ul ure ef Acid Iron MineralPollayraisprimarilyaliced dis ease and Acid tron Mineral rine relief by correcting the cause Acid Tron Mineral is not a *dope” y patent medicine,Tt ois obtained from the only natural mediejoal ire mineral deposit of its kind Bouown to world and in addition to thre form oof natural iron,centat pe asscum,Magnesium cal andootum,medicinal propertic which tell you are effec of the bloor our ‘loctor will tive in the treatmentnerves,kidneys,stomach and {lac tayFor more than thirtw ver tors and hospitals have |A-1-M.Pellagra institutes are vise using it.Get a boitle j tren Mineral today.It 3 mn remedy for pellagra At all”reliable)drugyists in 50c and $1 sizes, Use A.I.M.iran ointment fo skin eruptions,old sores,eczema, ete die, ‘MagnoliaBalm The secret of womenwhe knowhowtotakecareofthecom- plexion.Cannot bedetected.Heals Sun- stopa Tan.Soothing,cooling,refreshing.- White,Rose Red. FSe.at orby mati dire,Sample (either color)for 2c.Stamp. Lyon Mir.@o.,40 South FifthSt.,Brooklyn,N.¥. ADVERTISERSwill ,plonse bringNS and Windowshe sells.He sells hengeof early.No of EEes Sd Fearaniced oie oe HURLING?.._c.WATRANS. the company to be proud ofoem er’s son of them.The line ha Special Correspondenceof‘The Landmark..22 —The Piedhasbeen#ta-tioned here for thepast five weeks,|left on a special train Sundaymorningat8o'clock for Se-vier,at Greenville,8.C,for departure had been for several days,but were not reeeiveduntilSaturday.The hour was early,but by 7.80 there were hi ofpeopleatthestationtoseetheboy»aff.Forming in line before the ar-mory,the company marched to the train with drums beating and flags wavine—a brave and si pa-rade that brought thrills of prid@andAndtrulytheywere- th- for a few minutes at the station,an@ in-stantly the crowds rushed forwardograspagainthehandsofthesol-diers and wish them “good Inek andgoodbye.”Many of them wereatrangersherefiveweeksago,buttherewasnotastrangerinthecompanySundaymorning;and as’the boys.turned to shake the hands oftheirnew-found friends again andagaintheyexclaimed,“We're com-ing straight to Mooresville when we get back.”Until the Inst minute,and after the order was given to board thetrain,the crowd surged along the followed by cheers and good eS,smiles and tears (or rather tearfulsmiles),and fervent “God bleas you"! the train pulled out,while the boys crowded the windows and waved, wreetings to the crowd that watch: until the train was out of sight,and then turned to say to each other,“How lonely the town will be with-out the boys"!Yes,we shall mithem.From the captain to the lastprivate,the Piedmont seetion eanboastnofinermen.The town ha felt their stay here an honor and a privilege,and their courtesy and ap- preciation of the kindnesses shewnthemhasbeenunfailing.Many of| them are from Mooresville,but in. five weeks they had all found a warm place in the hearts of the peo-ple and the last one will find a hearty weleome here at any time.— Soldier Won Mooresville Bride. The goodbyes Sunday morning were mingled with congratulations for Private Hal.Hays of the Pie:- mont battery.who on Friday night motored to Charlottc,being evident v bent upon makine his calling and sleetion sure before he left for eamp, so far as the matrimonial question was concerned.He was accompa- nie!by one of Mooresville’s most popular and attractive girls —Mies Gay Kennette,the youngest daugh-cer of Mr.and Mrs.J.M.Kennette The ceremony was performed—in harlotte,Rev.Dr.Crowell officiat- ne,and the young couple returned to the Commercial hotel, remained until the groom left with his company Sunday morning,_re- ceiving the congratulation of |their netly surprised friends.Sf Hays was employed as bookkeeper ‘at lislist the Ford Motor Company =garage here for severul months previous to his enlistment.He is an estimable younr man and has made many friends in Mooresville,who will wish for him a safe and early return to the fair bride he left behind. Boy Died of Searlet Fever. The town was saddened Friday evening by the death of Willis Bar-wer,the 8-year-old son of Mr.atid Mes.Paul M.Barger.Becoming if Monday with scarlet fever in itsrstform,he grew gradually worse until the end,despite the faethatallpossiblemedicalaidwas rendered,A short funer:s <ervice vas held in the yard of the re-idenee Saturday afternoon by Rev.1 A. Themas of the Lutheran chorch,the iviet quaran making it ompose side for any ot to enter the hone. The hody Wis ONVEV¢|St. Lake’s charch,Rowan county.for bt rial Resid hi narents,Willis esves a younger brether :a cif. tor.the latter being also il!with arlet fever,and numerou other clative H:.denth is a sad -hock »his pares vho have the moa thy of all »krow them,\¢ht nd attractive child and posse of +p Yt hat never faied to 4 f do.be wae unusual ube in th wn and loved hun- of friends.Ths ri ‘8 devot made him ‘|fa- ‘al anil 'av |!will he !“dd. fever Quarantine er ether ca of fe- er ha ryrte }wn th 'Ho en hich yder of th (dys he pr alenee ¢it- let firs our tewn,all parentsarenotifieep }hitedee inder 12 year re Wothe streets and from .!Lie places 1 yatheorinws ou her vrice.”Th order will be lyforced,and it is hope hat n- on may be prevented Lichtning Strack Hous: During the thunder t her Viursdav afternoon,light:rich residence of Myr |{k, hatteving the sash and gla vo windew Mrs.Clark wa in he feee by flying gla u ed painful cut Personals. Mr Johnsie Harri tredMondayfronttwoweeks’to vy Mack Deaton,her at Hrnterev tbe Mrs Ellen ‘I 1@e ton and daughter,Mrs.©.7?re, ‘e Saturday for Burgaw their home,after spending tw:months here with relatives and frie:They nent moat of the time at M (haa. Stevens’,wth Mrs.G.Wo Temple- 'Messrs.Emmett and R Mor. mv of Amity,who spent me n the mountains,returne home Saturday nih Miss A Alh ieht of Cherlotte came |Vooret- ville Seturday nieht to rela. fives.Mies Lou Lippard of BariumcamedownSaturdaynighttovisit Meesrs.Watt and Pres Goodman and families.Dr.W.PD.GilmonetookatriptoBlackMountainSuitdey.Myr.J.P.Mills,Jr.,who is nowstationedatHendersonville,visitedhomefolksSunday,daughterSarah.‘Mr.and Mrs.E,W.Brawley,w where they . fo the Editor of The Lanamark:| Extension of the city of States-ville is the imminent question of the hour—-to he or not to.be.If this | werd “extension”is #0 icomprehen-vive as to include ex ion and real,uplift te the tewn,no good cit-|ixen,with the real good of the town)at heart,should treat it lightly,,even though the deadfall onssomeofhiscovetedholdings.ingjirectlyinthelineof.its blanket ef-;fects,I confess that I see through a’glass darkened by the |personalquation.Still,shall I allow this tompedemytown’s progress,becausetdoesnotstillbearmealongonits;tide,as of yore,without manor andwithoutpriee?Everybody knows hat imminence to the town is what rives value to the environs.Whatwouldthesevacantlotsandlandsbe worth five miles in the country?I im afraid that the capaciour pocketindmawcoolstheloyaltytotheirownofthosewhohavethehappi- ess of the titles to these environs, which their mess in hy-gone lays caused them to enswamp.It's the boast and pride of every man hat Statesville is his home,and that he can make the proud boast that he a “citizen of no mean city.”The iin living just eutside does not im press this on the stranger.Now he is the swim. Take,fornillsnewenjoyir instance,these cottor the most unpre- ’And Hay Rakes,McCormick Corn ”~ Binders and Shredders.These =“1 Machines you will need for the ie Hay and Corn crop now growing.“: i The man who buys one of these - machines this year wil)get it for be "i less money than for a long time to * Pr come,as prices will be much ! higher later. {e098 «uented fortune their lives.Can't »oat hey in all their undreamed-of pros-&a nerity,allow the immediate town,§y-on gomery are ‘ hich has always shadowed them .Wily with its wings,and whose name (oss viorns their letter and bill Reads.to th "m *:4 Py oe ANEML Pha eaten ,riieipate just a little in their Sse EEN AI i Lit eacseihanaieaioniertsctttatinatatieaiatati o peritv?It is true they have ade some dreary marches in the -See wilderness,but that is all behind hem now.For the unproductive,outlying lands,I think a small valuation hould be named,and further carry-with it,the right of the dwellers in these regions to fester all the hogstheyeannourishand=support;the hoz,the peor man's dearest friend,he rich man’s most faithful ally JBERTY,WITH NO ALTERNA- TIVE. Aug.27,1917. Pay the $5 and Save Rover. Co the Editor of The Landmark: As “T.E.A.”is such a clever,jo |fellow,—could not help readin: his article with sympathy.1 wonder hould “T.FB.A.”return home some lark,wet,dreary nigii:er on other casions when his spirits were iown in the heel—rooping—-and fai! meet Rover with his strong ties friendship and affection,wouldn't here be danger of “T.EB.A.’s”ge- nial,broad face languishing into aleony,wrinkly,sad countenance ?\ I susgest that “T.FAL”plank wh thet $7 war tax to help thrash t Germany and the coin the may- r exacts for a city permit,and cut hole through his palings of good ind suffleient size for Rover to go in and out,and save the expense of tying corn.Surely £5 would =pay for 20 dozen eggs and should =the ‘igh!present bills for missing re,alwavs insist en proof heyand mnable doul-t tha Rover wa ”transereasor,dim Tharpe will ell you egret at 25 vent per dozen than two bushels ef corn nd doutitle appetiz ver than corn cakes. the iden of looking on “T,“dangnishing face and oun app!should Rover’ to fi state Hey or rugged hillsideG.J.N. are cheaper for €5 eto R Snurr more len sant vehHhodyhav lov in on some Cleveland,R-2, To Clean Bethany Graveyard. ark OR ren f Bethany chureh ast all wt wrt ted thre Aug.21 sweeauenacnece of The tLandr vey ‘o ‘noob ared che ‘dey,1st. large an!th r en is sheaWeexnicttheseofof}ot h ‘ relatives Hoto beauty romemi whereburiedandanswer th that ploce Come prene:‘ng ‘he is toand chireh yrroane re cleaned until yem been on ao om retherelto her | Smit f Tew da h Pr.Bo Seitt t]Cood Amity re herve | Temes tireMr.FON rovedfarm i t |ened Piidav *'' househol:‘helrunabe‘iy me here,bout th made the form Mias Vyas! for the W.W.Ra Fannie Walter pent at } the Northe:market M ! Hender mill th J P fills ¢h ‘!for the past nf Wo week vi et the tripMrs.Goo Iny fives at frem :“5 'i tea reBiatnsvillnandNewton Hahn cam vo nis Purlington t«p i tt 'ant with his fami)lot Moends ’nl Newton.Fire:I White.who con Fart Owletharpe :an offic:n the field artillery,is visiting his porents, Mr.erd Mrs.M.W.Brown.LaterehewillbeencampedatColumbia,8 . Stomach ond Liver Troubles.No end of mikery and actual caffering2orbyditerderofthestomachandliver,ot *mre 1 be the we of Chnmber- «ve.thom 4 triak They ontyfn, A bedspring that can’t sag because of the patented fiex- ible hollow strand construction;, that does not roll you toward the center because it cannot sag; that is absolutely noiseless,having nothing about it to creak or ie that conforms to the shape of the body;. that has no loose strsnds,open linksor sharpcorners to tear bedelathiag Quaster century guarantee.30 night's freetrial.: SRT Ee ET ,:~¥ » PEACE INSTITUTE,RALEIG { For ihe Education and Culture of Young Women.» STATESVILLE HOUSE Classical,Literary and Scientific Courses leading to diGraduatescreditetbyStateDepartmentEducationferTeachers, Certiticate Special diplomas awarded in Music,Voice,Art and. Expression.Excellent Commercial Course,Domestic Selene. Domestic Art.INSTRUCTION:Specialists in all departments,tia SITUATION:Lovation.in capital city gives special opportunities, Delighiful secial advantages ' ATHLETICS:Supervised indoors and outcoors by nthletiediver.ter,Special attention,individual development.Climate permitsout-door life all winter.‘ For catalogue er further information,write at once to MISS MARY OWEN GRAHAM,President. —-—YOUR eeeee ee FeoeeFAVORITE ee 32 5 3 3 2 5 ; ——TIn Condition,—— That's Fit To Smoke. Thal’s The Way We Keep House. SPORE OF QUALITY. States,ille Drug Comp’y ereees: rsonggsaEtt INGERSOLL DOLLAR WATCH |War price $1.35,See me if you are in neednykindofaWatch.1 can supply that wen ee eo tnta eit relly etinetisingyaeeeemerng ofa |In stock,Hamilton,South Bend,|A tham,Eipin,New York Standard, Bedi,a “€*,vf |HB VWOODWARD Jewcler, EE ———-eevenmerecwmmnenampamenaeesetwreee DR.VANCE HASTY,DENTALealnetar sunares."|NEW SEED BUSINESS.|FIRST NAT MAL BANK WUILDING,{'‘a |Turnip Seed in packagesandinbulk.Also-a SS :|variety of other gard@n |Kiln Dried Flooring,and Field Seed.4Base,Case and;—AlNew.Moulding +LN :0.WATKINS. TELEPHONE ENGACEMENTS,5 19%.Hours *to &SPRCIAL ATTENTION TO CHILDREN'S TRNTH. a es |Hi | il l 32 n 8 2 it a: FE if | z‘EU a e i wn fact;Comingasaclimax to a series ofso-calledvolunteers|minortroubles between city volunteered at all and ey arias they not been driventoit by the site for the Mlinois division ofationalGuard,rsday’‘ised the priv-'break createdareignofolenanyway,they exercised =ma .hours Ot "the 125 :ve ir camand,so far as the public|mands.The others have waited to ac-nition for a raid upon knows,without criticism from the!cept duty where the government as-but eight were accounted forGovernorortheboardoftrusteesofsignsthem.av Sa that the University.The negro profess-|The men who waited for the op-|The certains kbeued 0 Guth ti or at the Greensboro college,who erations of the law and who answer-'tween a policeman,wno nad arrest-| has neither the education nor the ed bravely when called,have nothing ed a negro woman,and »soldier ofwisdomofhiswhitebrother,writes |of which to be ashamed.Neither is the 24th infantry,who her’ a letter complaining that his race is it to the discredit of any man that broke camp end joined ie i unjustly treated,and forthwith he asked for exemption,if he con-der,which quickly developed into a}there is a clamor for his head.The scientiously believed he was entitled riot and clashes throughout the’ negro’s letter,addressed to the to it.These remarks are made now Might between the negro:.and the police and citizens.President,was not proper and he de-to urge that our people show no dis-Hylen took charge of the situation serves reprimand if not removal.crimination in their treatment of the early Friday,when martial law was, But so far as his influence is con-volunteers and national army men.ee.a sdiere.|cerned,so far as the harm his letter In Iredell we have honored the vol-|Pgh aaa ak iiincis Guardpeans| may ¢o,his offence is not to be unteers and shown them courtesies,and several companies of Texas mentioned in the same breath with|all of which was due them.Next troops were assemblea at Houston|that of Prof.Williams.This is|week the first quota of those select-awaiting ordersto pesees te Sie rank injustice,which can neither be ed by the government will be called <Tilinots aman was ‘composed | execu nor defended.to the colors.Show them someap-!of negroes,but made no attempt to Arejthe young men sent to the |preciation.It would be cruel to al-join in the rioting and officers de-| University to be taught by Prof.|low them to go away unnoticed.pace pling —uae.Bee. Willingas that this country has gone They are the country’s defendersasNational Guardsmen aided in guel-into afworld war as a matter of race!much as the others,and the spirit ing the disturbance.Captain J.W.. prejudice,not as’a matter of prin-that would discriminate between ——of A ee ar-|‘:::tillery,was among those :seal |them io netther patetetic nor just.The trouble is said to have started—_—_—_———eee after some of the negro soldiers had, Houston,Texas,owmht to be suf.)rere THAT MAY YET COME complained of treatment accorded ,’.)f.sa ;ait su.A few people may or may not re-them by members of the Houstonficient}evidence —evidence that well anes Gel aus eels ane Or police —_—ot -_ informed §idn’t ,‘80 negroes,later being joined by oth- ed of os didnt |Thos.E.Anderson and The Land-ers,formed at their camps and be- ing négro soldiers ie aan com.Mark joined forces to inaugurate re-gan a march toward downtown|::-j ,Houston.Lights in residences alongmunities.The disposition among ae cated ae hid funera’s the way were shot out and a number soldiegs to resent control by civil au-|——Cannan ae ©of persons wounded as they sat in- thorities is always in evidence.That|custom of wearing mourning and side their homes.. ,wanted the cost of funerals reduced; .Major K.8.Snow,commandingspiritjsmuchmoreprevalentamongDr.And i to fi th the negro troops guarding Camp Lo- negro soldiers than among whites,:nesteon prerees:ne :x ©gan,declared that he attempted toforreasonsapparenttoanySouth-price of coffins at not exceeding $12.control the men when he saw what rue.al when =saa aoa That last came near getting the doc-was about to happen,but they werer.,"or :ay *.5 in coritact with ‘he anes of civil oe ee eee ee eee red igo esthorityintheSouth,trouble is like-Some of the undertakers intimated the camp and some scattered in ev-ly to:follow.The negress make that they would take pleasure in ery direction.An attempt was made good soldicrs when disciplined ang |burying for leas contr@led,but few of them can he trusted while in uniform to properly than $12--in fact to kill Major Snow,he declared.Ev-‘would do the job nothing if idences of the brewing riot became behavé themselves in a Southern commpnity.It’s a matter of regret ~apparent in the evening and Major t thisisso,but it’s to the-..Gent Gis is ae,BekIt's no ae ta the But all this is preliminary to say-begun to shoot at random while gro soldiers,who shot up the town following from the Greensboro Rec-|the streets were put under heavy pa- ,in America are urging the same cus-19th infantry,under Col,Millard F. said.‘They want te try the men in Goods Economist is of opinion that;coast artillery from Fort Crockett, 'soldier is now of prime importance.veyed them to the camp store house, persons and the wounding of 21,get| munity;the unnecessary burden of!violence and that at the same time was tot i LETTERS The rioting of negro troops at pressed —folks who were trying to Snow received word that the negroes put over a proposition to take bread hed entered the ammunition tentsfromthefamiliesofhonestunder-and armed themselves.He attempt-takers ed to —~ee _were already beyond co ao ==ing that the war,which brings so marching toward the city. aeaneeonmarenmenesnn much evil in its train,will also bring Police,citizens who armed them-ene eee :;.selves and 15 truck loads of Feder-The civil authorities at Houston,some good,one thing being the dis-atized National Guardsmen were Texasy have indicted the rioting ne-|carding of mourning costumes.The)rushed to the seat of the trouble,all i |;trol and quiet secured after the riot- ny mem,ee =——story:.|ing had continued for two or threemiliauthoritieshavethemenin|It is said that Europe has practi-jours . charge and it is intimated that they Cally discarded the wearing of Sa may t tried by court martial The Mourning and commercial interests!Flanked by a full battalion of the civil Quthorities resent this,it is tom for this country.The Dry Waltz,and three companies of the Land:,the temporary abolition of mourn-Friday the negro soldiers werepeal-y,Th mae onl foe |iRB may be a powerful factor in the marched four abreast to me parade aa there any special cause or |war.reity of fabrics,it is said,grounds,where their arms weredispute,so long as those proven will increase the cost of mourning stacked.Army trucks then loadedguiltyofthepromiscuousshooting,|00ds and food and clothing for the the rifles and ammunition and con- which resulted in the death of 17ectirty esago Roney Ward |wherethey wore pins inter heavy a 8 a move-guard.Surrow y his own menwhat?they deserve —whether by ment against the universal habit of,with loaded rifles,Colonel Waltz hanging,electrocution or facing a Wearing mourning,and pointed out;then addressed the negroes,telling| firing.squad The Landmark is in the depressing influence on a com-|them they would be protected from,;4 : clined to think the latter the quick- est and most effective way. ETM expense and comfort,and for a time!they would be preventec rrom comitlookedlikehewasgoingtobeablemittingfurtherviolence. to put over his proposition.But it Indignation over the outbreak wasfailed,principally because at that particularly expressed because of time,with abundant material in the the savageness displayed by the ne- world,commercial interests were in groes toward the white police offi favor of it.cers who were slain and whose bodIthasalwaysweenourideathatiesinnearlyeveryinstancehadbeen a small band of crepe was sufficient hacked with bayonets.Among themourningforafrienddead.If one’Wlinois Guardsmen also much feel-nt home loses a friend,near and dear,the ing was evident because of the mu-all the warnings of years,that heart is where the burden lies,and tilation of Capt.Jos.Mattes,one ofhewspaperswillprintarticleswith-|all the display of black goods from the first to be slain by the rioters.out Knowing who is responsible for,all the looms in the world could do Recause of this feeling General Hu-them,is a mystery:and vet hardly a "Cthing to assuage the grief.The len ordered the public morgues,innyFeecans*“\world is always in sympathy with which the bodies were held,to closeweek,passes that articles without those distressed,and a simple band ‘their doors to all except immediate names signed are not sent to this of crepe,an inch wide,would be relatives of the victims.office.If the “Friend of The Land-S¥Mficient notice sai the wearer One —the —soldiers was si -‘.,Was in mourning.o see a woman ed and a number were =woundermark”doesn’t want to disclose his jiterally sealed up in stuffy black,Among the wounded was a whit: identity to the editor he can't en-wearing veils and heavy fabries,is girl.Blanket charges of —murder lighten the readers of this paper. ATESALND ATI “A+Friend of The Landmark”is advised that when he =sends his name to this office his communica- tion will be printed.It is not desir- ed to.print his name,but how any- body ‘ean figure out,in the face of jaltogether wrong.Just «custom,were filed by District Attorneyandthehopeisthatthewar,which Crocker against 34 negro soldiers oe pete a wait until theyis bound to bring us many reforms,Secretary Baker will take no acgtir"s supply of coal at Will include the mourning habit and tion on the rioting until the reportbeforeshoutingtheprais-|knock it out.It has no place.,of the board of inquiry into the inciestheadministrator.—|SEE ident has been receiv Whatever isGreenrboroNews.|Bruee Craven,writing in the/done,he said,would be based uponItmightbejustaswell;and the Greensboro News,states the whole ‘he ~——of that board.ermanwhohaealreadyboughthis!case in the following paragraph:ar.Oe woes ne +gene ad:|‘an thewinter,sapply at high prices will not!Since our own boys have =to of "waiting editions colored troopsfeelgoodiftheexpecteddropisre-this war,facing the pooe jlity of in Southern States.Senators andalized.death,I don't want to any ene members of Con from TexasSere:intimating any doubt about the and other States in the South calledboardwhichinvestigatedthe"i#hteousness of the cause for which on him during _day to discuss theTheIslandNavyY.ion of they are to go into the valley of the subject.July wih ea Jed the South of'®aped ee &_our part ol 5 --:jonor supreme,reported annwas undoubteny:didn’believe it,1 would at least draftedofacriminalconspiracy,|KeeP my mouth shut my|traithehavenotbeer,\"¢ighbor’s sons the|tFreFeportindicatethatthe0Tuntofit.One certain thing aboutitiswerenotthere,ae.”hope of |some of the aa a us would be.f, ,French,Italians andcpaatsSe ie9*when -Riuerw,ee feel like taking off my hat to|uniformed man I pom What areoa,fighting for’?In order thatyimaystayathometnpeace!ea ve espeeOs Se6goandbechetoosoonasyougetthere. || ‘base on On both sides of the Verdun of the German crown princerightbank,having captured posioverafrontoftwoanaahalfmiadepthoftwothirdsofamile,reach- iiZJi E ¥ fe 7s & skirts cf Bethineourt and along thebanksoftheForgesrivulet.\The Germans in counter-attacks|twice have endeavored to retrieve loctgrcundontheheirhtsoftheMeuse.!but cach time met with repulse and|heavy losses.iAsidefromartilleryduels,there has;been little activity on that part of|the line in France and Belgium held|by the British.Field Marshal Hoig'smen,however,have cavricd out sever-al small trench raiding enterprises|with success and repulsed German; counter-attacks.| Evidently the German advance to-ward Riga,Rassia’s big port and naval the Baltic,has ceased,for neither German nor Russian communi-|cations mention the operation in thisregion.To the south,however,theRussianandRusso-Rumanian armies are keeping up their strong resistance against the Germans. Farmers’Meeting Begins Raleigh Today. Final arrangements have beencompletedforthemeetinganden-tertainment of the 1,000 or more offarmersandfarmwomenexpected|to gather in Raleigh today,Wed-,nesday and Thursday,August 28-' 30,for their 15th annua?convention. The boys’and girls’short course attheA.and E.college had an attend- ance this year 75 per cent.greaterthanlastyear’s attendance,and it isexpectedthattheatiendanceoffarmersandfarmwomenwillshow almost as great an increase.The convention this r will de-vote its attention very largely to theconsiderationofthefarmers’part inhewarandhowbestthesarmercanvervethenationinthisgreatcrisis.John Paul Lucas,president of the)‘convention,is executive secretary ofheNorthCarolinaFoodConserva-on Commission and the dominantnoteoftheconventionwillbefood “reduction and conservatton. The field demonstrations,lectures, te.,will be under the direction of1eexpertsoftheStateExperiment ‘tation,the North Carolina Exten- ~on Service and the faculty of A.& k.College.Addresses at the after- noon genere!sessions of the conven-ion will be by well-known agricul- ‘ural and livestock authorities,—in-luding Mr.Bradford Knapp,Dr.W..Massey,Dr.C.A.Cary and oth- rs.One of the outstanding featuresvillbeanaddressbyGov.Bickett. ee Fire in Concord. Fire in the press room of the Con cord Daily Tribune,early Sunday morning,destroyed the Babcock press Ginghams, Devonshire Cloth, Suits and Coats, Skirts and Dresses, Ladies Neckwear, Velvets and Dress Trimmings. Something New almost Every Day. TheStoreThat Pays the Postageon Mail Orders. at e Pi ee ee wl Te t e ’ be a t s oe eS ee ee EE EE ee ee ee two folders and a big stock of paper|}and supplies.The press room was intheannex,separated from the other|portion of the Tribune office by fire! doors,which were closed.Except for | some damage by water,the remainder f the office wos not seriously damag-|nd: Through the courtesy of its neigh-| hor,the Concord Observer,the Trib-| une was able to appear yesterday as|usual.The numerous friends of Mr.J.B.Sherrill,editor and owner of|the Tribune,will sympathize with him in his misfortune,and rejoice that it! was no worse.| SS a eS One tep-horse power International Engine,Vortable,togethe:with one bread meal mill,so feed mill,Entire outfit tor sale. casonable,Can be seen at Fred H. ers THOS.J.CONGER”NOTICE OF DISSOLUTION. The4V.Lone and dno.A.Seott,Jr.,under thenameandstyleofLong&Scott,attorneys-at-law,has been dissolved by mutual consent. Any acounts against the firmwiltbepresentedtoMr.ZEB.V.JNO.A. Aug.28--6t.° Con- Souvenir Day! The Public Is Cordially Invited on SATURDAY,SEPTEMBER FIRST To attend the opening of the new of the CAROLINA MOTOR COMPANY onEastBroadStreet-just opposite the Statesville Inn, Every car driver will receive a souveniroftheoccasion. Clean,cool,handsome in appearance,anddesignedforthequickdispatchofbusi-ness,the citizens of Statesville shouldwelcomethisnewadditiontoitsbusinessdistrict. Your Presence On This Occasion WillShowYourAppreciationOfOur© Progrcssive Spirit. We hope to register the name of every guestonthisday—a record of friends andbusinessassociatesthatwewillcherish for all time to come. “Look for the Garage with the Green Roof.” “WE NEVER CLOSE” Carolina Motor Company. oAeerete ne am ee gp =A emeronareRa seme LEST WE FORGET. Now.is a good time to select that Monument forlovedonesve.We aassortmentofbothGranite'and Menble inTombstonesandMarkerstoselectfrom. Barron&Conner. naa ohocy |Master John McLaughlin will _en- tee this evening in honor of Miss ‘Evelyn Wilkins of Goldsboro,who is 5 her aunt,Mrs.J.F.Bowles Birthday Celebration —Stony Point Items.| Correspondence of The Landmark. |Stony Point,Aug.27.—At the home, “of Mr.and Mrs.[).A.Sharpe,in this place,last Thursday,a very enjoyable @eeasion took place when their many| relatives and friends gathered to cele 'brate the 59th birthday of Mr.Sharpe About 100 persons were mt and |a well-filled table of the choice viands of the season was spread before them. |Mr.Sharpe is the youngest member of :ney of 14 children.Himself and |Mrs.Wm.Gryder of near Taylors- _.ville,and Mrs.Susan Murdock of York P Institute,sisters,who were among -guests,are the only survivors 4 .E.N.Crowder was there and, a talk suited to the occasion E made mention thet while it wee: Mr.Sharpe's 59th birthday it was 'veally his 60th birthday counting his |firstday ac one.This theoryhasbeer| advanced in other cases,but custom| has decreed ‘the foriser idea.AfterdinnerMr.Sharpe photographed the| Rev.J.R.Scropgs of Marion visit |ed his cousin,Mrs.Bettie Sharpe of |Phis place,a week ago and preached in the Methodist church on Sunday many friends were glad to greet’ m.Prof.Wm.Anderson of Alamanec county,who was principal of the; graded school here last session,has 'returned and will open school for the 'coming term September 3d.A heavy thunderstorm visited thissectionThursdayafternoonanda rain fell.During the storm tning struck a tree near the house of Mr.8.W.Honeycutt and two of his children were slightly burned by the |flash.Mrs.A.A.Somers nnd children left Saturday on a week's visit to her pa rents,Mr.and Mrs.R.M.Stikeleath ey,near Taylorsville,Mr.and Mrs W.¢.Beckham left Friday en a visit to relatives in Catawhe county and te take in the Ball's Creek campmeeting i |Meeting at [Ek Shoal —Other News. Gorrespondence of ‘The Landmark Stony Point,R-1,Aug.25...The farmers of this community wear smil- ing faces.A good vain this week changed considerably the looks of the corn and cotton. Miss Bethey Dagenhart spent a few days with relatives at Troutman.Mrs. L.C.Young is spending a few weeks with her daughter,Mrs.J.P.Miller,near Taylorsville. Mr.J.C.MeClain,Sr.,is conducting a singing school at Marvin this week,Rev.J.B.Pearson is holding a pro-tracted meeting at Elk Shoal.Graveyard cleaning at Marvin Fri-All persons interested areaskedtoattend.=A little son of Mr.Austin Dagen-hart,who has been seriously ill withcolitisforthepastthreeweeks,isimprovingslowly. A CARD OF THANKS. We,the colored teachers of Iredellcountyinstitute,desire to returnthankstoProf.C.W.Foushee andMissM.A.Charlton for their faith-ful service rendered us during theinstitute,and offer the following res- “Es:ed,first,that f theved,first,a copy © same be sent to The Landmark;sec-written in theeetheybe min- a COWAN, 8.COWAN, #2 CorrespondenceofTheLandmark. ‘|Salisbury.Mrs.®.F. ‘Brown motored to Statesville Statesville,R-5,Aug.27.—The a reek,which were married ursday evening ~~en route to north Iredell to visit o'clock relatives,: Mrs.P.R.Patterson and Miss terson,in Norfolk,Va.am Roscoe Hill of Porte | a.,aqgnting ys rents,Mr.and T.M.Hill.Mrs.Calvin Yr,Ga.,ing ten days with herniecew,Mrs.E.B.WattsandMr,W.M.Barringer.Mr.and Mrs.Eugene Davis of |Lynchburg,Va.,are the guests of Dr.and Mrs.J.F.Carlton.Mr.Daviswillbehereforaweek,while Mrs.Davis expects to spend a month here.Mrs.W.H.McElwee and children‘are in ing Reck to spend a fewdays.Mr.McElwee accompaniedthemtoBlowingRockandwentfromtheretoRaleich,where he is in busi- ness.:Miss Ruby Pedgett of Lincolnton istheguestofMissMaryNeilConner.Mrs.W.D.Clark and children arevisitingrelativesatOldFort.Mr.E.M.Land of Goldsboro ar-rived Saturday to join Mrs.Land atJudgeB.F.Long’s.Miss Julia Ellis,who was theguestofMissesMaryandIrisMe-Dougald,left Saturday for herhomeatNewBerne.Mr.Eugene Eagle left SaturdayforChapelHilltoresumehisstud-ies at the University,Miss Mamie McElwee returnedSaturdayfromMontreatandotherpointsinthemountains,where she spent the summer.Misses Lucile Fulp and Bessie An-derson left Saturday for a visit toPilotMountain,High Point and Northey.who visitedrelativeshere,left Saturday nightforGreenville,8.C.Mes.L.Ash has returned from avisittopointsinNewYorkand necticut.Mrs.C.W.Swink,Mrs.Ed.Moss,Mrs.Dolph Lentz and Mrs.Earlfrom Morganton and spent Friday with Mrs.J.L.Kimball.Mrs.J.L.Kim- ball left Saturday evening for a few days’visit to Salisbury. Mrs.J.C.French of New Orleans is here to spend several weeks with her son.Mr.G.E.French.Mrs.M.P.Alexander and Mrs.DF.Jenkins are visiting their sister, Mrs.PD.L.Love,at Sylva,Jackson county.Rev.and Mrs.A.W.White andMissLucileWhiteofJefferson,S.C., will be guests of Prof.and Mes.J.H.TiN this week.Miss White gocs from here to Toyahvale,Tex.,to take up juties as governess on a Texas ranch Miss Bernice Andrews of Florida i a guest at the home of Mr.and Mrs RU Gray in Shiloh township. Mrs.Floyd Lipnard and dauchter, Miriam Wyckoffe have gone to Char- lotte te be with Mer.Lippard. Master Jo.Wearn Woodward,whonenthisvacationwithhisaunt, Mrs.J.H.Wyckoff,returned Satur- day to his home in Charlotte. Miss Ruth Morrison left day morning for a week's Blowing Rock. Notices of New Advertisements Satur- visit to New fall arrivals at Ramsey- Rowles-Morrison Co,All kinds of trunks.—Crawford-Bunch Furniture Co. Chevrolet motor cars.—Univer- sal Auto Co.,Winston -Salem.Make thriftthantsandFarmers’Bank. Accurate time-pieces.—R.F.Hen- ry.Pure,delicious,refreshin Cola.-Coca-Cola Bottling Coca- 20. Music pupils wanted.—’Phone 354 green,Five-room bungalow ‘Phone 461 blue. for Men wanted for work in chair fac-|tory.--Forsyth Mfg.Co.,Winston- Salem.Young men wanted to learn mould-er’s trade.—Southern Desk Co.,Hick- ory.Clerk .wanted for soda fountain.—P.0.Box 849,Winston-Salem.Auto dimmers.—L.K.Overcash. Live stock,buggy-and wagon forNicholson,Sta‘sale.Walter tes-ville,R-1.Young shoats for sale.—R.H. Kennedy,Houstonville.a mules for sale-—J.M.Stike-ther,Loray.Two-horee farm wanted.—M,.care by ye 1 propertpersonalpro .Saturday,September 1.—Mrs.Delia ,Burke.Notice of dissolution of partner-&Scott.= |stances fashionable.—Mer- rent. lost.Reward for one and ' where they spent a short.going to Statesville.has been some censureyoungsterswhohavemonths,but in these two in-'‘the righteous criticshavetokeeptheirmouths Young Sherrill)enlisted for as soon as war was declared and is|to leave with his company for train-|ing in a day or so.is a ' at late it s /fact he didn’t marry to dodge mili-| jtary service.Likewise young Wag-' ner deferred his happy marriage to‘see if perchance his country needed|him in the first call.Inasmuch as)he wasn’t chosen to fill the ranks hegoesaheadandgetsmarried,andpreparingtocontributetothecoun-try’s needs by raising corn and cainandchickensandiallofwhichareneededinunlimitedquan-tities.The Lord speed ‘em on their way.A Mr.McLain of Statesville and aMr.Bumgarner of somewhere in thecountyhadahead-on collision in thevillageSaturdaynight.Mr.Bumgar-|ner carried a load of youngandwhenthecarscrashedMissDessieTroutmanwasseverelywoundedabouttheface.Other oc-cupants of the car were jolted con-soweey The report has it thatr.McLain earried no dimmers onhiscarandtheglarefromhislightsconfusedtheotherdriver.One car was demolished. The Rev.J.C.Keever began his annual meeting at the Methodistchurchlastnight.He is assisted byRev.J.W.illiams of Statesville. A most successful meeting is expect- ed. MRS.TEMPLETON DEAD. Victim of Tuberculosis —Mr. Johnson Hurt News. Sor.espondence of The Lanamart. Jennings,Aug.27 —Mrs.MollieTempleton,wife of J.Monroe Tem- pleton,diedat herhome near this place last een about 12 o’clock, of tuberculosis.She had been af- flicted with this disease for some time.Her remains were taken to Grassy Knob cemetery,Wednesday,where they were laid to rest.Rev.J. Enos Privette conducted the funeral services.Mrs.Templeton was around 40 years of age.She leaves a husband and three children,one girl and twoboys;also a brother,Mr.JonahRash.She was a member of Gras- sy Knob church and a woman of a good,quiet,harmless disposition.Itwashardforthishemetogiveupthiswifeandmother,almost in the prime of life.Our sympathy goes out to them in their dark hour oftrouble.It always seems sad to thiswriterwhenanyonediesoftuber- culosis,more so than of almost any other disease.Mr.Reuben Johnson,while sawing at his saw-mill a few days ago,in ome way let his hand come in con- act with the saw,which sawed off three fingers and nearly severed the fourth finger on his hand.Dr.Jur- ney carried him to a hospital,where ~~ his hand was dressed and he was,:Di _L.K.OVERCASH,Aug.28 -1t® vetting along all right when last ee Ee heard from.WANTED—Music pupils,Rates $1.50 per! month,‘Phone 344 Green Aug.28 St.\Mr.E.E.Robertson recently made .trip to Baltimore to buy goods for his store.Mrs.Lela Mullis and chile ;shor »visiting at —cuit S i ©ore E a a MEN WANTED—Want 35 good men to work —a jer 8,mt.:me rne}i maghine reom in chair factory.Apply Messrs.J.C.and Leonard Templeton at once and state wases required.Address have gone to Petersvurg,where they ‘ORSYTH MFG.CO.,PO.Box 1594,Win- will probably work on the soldiers’_stonGalem,N.Aug.28 camp there.—‘WANTED—Ambitious young men,mechanical- They have just closed a very "iy ladon’to learn the moulder’s trade. teresting meeting at Zion,A_pro-ee ~a odeseats ha gins tracted meeting began at Grassy (e™s8utineRN DESK CO.Hickory,N.C Knob Sunday.Aug,28 4t is right serious and critica -—. is 0 rig 7 WANTED—Young man for work at Sodatimeinthiscountrynow,as we are it warm,and war often means death toWewouldlike1numberofpeople. ‘o see the people taxe a great inter- est in the meetings this fall make that of all preparations fo war,and that is to be prepared t: lie when the:summons comes.We oucht to do this when there isn war,and we certainly ought to when It doesn't @o any good to erieve or trouble over the war and 8 there is. other tribulations.This writer vriving against that,but it will dc rood to make that greatest of a! preparations,as we have just said. Mountain Trip —Death — Good Seasons and Good Crops Correspondence of The Landmark. Statesville,R-6andMrs.H.L.Gilbert,Mr.R. R.L.BradfordLittle,Mrs,and Mrs.Kesterdater,Rev. and other points in the mountains. J.A.Hall died at Mr.Lee Brad is loses the $6. ‘and the title is Other and Aug.24 —- Little and family,Dr.and Mrs.E.rE a =Carolina,have returned from an automobile trip to Blowing Rock ted by a reputable surveyor.the lawyers must abstract thetitlehereandsendittoColumbiaforapproval.The expenses of thisabstractingisbaseaontheamountoftheloanandvariesfrom$12.50 for each $100 that ne borrows.stock is retired when the loanpaid,as no one can borrow qnsepsstockholderandnoonecanstockholderexceptaborrower.In making an application,if theappreisersdonotrecommendtheloan,or if it is turned down by theBankatColumbia,the borrowerThisishisonlylossthen.But if the loan is a vedandtheattorneysabstractthetitle,‘ound to be not good,then he will also lose the fee for ab- stracting.If a man wishes money for the|purposes allowed by the bank,viz.: isaa THE FIRST NATIONAL BANK, y THE cs ij ey ya My aN v7 TS ig "ALL HE CAN1SPAREINTHE 4 BY¢.etrare’~Rel: BANK FOR THAT=~«RAINY DAY.y‘‘fdDe RORY @ o” ay The NET RESULT of a year's work is what counts. If one man earns $10,000 a year and spends it all,he does not really make as much as the man who earns $6,000 and hos $2,000 in our bank at the end of the year.i Put your money in our bank and let it STAY there:this is the one SURE way to get chead.es baer Make OUR bank YOUR bank We pay 4 per cent interest on time deposits. Statesville,N.C. To buy a farm,to liquidate indebt-—edness or to improve his farm,there |jis no doubt about his getting themoneyifhistitleisgoodandhedoes;not want to borrow too much on thevace.The limit of a loan to one,‘man is $10,000,Yours trulv.W.L.GILBERT,Sec'y and Treas. To Cure e Cold in One Day.' pAxats BROMO b meee wists ref aran to cure. MAR The following prices Ay0}produce on the local market;{ ring Chickens,18e.per bb, *,tbe.per tb.ws,Jée.per dozen.Roosterg,Je.to Be.per Ib.Tub Butter,26c.per Ib,Dairy Butter,30¢.per Ib.Beeswax,30c.per Ib._—Hides,18¢.per Ib.ams,28c..to $0c.per Ib. Bides,2ic.to 28e.per Ib.Shoulders,26¢.to 28e.per tb. |New Red Honey (strained),16-1%e.per Ib. }New Red Honey Com,te.to 20¢,per Ib. wood Honey Comb,22c,to 26¢.per Ib. |By Honey,22c.per tb.{ Auto Rubber Casing,4c.pcr tbPotatoes(new)$1.50 per bushel,Grain.following were paid yesterday,for on the market:it,$2.25 per bushel. Corn,£1.90 per bushetCats,The.per bushel. On the loca!market yesterday 24 cents per pound was paid for best grade cotton.firm.| 25 ER.BAG SUGAR fer $2.45 at D.J.KIM-BALLS.Aug.28.| WANTED —Twe messenger boys with wheels. ERN UNION TELEGRAPH CO Aug.28. SS P-U-R-|-T-Y Of the ingredients used in its manufacture—-PLUS — its DELICIOUS and REFRESHING qualities EQUALS In bottles.. MILLIONS drink it DAILY.WHY drink an IMITA- TION,when MILLIONS testify WHICH IS BEST? BOTTLING: COMPANY. reer To getthe TRUE meaning of SANITATIONLOOKUS OVER. Le popes of heya.Reward for return to THe ANDMARK Aug,28 --1t° WANTED—To rent a two-horse farm.Write M.,care The Landmark Aug.28 It’. ror SALE—Three mules from two to twelve years old.Cash er on time.J.M STIKE- LEATHER,Loray,N.¢Aug.28 -It. FoR ALE—Fifteen threc-months old shoats, R,.KENNEDY,Housionviile,N.C. Aug.24 2 FOR SALE—Mare and mule colt;wagon and hummy,cheap WALTER NICHOLSON, Statesville,R-i Aug.26 2t i AUTO DIMMERS—Sec me for automobile FOR RENT—Five-room bungalow.Lights and water.“Phone 461 Blue Aug.28 1t® Apply with ref- Winston-Salem,N Aug.28 2t Vountain and Cigar Stand O.Box #49erencetoP FOR RENT—S-reom house on ‘north Center treet,Large lot i.¢LEWIS Phone 179 Green.Auw.24 ’WANTED—Old faise teeth;don't matter if broken.1 pay $2 to 815 per set.Send by ,parcel t and receice check by return mall..RRL.405 N.Wolfe St,Balti- more,Md.Aug,24 Mt WANTED—Girls to wait in dining room at Hotel Iredell.Apply to MRS.JNO.H»GRAY,.Aug 21. 1 wa colored men,preferably mar- ried,to work in aluminum plant §hours per day,7 days per week.Wages for steady work $14 per week to start Increnses xranted after one,three and six months of service,Fine new houses with water,toil-| .ete and electric licht.Cheap rent.Steady work inside all year round.Apply Employ- By Burean TALLASSEE POWER COM- PANY,»CG Aug.21-3 Ww our new mill cool, care every five minutes Close @t 12 o'clock Saturdays.Good wages “wrtalil ies knitters,loopers.Cam niso une t women to learn.Most attract- Snow ©.,\ford’s yesterday and was buriedat |; closed Friday —>oran ive eltyim the South.Forty thousand troops Jordan Ruther ngine le—T.J.Mt,Hermon today.”“toned .of 1@ ;7”i .Several cases of ¢fever in vo A Tr NUNTTTING COMPA. ‘ee ibe.sugar $2.45.—D.J.Kim-)the community.Johnson,+Charlotte,Aug.7 -@. *|bell.cee _\whohas beenvery sick,is reported “rete ab eae ome better.wish toToServeCreamatLoray.—If i eck”Ge betters Se 'aystem to be found anywhere igang‘utc cuee"aed ttn the mon \in you what we thinkWevery Our Clocks Will Get The Children To .onEF:(2 Whether you drive your owncar or employ a chaffeur the convenienceof a car cannot well be estimated.To the theatre, to a friends’,on a business call, anywhere and everywhere you want to go the carwilltakeyou—" directly and with ease. Nowdays The Car Is The Thing and Here Is The Place To Buy It.. vill SchoolOnTime. Along with the other good lessons your children are taught at school you teach them right in the home to be PROMPT.It pays in life to be PROMPT. Accuracy is the thing we demand in every time-plece we sell—from a kitchen clock to —gold watch. Do you need a kitchen clock Don't you want a mantel clock? Whieh one of your farnily desires a Ask yourboy.R.F.HENRY,Jeweler... new wateh?we = —- : << . es e r e au - uu m ~- one. ee me ment. ~@4 in the extreme west,or mountain obligating[to probably”150 more as soonxsthenew-dollar ritionhasbeenobtained.(gcoat of this construction will be be-tween $300,000,000 and $400,000,000‘After this tonnage is built only the tion of more money will be; to continue to turn out fabri- ‘cated vessels.The government's My p mme calls for a total of 1,27shipsof7,968,000 tonnage.This isjjinadditiontonearly2,000,000 tonsiofshippingnowbuildinginAmeri- sean yards,which has been comman- deered by the Emergency Fleet Cor-poration.A large rt of the gov-(une fleet and of the comman-wered fleet will have been complet-ed by the end of the fiscal year,(June 30,1918.Building,comman- deering and purchases of vessels wi!l total about $2,000,000,000, Kerensky Promises Blood:Iron. Rucsia is passing through a perioc of mortal danger,Premier Kerensk) told the national conference which ha:assembled in Moscow,Russia,to considerthepresentsituationofthecoun tery and plans for a new national government.Me declared that any at tempt to take advantayre of the confer ‘ence for an attack on the nationa j Power,as embodied in the provisiona jicesly “by |would be repressed piti' shipbuilding and essly “by blood and iron.”Notwithstanding the one day strik: ‘proclaimed by the Bolsheviki in pro fest against the council as a counteslevolutionaryexpedition,the city i: jet.A few incipient attempts ty é Belsheviki street corner orators torganizedemonstrationsweresumma ssed by the crowds and no serious incident occurred.The gran opera house,in which the council i: meeting,is surrounded by a clos chain of soldiers,with officers ever: few yards,the soldiers being picke: men from regiments of the signacorps,or cadets training for officersThechambersunderthebuilding: are occupied by soldiers with fixerbayonets.Members and _—invite: guests before being admitted havetheirticketsexaminedbyninedifferentmilitaryposts. |eenmenenelMoreDemonstrationAgents. Raleigh News and Observer. The division of the State into fivedistrictsfordemonstrationpurposes instead of three as at present,is theplanoftheAgriculturalExtensionService,under Dr.B.W.Kilgore. for promoting the efficiency of this department of agriculture develop-According to the present ¢,a new district will be creat- section,and one in the eastern sec-tion,very likely in the northeast.The district demonstration agents at present serving will continue intheircapacities—Mr.FE.8.Millsaps Statesville,in the western district;Mr.T.W.McLean,Aberdeen, cen-tral district;Mr.R.W.Freeman.Wilson,eastern district.Mr.J.M.Gray,county agent of Gaston county,has alreacy teen ap- pointed district agent for the newly- created mountain district.The fifth district agent is yet to be appointed EE Anti Draft Meeting ai Lincolnton. An anti-draft meeting was held i:the court house in Lincolnton Satur day.The leader was C.L.Eaker,:school teacher of Nor:h Brook tow:ship,Lincoln county.About 400 per sons were present,but a majority wor net in sympathy with the meetinyThreespeakersaddressedthemeeting urging support of the government| but the anti-drafters sugyvested tha the speakers voluntce Eaker said the object of the meetingwastosecuresignerstopetitioraskingCongresstopasstheHardwiclbillpendinginCongeess.The Hiard wick bill really re-enacts the voluntec System,at least for foreign service allowing the men drafted the privi Jege of refusing to serve in a foreigy land.Qnly 133 cigned the Petition | OSCEES©Hansosrome To Long Island For Training. Preparations have been made at Camp Sevier (Greenville,S.C.)fo thé entrainment of the South Carolin:| battalion of engineers,117th division | who will probably leave today fom Mineola,Long Island,where they wil’whdergo a few months training prioi }days in Berlin on his way ap her workinthehighschool.Mr.and Mrs,W.B.Crawferd and children and MissNoraVickeryofStatesvillespentSaturdaywithMrs.Crawford'saunt,Mrs.Sara Feimster.Mr,Lard-ner Moore and Master Wallace Moore have returned from a visit to |Rev.W.B.Meflwaine,missionaryteJapan,who is now at Heat! Springs.Rev.S.W.Moore,pastor7thePresbyterianchurchatBlue- field,Va.,who has been attending a Y.M.C.A.conference at BlueRidge,is exepected tonight to spend1fewdayswithhisfather,Mr.J. W.Moore. Dr.John C.Jolly,who lived about31-2 miles south of town,died Sun- day morning,after a long illness.Hessurvivedbyhiswidow,a daugh- ter,Mrs.Richard Carrigan,and a son,Mr.Sippie Jolly.e was 72 years of age.The funeral and burial services will be conducted at Friend- ship Lutheran church today at 11o'clock.Master Wilson Moore has returned ‘rom a week's stay with his grand-‘father,Capt.R.A.Torrence,in Char-otte.Messrs.H.P.Feimster and W. 1.Matheson of Mooresville,are spending today with relatives here.Lieut.H.G.Baity spent Sunday withfriendshere.He soes to Columbia, 3.C.,tomorrow. MURDER AND ROBBERY. Double Crime in Salisbury— Negro Victim of One of His Race. Abel Harris,a negro watchman at the car barn of the North Carolins Public Service Company in SalisburywasmurderedFridaymght.The safe in the barn was breken open and its contents,about $75 in cash stolen The crime was discovered early Sat urday morning.The indications were hat there had been a terrible strug ale.Harris’head was badly beatenHarriswassubbingfortheregular watchman,Baxter Cain,colored.Cair ‘s under arrest,charged with the ‘rime.It is believed that he ==got Harris to sub for bim and planned tc ob the safe while Harris was ot luty.Strong circumstantial evidenc« voint to Cain's gyilt.It is known that he was trying to raise $50 to pry fo:ork Jeg.He tried to yet a small gro man to work for him Friday ight and failing in this he secured Mairis.At 11 o'clock Saturday he paid the $50 and secured his artifi ‘ial limb.Officers later saw the noney he handled in this transactio: ind it,consisted of one dollar.bills andsalvesandquarters.One of the bills was identified by a conductor as a billhedepositedFridayinthesafethat vas robbed Saturday morning.After ‘ain's arrest a cloth containing $27..0 n nickels,dimes and pennies was found hid away in hay in the loft of his barn.These two amounts wer oractically what the cas compa:|st The transfers and tickess nnd venort f the conductors for Friday’<worl vere found hidden in the bank of a small branch that runs back of Cain's varn,and the negro’s mule was track ed to the spot where these thing were found. Austria Wants to Quit. An Austria which is literally cry- ng for peace,which has’discarded ny thought of territorial expansion, and is even willing to buy its way out of the war by (erriterial sacrifices or he Italian front and in Galicia;ar Austria of frequent food riots,una le to last through another winter of War;an Austria population would rise in if any rea sonable peace offer were rejected by he government,is pictured by ar intelligent:Austrian who has ar:ived it Copenhayen from Vienna.accord whose revolution ing to Associated Press correspond mee.In a long talk with the corres- pondent he told a story which though perhaps unduly pessimistie,explains the persistence of Count |Czernin Austro-Hungarian foreien minister wind of Emperor Charles im returnit again and ayain to the ibject af peace nevotiatior This Austrian,who spent haven,had an opportunity to Vk with representatives of the Germar foreign office,including Baron vor Dem Bussche-Haddenhausen,the jer secretary,and other Germans of the stamp of Prof Hans Delbrueck of the University Berlin;Phillip Scheidemann,the «o prominent 80 to embarkation for Frence with thfirstcontingencyofNationalGuare|engineers,who were ordered for over |sea duty several weeks avo.The bat |talion is composed of about 125 Nort)|Carolinians and 100 Tennesseans,whewererecentlydraftedintotherank:|of the various companies stationed at |Sevier for the purpose of recruiting ! to war Strength.it A TE ! Saving on Sugar. An agreement by the country'sbeetsugarproducerstolimitthepriceoftheirproductsoextoeffectnfonofabout11-2 cents athepresentpriceofsugar,by the food administra-tion,with a notice to the public thatthisshouldmeanasavingof£30...000,000 between now and the first of year.It is also announced thattvwholesalershad'agreed to charges to pre- tialist leader,and Maximillian Ha den,editor of the Zukunft.He avicthatallofthesemenwiththeexcep tion of Herr Harden,were convinces peace was coming before winter SEeemeeworneem Will Mark the Graves. American soldiers who give theirlivestothecauseinwhichthena-on has enlisted will not lie forgot-ten on foreign soil if the careful'preparations of the general staff can |prevent it.Relatives of the men"ho go to the front in France mayrestassuredthateveryeffortwillbemadetolocateandregisterthe graves of the men killed in action orwhodieofdisease. Army officers have directed that a registration service,quarter-master’s corps,be organized for the‘uration of the war.The first unit.vill be commanded by a captain,vided by a second liewtenant,and will include 49 enlisted men of dif- ferent grades.The duties of theeerviceatenotheea4thename,which rave i ‘wdoubled.The Campana |The lowa Post,a €|A|newspaper oeat ds |‘—_la.,has suspen Pr The |+h paper has been intensely an |aves Lileorty |witlatteandwithdrawalofsubyloca!|Our Amevicans! Germans is given oe the for|Mey the Spirit of the Lordthesuspension.ory G iz,ite|Dwell tm game Senete, editor,has been before the Pedera'|The ca ionauthoritiestwice.“t nertp 2clear theroad. The name of East Germantown,“lor the weaknearRichmond,Ind.,has been ng-Liberty to a blessing.seer ed to Pershing.Official Y was|For the worldtakenontheapplicationofS-|wie aeterFrankGipe,because nts |And you dail be rbjeeted to the Ge and,Free,indeed!«wanted to henor Gen..The lree to obey your eaptain's least command; town was settled 100 years agoPennsylvaniaDutch.by Privates Nelson and James Kelley ....,of Battery A,Second Missouri Fie!Artillery,were killed and four others seriously injured when a shrapnel!shell exploded on the cantenmeritrangeatFortSill,Okla.,complete!swreckingthemesshallinwhiehtheywerepreparingtheirfirstmealafterirrivingattheOklahomapost. Joun Francis Beckwith,poet,au- ther and soldier,arrested at Cle. land,O.,pn a charge of usi the mails to defracd,told Federal offi- ‘ers he made love to scores of wo-en throughout the country in or-lor to wet funds to keep “the one wo-van”in luxury in a home in the Ad- rondacks,near Albany,N.‘Y An incipient riot between a numb of negroes and members of the ThirdandSixthregiments,Pennsylvi ia National Guard,occurred in Philadelphia section,resultine in th.arrest of fitteen whic ond negeo mer Four negroes,who were more ser ously beaten in the fight,in)whi 200 participated,were taken to a hy pital Breaking her silence as to women picketing the White Heuse about the whole subject of wemen-ffrage,Dr.Anna Howard Shas. the foremost woman suffrage lead-‘rand chairman of the woman'scommitteeoftheCouncilofNation-tl Defence,severely condemns pick- eting in an article which has been made public. The torpedoing of the British stenm er Trelisick,loaded with 350,000 bu:h els of oats for the French governmentwnsreportedbytheofficersofaBrit ish steamer arriving at an Atlantic port.The crew of the Tretisuck,te gether with the crew of another tor- pedoed steamer which they had picked up a few hours hefore thev themselves were attacked.were by American warship. rescced The Senate military affairs commit- tes has decided not to hold public hear- ings,requested by Senator HardwickofGeorgia,on his bill to prohibit the sending of American soldiers abroad witheut their consent.Tire decided it would herr Senator Hardwick alone for an hour this week but refused to hear a delegation from orgia that Senator Hardw sived io have appear. tee West, and; ar cammit-| de-| Pree to serve and never swerve from a duty :Free to speed to do a brave deed;ree to spend your lives for a friendOurAmericans! »low!huerwhs for you our welkin ringsOurAmericans!|tiod keep you ‘neath the shadow of His wings,| Gur Americans!—M.H.E.-YEWsINCONDENSED FORM (tems of Interest GatheredFromOvertheState. vames Wrenn,a 10-year-old boy,was drowned while bathing in Bear reek,near LaGrange. J.M.Williams of Chapel Hill,raveling salesman,dead.Auto and rain collided at railway crossing. Eli Chappell,a negro living in John-|sion county,committed suicide by shooting.Had been drawn in the military draft is the only reason as- signed. dames O.Johnson of Charlotte was ‘atally injured Sunday when a motor- vee he was riding crashed into an ron bridge in the vicinity of Char- ‘tte.He died three hours later The Rowan county Sunday school mnvention,which was to have beenneldatClevelandSeptember5and ».has been postponed to September12and18. The Waynesville Courier was solérecentlyandMr.J.D.Boone,editor of the Mountaineer of Waynesville,bought the Courier and consolidated|‘with his paper. Major Geo.L.Vederal disbursing officer for theStatetroops,has been assigned to duty in the quartermaster’s depart- aent,Greenville,8.C. Mr.H.C.Griffin of east Monroe ;township has a half-gallon glass jarfilledwithpearsavhichhasbeenkept‘or 24 years.The pears are fine as they were when first put up,except |that they are a little darker. Near Albemarle Henry Smither- |man,driving a Hudson Super-Six, jran headlong into a heavy motor jtruck driven by Ernest Skidmore Both truck and car were smashed,|Skidmore bruiced and Smithermanjbadlyifnotfatallyinjured. John Coffey,who some months‘ago killed Albert Kirby,in Caldwell ,county,was convicted of first degreemurderinCaldwellSuperiorCourt and sentenced to die December 28. |Will probably not be executed,as the The final agreement in the wage}judge and others did not expect a controversy between shop employes)verdict of first degree murder. ind the southeastern railr has}General Julian S.Carr hes offeredheensignedonabasisofanincrease!two prizes of 874 cach for the bestmnpayforthe26,000 men,which the rnilond'’s estimate will total &s.000,- 0a vear.The settlement of the dis pate was affected by Secretury of La- bor Wilson aftcr four month.efforts by representatives of the cimployesandroadshadprovedfutile, Warning against a German propa-| ganda seeking to stir up insu imong Ameriean negroes is piven in a statement issued by the Patriotic Education Society.Anonymou.pos- tal cards and letters urging roes to rise against the whites and p-omis-ing there will be rection no color tine when!ten lav loock's brother-in-law,Ed.Germany rules,the statem “ays |Lester,believed to have been a partyhavebeenbroughttethesn.vu of!to the crime,was held without bail.—the officials of the societs |‘pro News Sas reached Wilson that Da-leaders,vid Turner and Raney Wilkerson,pri-Shippers are co-operating well vate colds in Company K.Northwiththerailroadsintheireffortsto!Carolinn National Guard,who severalfurtherfreightmovementthroughdaysavewerearrestedatWilsonandefficientearloadingthatthepaeetakenbacktoCharlotte,were,courtavedinJulyaloneamount:vit-!martialed and fined $107.50 each andtually120,000 cars,according to a!gentenced to serve in the eomp guardatementissuedbyFairfaxHarrie)house for a period ef nine months on,chairman of the railre:,war There were two grave chacves againstpearTheaewaseheetive|the young men-going to sleep whileinapartsofthecountryM-on sentry duty and cutting their waycludedeverycommodity,—1 coal from the vuard j hil ppyineandirent®food,|St te;sentence and liberating 14 other pris- Barium Items.ones: canondene@ of The UCnndmece \Birthday Dinner.Barium,Aug.27 Mr !FF.Jerrespondence of The Landmark Smith of Columbia,8.(oth-The relatives and friends of Mr.er and sister,Mr.Tay Gr and:and Mrs.8S.RR.Jurney enjoyed aMrs.J.8.Drake and children of Co-)rare treat Thursday,28d,at theirlumbia,are spending a wei the home near Olin,on which date Mrs.Lodge.Jurney gave a birthday dinner,—in-_Miss Lelia Edwards of Mars Hi)viting their near relatives,and theisspendingaifewweek.ut the public in the afternoon,from 2 to 5,spring,after which she expect to to a msuical in which her music pu-enter college at Raleigh.Mrs |fat-|pils partic ipated.tie Kornegie of Goldsboro \.\\.:tingy One of the principal features ofherson,Edward,at the orphanage.the dinner was the white birthday ed soMrs.J.C.Moore of Stonyvisitinghersister,Mrs.W.P.Cavin.|(47)on top,and other decorations ofMrs.8.A.Grier is visiting f; Lenoir. Food Scarce in Germany. The people of Germany are wn-yuestionably facing a serious <hert-age of necessary food and the maxi- iends in mum efforts of authorities now arerequiredtomakewhatsupplies:¢have go around,according to warBartholomew,former representativeofan‘an oi]company at Ham-burg,has arrived at an Atport.Mr.Barthowomew [4ftyJulJS ity. 1 and =several . was kept i mallvicinityotHamburg,Me dimen,ttlpoteatSeas essay written by North Crrolina teachersonthesubject“Why the Unitea States is at War.”One price is to be awarded for the best essay by a high |school teacher,a second of the same amount for the best essay by en ele mentary teacher.Ro ob.W.Conner Raleigh,can furnish informetion. George Grissom,white,aged 24, was shot and killed by Vernon Hock,a white man of about 30 years.in a jeard room of the Herriet Mills at|Henderson.Hock mrde no attempt to escape.His defence is the unwrit- Point is,eeke,with the number of her years there can be no foreign sabstance in pink.The cake was embedded in a=e of white and pink roses andbudswithfoliage,and was onatallenkestandintheofthetable,which was loaded withthings.The home was ee dec-|orated with asparagus fern,potted|plants and cut flowers.Mrs.Jurney received a number oforetiyandusefulentseemedtohaveatimeandwishfortheirhappyreturnsoftheLB Chennte Constipation }fle ty ne geen an be many Peterson,formerly Merchants and Farmers’Bank.| OfStatesville,N.C.| “The BankForYourSavings.” R ’The Harris coulfty grand jury at |Houston,Texas,has returned blanket indictments for murder against 40 negro soldiers alleged to have par- ticipated in the riots at Houston |Thursday night,in which 17 persons jwere killed and 21 wow ;The negroes have taken inchargebythemilitaryauthoritiesandlarenowatColumbus,N.M.It isintimatedthattheymaybetriedby court martial. The civil authorities resent the ac-Lion of the military in taking chargeofthesoldiers.ey want to try,them in the State court at Houston‘or murder.The final disposition of|‘he matter will be determined whenitheboardofinquiryre) THE BOY AND THE Tn A Salisbury item says:“RobertMcLean,a 13-year-old boy of Moores-|ville,was arrested Saturday for driv-ling an automobile,his youth beingagainsthim.The arrest followed an secident nt the corner of Main and‘ouncil streots,when young MeLean’s‘ar knocke!a white man,Charles frexler,down,bruisme him,The hov's father,J.C.McLean of Moores- ville,was a passenger in the car atyi re time The disposition of the case is not ated. What Better PurchaseFor $1 Than Good Health? 3 POWERFUL FORCES IN 1 Nux-Iron Paw-Paw,the New_Remedy Known as Iron- ized Paw-Paw. Read Mrs.Moore’s Testimony. Mrs.S.I..Moore,living et 412 County ‘street,Portemouth,Va., “T suffered from Nervous In-|Says: digestion and Sleeplessner:s that I had almost given up hope in jthe efficacy of medicines.1 had l shortness of breath at times,alniost )smothering,affected with|headaches,appetite and |had heare muchjstroneth,1 about Tronized Paw -Paw |T want- ed to try its merits.I bought a bot- tle at)Trant's |Monroe Pharmacy, and after using bettle,to omy lgreat joy my headach:.nervousness and indigestion absoluccdy disap peored,My appetite is go am igaining weight and can eat almet janything without ill effects.1 fidently recommend —Lronized 'Paw to any sufferer,96 it whet it is recommended to do. worth ten times its price. be without a bettle naw.” Now is the time to berin taking a Tonic —tone up vour ystem =and prevent vour vital organs from.be- roming disordered or bacly affected.Your drucgist:probably keeps but if he doesn't,it sold by the Polk Gray Drug Co Ironived Paw -Paw,price $1.For- }mula on.every bottle.Mail orders prompily attended —so.Interstate Drug Co.Inc.,New York. N INTERESTING PROCESS Did you ever think of the laber jthat is necessary to be certain that the bottles we use for our drinks areabsolutelysafe,sanitary and clean? The first operation is to place the ‘bottle in’the Soaker,which’tleansandsterilizesitwithacidfor10minutes,then the’bottle is brushedthoroughlyinside,it is then placedjonaconveyorthatautomaticallyrinsesthebottletwicemoreinsideandoutside,with absolutely clean,fresh water,and then,and not untilthen,is the bottle ready for use,After all this rinsing,brushinganding,every bottle is inspect-|t we are absolutely certain so much constantly loss oO one con Paw- will co It is I wouldn't A the bottle.|In other words,the bottled drink|is as clean,pure and wholesome asispossibletobemade.You couldnotbemoreparticutartmyourown MAYR’S:Wonderful Remedy One DoseConvinces Statesville Drug Co. and other reliable druggists, % Your Crops Are the best they havebeenforyears.Alsoices.Give the wife aPomptolelpherwithherwork, Myers Pump and repairsfor‘all makes. W.E.MUNDAY. Your Plumber,114 B.Bread &t. Phone 55. DR.J.M.HOLLAND. DENTIST. OFFICE MILLS BUILDING. Over Mrs.Sims’Millinery Store, Statesville,N.C.GOURS 8&to6.‘PRONE‘ti. You msure your house against fire. Why ret insure it against deeay with FOR SALE BY Lazenby-Montgomery Hardware Co, Statesville,W.C. r 1 ’'g%WOOD SAWING Am ready to saw yourwood.Please see me or‘phone me—421_Black.T.G.WOOTEN. eNOTICE! Commencing teday we will diseon-cinne the Jitney Service in the usualwayandestablishScheduleson_thedifferentprominentstreets.Firsttobeoperatedwillbealinefrom Rloomfield (at Ww Sumpter’s Store)via Front Street to Square and Southern Depot.This car willruneverySOminutes—on the evenandhalfhour,Others will be put onlater.No Schedule on Sunday.RIDE THE JITNEY. JITNEY TRANSFER CO. Statesville,N.C._ PUBLIC SALE OF VALUABLE FARM AND DESIRABLE RES- IDENCE PROPERTY. Ry virtue of the power contained in the last will and testament of D.M.Howard, | late of Iredell county,N.C.,the undersigned will « TURDAY,SEUTEMBER 22.1917,ex to public sale to the bishest bidder forcash,the following deseribed real estate,to-- witThe farm and home place of the said D.M. Howard,decensed,situate on the Lewis Ferryroadthreemileswest6fStatesville,Baldfarmcontains88acres,more or less,about 50acresofwhichisnowinfinestateofeulti-vation.About &neres of which ts fine bet.tom land,dredged,lying on waters of Thirdcreck.There is on thie farm a nice new 7-room cdttige residence;a goed tenant houxeandoutbuildings,and aly abundance of @ood,beth onk and pine,for all domestic purposes The public rood,sand-clayed,runsthroughthisfarmandthe«ame will be intwotractsandthensold«\The undbrsigned will be iad at any time tohowthelandteanyonewhebe-ested in the same JOWN M.iowaanZeb.V.Lone,Atty.Executor. Aug.21 Sw, Come around to our plant and letusshowyouthediferentprocesses!and youwill then a jate the|care with which our drinks are bot-|presents.All pres-tied.It will be a pleasure to show “"ATR Mint ColaCenterSt.Co.|No&?.| ‘you.F me ty |623,N.| Application For Pardon. _NORTH CAROLINA,IREDELL Me ghfpotermofthe= ae aE ar “i = eS Se r r a Sa i , Tr s a e a e n ™ : -r r a r e e e S SuperiorOfficers will be in chargeof the training. Theadvantageswillbe great for thedevelopment of aricher womanhood.Failure to enlist will be a reproach. Bear in mind the date of enrollment,September 5,and the place. Mitchell “3 Your H Are not tied from carrying out your ex- pectations and desires when you have IN THE BANK. Your Bank Account depends on whatyousave,, It is not a matter OF GOOD FORTUNE. Acquire the saving habit while your in- come is smal]and it will be casier as your income increases to Increase Your Bank Account. Now is the opportune time to open an Account with us. “MONEY MAKES THE WAY EASY.” GEO.H.BROWN :O.L.TURNER FOR SALE 206 acres,level,productive,red land farm,fronting quarter mile on the most traveled,psllic,sand-clay road leading into States- ville;nice twe-etory,frame seven-room dwelling,located in a beautiful grove;barn and out-buildings,fine well water,two branches;abundance of fruit;quarter of mile from school and churches;80 arres in cultivation,30 acres in meadow,balance in woodland,part of which is inclosed in pasture.An exceptional opportunity to buy a fine grain and stock farm.Will take in part payment,small farm if well located. ERNEST G.GAITHER. Insurance,Stocks and Real Estate. Phone 23. College. ands People’s Loan and Savings Bank. Satesville,N.C. Ce yond "—_—~—Tom BI t;aa a |Out’!!|“The handling of these aliens is! l regarded by the United States gov-| ernment as 2 somewhat matter.It wishes to treat them con- ruption that the visitors.It has been psoldiersbeinstalledas guards,but| this is regarded as unnecessary and) exnensive.4 system,’practically. und unobtrusive. force them. “But,on the other -hand.the au- mies in luxerious idleness end thev are irritated at reports which place them in this attitude be-,‘These men do not}said an @farethepeople.live like princes,’ |t»house 300 and made to hold 600. ed in the halls.It is noz rrue that the, eovernment allows $1 a day for their food and they provide their own commissariat.’“The government provides all the A food.’continued the sneakers,*f B of the kind these men have been ac- eystomed to,and it is cooked by Ger- A man chefs.As these chefs are ex- semis,former cooks of big liners, naturally the meals are appetizing.| i The food cost to the government i+ not over 50 cents a day per man.As for the ‘luxuries’we furnish see for yourself. “A ‘Verboten’sign was on the door of the spotless kitchen where a ponderous chef with bushy whiskers looked like Admiral Yon Tirpitz in a cook’s cap.On the range was an enormous pan of cabbage,in a emailer receptacle were turnips,in nether potatoes.There was a pan of roast beef,two kettles of soup, and on a steamer a pan of beans. Thev like stews and soups,’said the lofficial.All the bread is rye.The dining room was no less clean.The \iebles were plain boards and sta- tionary.The crockery was plain and verv thick.Distinctions he- tween officers and men are observed‘ere,the ordinary seamen and wait- vs eating first.“Before the Germans can be put o work there must first be work for them to do,and at present there ‘ not enough work to ‘go round.’Thev ‘van be put to work,said an offcial. ind it is hoped to have many of ithem emploved on the highway toTernesseewhenworkonitstarts. “The Hague convention provices for working enemies,’said an cial,‘But not on military works.A< a matter of fact the convention is ‘net binding on this country but the department observes it.However, that is aside from our problem,as we have no military works here.” “The location of the etation in the Davidson river section of Pisgah National Forest was urged hecause the Germans could be used in build- jing roads there.The site was con- sidered.but inaccessibility.the im- nossibility of erecting buildings at ==once,the need for water and sewer systems overcame the advantages, and the hotel property was leased for 1 year.with the privilege of a year's renewal,at $18,000 a vear.It had accessible. “To house the expected thousand plicates of army cantonments,are ing room and bath houses.Eachbarrackis20x163feetinsize.up- ‘and-down board sides,double-floor- ed,with composition roof and bunks ‘alone the walle.mess hall will be 44x176 feet,the kitchen in the middle.The barrack 14x50 feet,equipped 8. “The station hospital is located in Carolina lan-|now abouto:tn ¢captain has amaetoteecle&i,is cultivating beans and corn,and Jimpson weeddelicate!taking advantage of the poor manbeliefthatitissomestrangeAmer- eiderately,but avoid ‘spoiling’them.|ican vegetable whieh has sprung up ond it is for fear of possible inter-was half-crown beforeI noticed it, Americans may be stinted for food,4 pag Back is Generally Worse in buildings,water and sewer,and is iwho are coming seven barracks,du-|| building,besides a kitchen and din-; bath house will| be behind its ecantonment,its size | *that which | ja bed.ten forlotthis a-bedlouinatePhyductedwas es ie case of See in meni month,it is learned from other lean ports by the beginning of sources.war in 1914.Then inv signa},“Some of the aliens work in theWel,3 T-acre ve bie garden,where a|‘Welcome’;now a four ketaliing,topped fine crop of food is growing.Others beyAe ks ¥‘the m.|have their own tches,mark- erty and ispatrolled y _ihant-iad =wsbender of white stoneswhere men ichmen.’These visible,ani-|@r.Cultivating the lana i‘signs’mean ‘Werboten’to|the German taste,but not all of the those inside,and the translation in hotel guests know ah there is to.One shippatchinwhic? and thrivinghisimpudently 8 ikewise one thing ‘keep the station closec anceliminate |the heart to tell the captain it is a that ¥«oa.” Summer Complaint. During the hot weather of the summer ,|months sone member of almost every family“The aliens are now_on the ‘honor je likely to be troubled with an wnnaturst Rules are few |loogenens of the bowels,a it is _the erent- Tie Germans have |6st importance that this treat promptly..whigh can only be done when the medicine isasystemofregulaticnrfortheiriotahurd.Mes.PF.F,Scott,Seottaville,own guidance and committees to eN-|N.Y.,states,For example,the reg-|Colic and Diarrhoea Remedy as much as five“1 first used Chamberlain's A that time 1 had a severe at-;.|pores ago..lation against smoking in the write |eek of semmer comulaint and was sufferingingroomistheirrule{Intense pain. soembers of my family have since used it with thorities do not wish to be in theat-|lke rrentts” titude of keeping these public ene-—— One dose relieved me.Other LAME EVERY MORNING!_ the Morning —Statesville PeopleAreFindingRelief. A back that aches all day and ‘They are quartered in a hotel meant causes discomfort at night is usual- ly worse in the morning.Makes youTheyaredoubledinroomsorbunk-geo)as if you hadn't slept at all. You can’t get rid of kidney back- ache,until you reach the cause—the kidneys.Doan’s Kidney Pils are es- pecially prepared tor weakened or disordered kidneys —have been gratefully recommended by thou- sands. Testimony of Statesville people proves the merit of Doan’s. Mrs.D.D.Littlejohn,146 E.Sharpe street,Statesville,says:“My back pained me so severely that I could hardly get out of bed in the morning. Sharp twinges darted through my kid- neys and nearly took my _breath away.My kidneys didn’t act as they should.1 was nervous and run- down.I!finally began =taking Doan’s Kidney Pills and they re- lieved the misery in my back and made my kidneys regular in action. Six boxes of this medicine made me feel like a different persen. Price 60.,at all dealers’.Don't simply ask for a kidney remedy—get Dean’s Kidney Pills—the same that Mrs.Littlejohn had.Foster-Milburn Co.,Props.,Buffalo,N.Y. Barium Springs Water.Will relieve when drugs fail—-Stomach,Kidney and BladderTrouble,Rheumatism,Fesema andotherSkindiseases.'Phone W.A. EVANS and the POLK GRAYin.DRUG CO. PINE SHINGLES! JUNIPER CEDAR SHINGLES! RED CEDAR SHINGLES! Natls,Ridge Roll,Valley Tin,Brown and Green Shingle Stains. C.WATKINS,Shingle King of Ire- dell County. FARM NEAR TOWN For sale,76 acres.Good build-ings;well fenced and watered;highstateofcultivation.Good road,2 1-2 miles from Statesville. W.J.MASON, Statesville,R-4. Aug.21—4t’. R.P.Allison the agency for various Magazines and Book Publicationsand wants your orders for sub- to Maga- |ginesof all kinds.Will|order any book wanted. ' |Has taken over from \ All Magazinesoncoun- tersoonas out. Cost whatyou pay for them.Everypoundnouselesslint.To really know the differenceincostbetweenoldstylehullsandBuckeyeHullsyoumustknowthecostperpoundof realroughage. Even though BuckeyeHullsdose!l at a muchlowerprice than oldstylehulls,youcan't realize how muchlessthey are costingSaFaccade’bon mand cae can adie 6 ORG “FREEsatiateMRcrcestcee Halls Drug Store,to every mansimpleSanitarySharpeSafetyRazor. The Ideal Army Razor.The Fcovomical Home Razor.The 100 per cent Efficency Razor.The Strictly Guaranteed Razor. Come and get yours.HALL’S DRUG STORE, one TRUNKS,SUIT CASES AND HAND BAGS. We have just received a large shipment of Trunks,Suit Cases and Hand Bags. Now if your vacation needs requires a Trunk, Suit Case or Hand Bag,it will be to your advantage to give us a look before making your purchase in this line. Trunks,£5.00 to $18.50, Wardrobe Trunks,$20.00and $25.00. Steamer Trunks,$5.00 to $8.50, Suit Cases,$1.25 to $8.50. Hand Bags,£3.50 to $12.50, PHONE 83.. SHER RILL-WHITESHOE CO.] THE STATESVILLE REALTY &INVESTMENT COMPANY Appreciates the very liberal patronage of itfriendsandpolicyholders,bothNEWand OLD.Our office is an open one,and we invite all our customers and those who will become customerstousethesamewhentheysodesire.As in thepast,we will strive to give the same HIGH GRADE SERVICEthathaswonforthisCompanythewill andconfidenceofoverseventeenhupatrons. “WE INSURE ANYTHING INSURABLE”andPAYALL HONEST LOSSESIN CASH WITHOUT DISCOUNT. =“WEATERDOARDING, ond Composition intended in one,two and) C.WATKINS. Cc. Wewillbegladto have call at ourofficeforanyinformation,or No,54 if ourserviceinWedoNOTARYPULICworkalso.J.F.CARLTON, 7 i * dy accepted by eal bart ew Hope,accepted;mal board,Has wife. La Combs,Stony Point, ¢accepted by local t d,ok.filed no adine.eeLonnieP.Myers,Jennings,ac-cepted;accepted by local board.Hasparents. Frank Long,colored, accepted;accepted by localNoclaim Statesville,board. James Fletcher Bass,Dunlap,ac cepted;accepted by local board.Noclaim. Lloyd LaFayette Deaton,States-ville,R-1,exempted until December1;accepted by lecal beard.Haswifeandmother.Charlies Franklin Foster,Harmo- ny,accepted;accepted by local beard.No claim.James Lackey,colored,State ville,exempted until December 1; No claim sStates- accepted by local board Horace Campbell,colored, ville,R-7,exempted;accepted by eal board.Has mother,bir sisters dependent. Joseph Paul Carter,Eufola, exempted;accepted by loca oard Has aged parents. thers and The following Alexander laims were passed on: The foregoing shows that th teen men accepted by the local board were exempted by the district board,and two who did t apply to the local beard for exemption were exempted ==by the district beard.This mean that the local board will have to call more men to pet Tredell’s quota of 144. Alexander. Claim refused FE Sharpe, Obed F.Bowman,Marvin A.Bow Quez Blankenship,James Albert)Al len,Erastus Burette leenhou \ ner Clyde Harrin n,Ixaae Aver Stafford,Harrison Smith,J.MonroeWarren,E.D W Leroy Parks Gwaltney,Jr.Matthew Clem ent Bennett,John ©.veague Exempted Wilhkam Talmage Linney,Herb«I.Mayes,Lawrence I.Fry,Ques.Little,Fo D2 Bowma: Sipy Lerey Stafford,Rome W.Dula, Sipy Eli Jolly,LL.%.Staford,Wi! §L.Blankenship,Earl E. Bow- man,Carl Fineannon,C.FE.Crouch, Isaac N.Sharpe,Ed.Maye John Espy Martin,Wm Carl Payne, Charlie Franklin Brown,Artie Ps nell,Walter F.Stokes,Plume Israel Ruckey,DeWitt Ingram,R.L.Sher- rit.C.L.Frazier,Roland Pinkney Cline,Vanee Alexander Baker,T.I Query,Charlie Couch,Walter Alvie Menser,Ques.V.JoNnson,Charli William Fox,Jos.F.Jolly,J.Clint Prichard,David Sherman James, William Butler Chapman,David M Childers,C.P.Wike,Chas.P.Hut bard.The district board,which was exsion beth Friday and Saturday, aejourned Saturday afternoon until this morning. Mr.Meore Hurt —Escape From Greater Danger. Mr.Lester Moore,an en)«/ Holland Bre draymen,Was pain- fully hurt about 12.30 Fri lay.A woods Was be-truck piled high with ing driven into the Statess iNe Mint Cola Co.'s place on enter street The load was too high for the doer way and some boxes and a couple of eylinders of concentrated gas,used in the hottling business were || ed off the truck when the top of the lead =struck the deorway Mr Moore,on the rear of the truck,4 knocked off to the cement sidewalk,the voods boxes fell on him,and the ealf of his left leg was badly mash- ed.He was taken to Long's Sana torium §for treatment N bone were broken and he received no oth er injury.but the hurt to his fe: was sufficient to keep Mr.Moore the Sanatorium for a few days and disable him for a time It vives one a chill,however,to contempla what mivht have hap pened had those evlinders of gas ex ploded,as they might have done when they were knocked off.Mr.W L..Gilbert,of the Mint Cola Compa ny,thinks that th happening thereabouts,in ach event, weald have made the damare by ai bom from an airplane seem insignificant Married But Didn't Want to Be Exempted. at the marric oO eep out »Was atric 1 he i men etry of the war "The Tre the of the 4 itesville a Tette rom oa ¢tte man,“Samewhere ji ve ter \ Carolina.”ino which th that he had heen accept voh eal boord,but that hi wire 7 ented t enoe and th t had exempted him.{Eh want draw the paper he ‘ trietie and P want to vo to wat Evidently he’ver n for other reason he pref battlefront to his happy ome Forty New Forty new lawver one and an were |\ Fifty three app! dies who apphed two we Three newror applied 3 licensed 1 he Tredell mar Sharve of Harmon.The 3 \Mi |e Kell Krank ty and Wiss Stella Fl ttle Wan a aaased revEelVve exemy bard i¢ trpet te er ome Lawyers dell n Erne unty,Fr ‘) cer Lie Clarkson were olr (son 0 vir non)Mecklenburg | do of Ashe count The Four -Minut« “What Our Enemy & the subject as { ment to the Foo country for +) and nevt week ly about Germany,her system o erpment,military strength and oth er information has been furnished by the government to the Four-Minute .upon which to base their tal Taiks will be made at the Cres: theater thie week as follow To- al Dr.8.W.Hoffmann, ¥night by Hen,W.D.Tur_”night by Mr G.E : of an Pall Minute M weir tall nt "PASSES Third Creck charch had home- old ones on the La the summer were coming Frida soot was a success ineverypartieOnlyeneothertimeintheatorsofthechurchhadtherebeensuchpgofin-terested people.‘Tey 3,1802,whenthecentennialwascelebrated,therowdwasaslargeasFridayand pos@ibly a little larger.Anyhow,Vriday many of =Third Creek daughters from and/mingledchurch's sens and far and near returnedogether,The pregramme of exercises was taken up about 10 o'clock and lasted rac tie a through the entire day. There was an intermission from 12 iw 2.80 for dinner and to give all an opportunity to renew acquatnitances. The most interesting visitor present ind perhaps’the one to whom the day meant most,was ‘irs.ilizabeth B.Allison ef Statesv.ie.irs.Alli-on passed her 4th mile-post the past month She jomed Third Creek church in 2857 and was a member for several years,until ber narriage At the request of these whe had the home-coming in charge, Mrs.Allison)prepared a paper on Phird Creek church,woich was read Friday In this descripe the hurch wher he trendec--in the 10s as a jog building,with high pit and ches.It stood nearvherethepresentsessionhouse inds.An |.divided the congrega on inte tions There were cer houses in which the pastor met people to catechrse mem,the the Snorter an?the Catechism. Mrs.All ons section met at James Luckey'’s.They had Sunday school ind two sermons a Sunday during and at intervals a ser- egroes,of whom there number members.The the church at that time ham Wood,Jaco Krider Johnston,1s Kulp Vbel Graham and Phife The pastor spent twe hor and Vi ited eve techise them.Whenia t of sickness,funerals eFV¥ice \ the elder There the Ghurch prove the she bert ser ain the UNE $oly?on ree mon for thet quite a ers of ore W bert atrick, n each t 1 te t,on ace or BSsasist held in at a meeting, church =by singing schools at rachers,to in he th pgrood te music,and there was yout congre rational singing,much better,Mrs. Allison thinks,tha he house was filled generally,and gallery, oO.oO veral occasior there vere so many from other churches that services had to be held in the roveOnce,M A lise ld,when the ivch owas filled and services had mmenced,a large black snake fell m a hole overhead and landed on Ket fF some of the men.The awdies scrambled the seats and kod there until the snake was kill i,but none of the ladies scream- ed.At another time a dos owed me ioone-to the gallery.ot upen he railing,went from side to side, and the people were anxious until it nped out the vindow There ere five families in’Mrs.Athisen’ iwheod whe attended at Third eck,hu og -ory ‘t jo so.Most trevel those dnvs was done horseback,being the surest vayvoon account ef the reagh roads Rev.A.EF.Wallace,present pastor f Third Creek church,in charge of the exercises Friday,as isted by Messrs,T.A.Nitiock,© R.Wood,R.Holman and R.A.Nib- ishers.-There were devotional Xereise.,ving,Scripture read roll-call from church register Several responded eo the adere f weleome by Revo ALE.Wallace. mong them being Rev.Dugald Monroe,di.Re .Fleming, Rev.J.Lb.Yardk Kenn Iv.Mr.Horace To Spence ir if nd Dick Woods,col f th “t named of State All eONXNpressec their tsure t gy there ana tl re spect in which they hold Third bree Wr Woods saade a good how.Hl ited that he was mirht: i to there:that it made him roo He had heen both asked nd invited to be there and that } eit wera ention for a negra to ted back home Dick owas bap Third Creck and his me-ter, Mir.Burke,was an elder there Vie ermor of the dav was ached by Rev.EoD.Brown from he test:“Our vathering together’ he oo satd,heald call '1 from every !)vier uw 1 to come the Anyhell;mil roche Fi a i wer also sadnesfae<a MANY AT loaway.Th t A re , nere will '€ Wi Y { ‘uA al ' }}()Visi \ey '(b nd 1 v He 1]ve vi !ot wt "ay !t time but wre to !t athering will (i It !en nd wonderful gath ring.wt all nts shall be gath he Voassembted in Hi ‘A}Aliffere ¥]he 'The ‘of this wathering ’(ife med re |({will t pli |‘‘h f :i }‘e th'l et| para ’yt |i nh on Phere t ' |tal a?»mir \('on M Ino. ‘hetween home ('}R t H.Spence; Vt Sunday hoo!to hame Re NON.Fleming:“The i}mearing of home coming,”Rev Dugald Monroe,Jr;“Home comingtheHouseofManyMansions.” Jf.Yandle:“Benefits derived m home comi *Rev.R.A.Lap The last named subject was ed to Rev.R.W Bay d of Stu- art's Draft,Va,but he eould netver Mr.John Fleming spoke of on' Third Creek sens and daagiere |had taken in the business and professionalworldandintheservicePot | Soy t _-oming is tohome;Rev,M msgloryof—faperesaints;Rev.blessings andhomecomingbrings toSpecialfeatures =» gramme,all of which sont ly enjoyed,were singing by a rr tothe esers.Gra . Carson and Finason;duetsB.B.Plyler and Rev. volo by Miss Hazel ierandsingingbyamalechoThehistoryofThirdCreek wasel-ofveadbyMr.J.H.Carsen,senior der of the church.The history the church up to 1892,as read byMr.Carson,was from the historic ketch of the church by Dr,J, lamscy,read at the (808 .In this it is set forth that hird Creek church was or imed at G. 7.; ce al centennial in We have just closed one of the largest contracts with the Chevrolet Motor Company that has ever us present location in I ,morehan125vearsage.The chureh wasinOrangePresbyteryuntil2796, when Concord Presbytery Was es-tablished.It is believed there wareachingthereevenbeforeth church was organized.There was « meeting house and burying ground # there before the Revolutionary war, ne of the tombstenes bearing date s early as 1716.Third Creek ehurchThelandfer was donated by Samuel Youny, many of whose direct deseendantswerepresentFriday,the deed beingmadetoSamuelLuckey,Georg: Niblock and Thomas Dickey,—trur tees of the congregation at tha time.Young died in 1793 and pre vided in his will for the puforeachofhischildrenacopy ©he Bible and Westminster Confe- ion of Faith. The first pastor of the church wa Rev Joseph Dickey Nilpatrick,who rved for 35 years,dying in 182 Death occurred while he was away mm home His body hay in)-the rurch »night,the people held the nd the interment was in the ome there next day.After his eath the pastorate was vacant for tr.May 25,1832,Rev Lockridge,a licentiate of (Virsiniad Presbytery, {installed pastor, Ar drew Y xington a4 med The present building was ecom- leted and epened for worship —in 1885.The brick were made by the on gation In February,1887,t M.H.Adams was employedorhiswholetimeandcontinuedax stor until 1851.In 1838 the SynodNorthCarolinametatThirdrechk,the Rev.Stephen Frontis be moderator.Rev.8S.B.O.Wilson was pasior from 1853 until 1860 been made on any make of automobile inthisState tor the same size territory,This contract was closed after a long and very thorough investigation of the Chevrolet automobile and the eight different Factories and organizaiton which back it, car that is well worth your consideration. There is no cause for your buying an automobile that is not fully equipped with all the modern equip- ments such as self-starters,electric lights,speed- ometer,demountable rims,extra rim and tire car- rier,One-man top,ventilating slanting windshield, same size tire all around,and many other things too numerous to mention which you can get by purchasing one of the new model We have a large shipment in transit and will be in position to make immediate delivery. not a dealer in your territory there will be one; however,you can correspond with us here until there is a dealer appointed in that territory. will save time by getting your order placed at once. It is a Chevrolets. If there is You Sinee then other pasters and sup- ies were Revs.GD.Parks,G.R Brackett.W.A.Woou,E.F.Reek- ell,R.W.Boyd,A.L.Crawford,: cer White.T.ds Allison,R.Ss. \rrowo nl,J..lr.H.Spence. ‘ornelius Mil .Dugald Mon- oe,Jr.Rev.J.L.Yandle,A.EF Wallace,for the past eight months Phir d Creek chureh is located in -owan county,a few miles from ‘ela and js situated in a hea@t- ful grove of nearly 20 acres,To}le to properly appreciate the class people ascoviated with the —con- yatien,it would only have beenexsurytocastalookatthedin- ytable Friday.A long table had en provided but when the ladies rin to spread the dinner the ca- ty of the table was)much toe tl It was announced that the would not hold it)all at one ne,but af the people would fall toe, at awhile the table would be nhonished,This was done and with} most stantial ecatabl Auto License Taxes. The co@mties are now ree ng ro part of the automobile license ix collected by the Secretary of Saute for the year ending June 30, 17.and Treasurer Rives has re- ed $2,714 as.Tredell's part Under the 1917 automobile Jaw,70 cent.of this automobile fund poes the Highway Commission,to be ent in pro rata manner for roads the counties within ao year after |e taxes have been paid. ihe ining 30°per cent.plit, |er cent.being applhed to the ver ineurred by the Secretary s “2 office in registeriny itae i and V7 1-2 per cent.mainte. fund for the Highway com- Ate with the certification of the !automobile funds,the Soe. of State has certitied the ate reasurer the total colle ne r tt irst month's registration in- rt w law.Tinis was July.The }ounts to $238,815.04;IY »be upplied to expense 11, 1 be devoted to road 1 e- the State Hivhway ¢ome. throughout)the State,ond 1.15 to be devoted to 7 im- wvement in the varieu counties ym which the amount was collect. .pro rata,during this year Under the law)prior te the 1917 .counties got 80 per cent.of the io dieense taxes,For ale {[-edeli’s collections were $2,714.For e month of July,WT,the amount $41,086.50 Court Items. Lee Gaither and |Robert)CatheyoretaxedwiththecostsSay Mayor Bristol for excoedn ue yohile speed limit In the mayor's)court)vesterday *Herbert Merrison Was ed 1 the cost for exceeding autome. speed limit. ours Moore and Haywood Goiden, ored,each paid the costs cr day for an affray. AT WORK ON THE BRIDGES, The Virginia Bridge and fron rpany,which has the contract te ld three public bridges ac:the Catawba river for the couniies of Catawba and fredell,has begunworkontheBuffaloShoalbridge and has promised to put a force of hands to work on thewidIslandFordbridges at once.Mr,| R.L.Greenlee,engineer,is SUpet :vising the work for the counties. Inzati ve effect,GuinnisbetterthancohenBotCauseNeTvousnessakwefullwe Mooresyi Ihe | |Universal Auto Co.,Distributors, Winston-Salem,N.C. 5 passenger Car $635.00 f.0.b.,Factory. 2-passenger Car $620.00 f.o.b.,Factory. ——At—-— MILLS &POSTON’S. We have received a splendid line of Ladies New Fall Suits.Also Coats for Ladies,Misses and Children.Early buyers in these particular lines will get the best offerings of the season to selectfrom,at more attractive prices than later.All materials have advanced since above lines were purchased last spring. Yours truly, ===MILLS &POSTON.= C.WATKINS for ||Bracemima”1}GOING AWAY? satin,Lath,‘Lime,Gomer 1 You Will Be SizedUp By Your Trunk.Planters’Wh-,Statesville. FOR SALE.ite me ol‘tetake Two high-class farma of 200 aeres ench,inhealthfulcommunities;goed residences and allnecessaryoutbuildings;fine shade trees,excellently adapted to ail crops;accessible tod markets;mails daily.One has graded tep-coll highway of nearly a mite with ownership onbothsides;about 100 aeres in cultivation,in-/cluding pasture,remainder woodland;new 4-room tenant house and bern.'Other also on top-soh rond;about half in} cultivation;wired for pasture;goed meadow; 20 acres fertile,dredwed creek bottoms.There propertics are capectally suitable toomenbyowners,No for sale and noihe.but prices entirely fair and rem|sonable. we oFAue.3 Vf nterested,under theseRB.mt AO . See eae‘Thove Who Know Better]“TheStoreThat Than ©.WATKINS say Lumber) won't be cheaper for many years— wars,ornowars.SO BUILD NOW! \ ae 2ioeioe We arealwaysglad to show you.Cae eerie tee Two ining camp at will be sent September 6,two and one September 8.are white.as William Swink,Harmony;no claim for exemption. >‘el J Coleman made no claim Gregory,Statesville;made ;Galliher,Harmo- Adams Honeycutt,Moores-i,R-2;failed totalboard. Franklinnowliving atfamily. Everette.’ {made no claim."s quota is 1 Kestler,T appear before States-Tenn.; States- oone, Cash, aged parent.‘Gkante Wallace,Trout- 44.Under thezationregulations5percent.be sent to campmb5;40 per cent.40 per cent.October 3 and the re-ing 15 per cent.icable. inning Sep-September as government has provided thefalboard is necessary men to camp. with Mealtionandwhatever otherticketsand for getting the They will benoticetoreporthereintetimetoleaveontheSthr, Prosperi Heads MilitarySchoolin Sep- |Mr’Clarence Greene Prosperi,whoBeentlyretiredasrectorofTrinityopalchurch,Statesville,is nowintendentofJeffersonMilitary at Washington,Miss., Mr.Prosperi’s family will“.him soon,defferson Military ( near wlloge,locatedRthevillageofWashington,six milesNatchez,Miss.,jutionoflearningin ng been chartered in 1802. 8 the oldest in-the Southwest Jef-Imvis,president of the Confed-»received his g there. carly Tre grounds embracecollegiate ®acres,the buildings are large andodiousandthedormitorieswil)modate100were on theschoolhasr.Prosperi's Statesv 126 students.Morerolllastyear modern equipmentiefriendswillPleasedtolearntiatheissowellated. Examined For Hydrophobia. |Ruth Burnham,aged 7 or 8 years, Savannah,Ga.,who is a visitor at Wille,who stabbed & wa ‘3 »home of Rev..Dr.C.E.Raynal,severely bitten Tuesday by Drnal’s dog.The =¢ its head sent to log was killedRaleightobekaminedtoseeifthedogwasin-1 with rabies.bitten below thehgoingto.M.R.Adams w along all right. ere is no special considerable Wassedthewoundand The little girlknee,the dog'sdepth.called and she is yet- reason for he-ving the dog was infected with ra.It is understood thatibiteda strangers. disposition to he has be flerce Murder Trials inSalisbury. Luey Allison,colored,of States- tollough,also of 1,in Salisbury May to death Annie Statesville and30th,last1hetriedattheRowantermofwhichafternext.begins in SalisburyTwoothermurder,all the defendants colored andirvictimsofthebecalledfortriasamerace,are1atthesame The Allison woman will probablyofflight. »made by her co!She was released ofloredfriends,adaysafterthemurder. Child Labor Law in Court. Argument in the test case of thetutionalityoftheFederalchildlawwasinprogressinGreens-a ae andJudgeBoyd.TheCharlotteparties. Prof.Roscoe Pound, yesterday be-suit is brought dean of law ofrdUniversity,and Prof.Park-of Columbia University,are as-ing District Attorrney Hammer inprtoftheact,Junius Parker ofYork,formerly of North Caro-;Judge BynumClementManleylemappearforthe of GreensboroofWinston-plaintiffs.THREE KILLED. Thomas Howard,chief bank ex-vr for the fifth Federal reserve t;his brother,and his nephew,Overton How-Richard Bag-1 16 years,were all instantlyyesVa.,whenymorning near Ashe-their automobilewithanelectriccar. KILLED.SpeenACCIDENTALLY Miss Maud King ofold,=e in y oyofapistol. pn York,47‘oncord,wastheaccidentalShewango-with A STATESVILLE,N.©., For =at Greenville Capt.Westmoreland Wednesdayafternoonreceivedorderstoleaveherewithhiscompany—Company E,Iredell Bh>s—tomorrow afternoonat6.55 on the train to Charlotte,forCampSevier,Greenville,8.C.Thecompanyhasbeenexpectingordersforsometimeandisreadytoen-train.The company has three offi-cers and 165 men.Grady H.Moore of Catawba coun-ty is a new member of Company E,having enlisted since Monday.alin osPtaigne,whePrin »y y to take ¢regimental headquarters during Gol.Gardner's absence,returned homeyesterdaytoarrangeforgoingtocamp.,He returned to Shelby earlythismorning.The rterswillbemovedtoGreenvilletomor- row,Dr.R.A.Campbell,who has beenheregivesFn—vee of vae-eynat ompany E,ves todayforRutherfordtontointheinfir-of the First North CarolinaRegiment.The infirmary will leaveRutherfordtontomorrowmorningforCampSevier.The ladies of the local Red CrosshaveturnedovertotheIredellBluesthe24sewingkitswhichhadbeenmadeferthem Young Gilliland’s Bond.Mr.T.N.Gilliland of Statesvillesentacashbondof$1,000 to FortSmith,Ark.,several days ago,to se-cure the release of his son,E.B.Gil-liland,who is held there to answerforaviolationofthewhiteslaveact.The cash bond was to insure the ap-pearance of young Gilliland at theJanuarytermoftheFederalcourtatFortSmith.The Federal author-ities refused to accept the bond,however,unless it was made te pro-vide for Gilliland's appearance attrial,whether at the January termoralaterdate,and the young man’sreleaseistemporarilydelayed.The idea of Mr.Gilliland,senior,was that the $1,000 cash stood forKE.B.Gilliland’s)appearance at theJanuarytermofdourt,to which he‘s bound for trial,\and then if thetrialispostponedrenewalofthebendcouldbeconsidered.The Fed-eral authorities,however,wouldn'thaveitthatwayandadjustmentispending.It will be recalled that BE.B.Gil-liland,who is a barber and has awifeandtwochildreninStatesville,went from Black Mountain to Ar-kansas last apring in company with2youngwomanfromBlackMoun-tain.He was arrested in ArkansasonthechargeoftakingawomanfromoneStatetoanotherforim-moral purposes. Child Labor Representative. Miss Ketchum,representing theFederalchildlaborburenyinWash-ington,was in Statesville TuesdayandWednesdayexaminingchildrenwhowillapplyforwerkinthefac-tories under the new law,effective to-morrow.The law prohibits childrenunder14workinginthemillsandal-lows children between 14 and 16 yearstoworkonly8hourspdayandnotatnight.:The purpose of Miss Ketchum’svisitwastosecuresatisfactoryevidenceastotheagesofthechildrenwhowillclaimtobebetween14an:16.Birth certificates,baptismal certificatesorattestedcopiescfthese:Bible records,ete.,were deemed satisfactory.If the visitor found satisfactoryevidencethatthechildwasofproperageacertificatewasgivenThisguaranteestheemployeragainstprosecution.If a child without a certificateisemployed,the employertakeschancesonbeingabletoshow,in case of prosecution,that it is ofproperage. The examination was held at theSouthgradedschoolbuildine.MissKetchumsaidshocouldn't talk to th«newspapers about her work,and sothenumberofchildrenexaminedanthenumberofage.certificates giverwerenotlearned. No Plans For Meetings. So far no plans have been madeinStatesvilleforanycelebrationonLaborDayoranyotherday,in hon-wr of the men called to the colors un-der the selective draft law;and sofarasTheLandmarkhasheardnovlanshavebeenmadeinthecountytocarryoutGov.Bickett's sugges-tion in his proclamation this week.The men called to the colors will.ns stated,be sent off in groups.Thefirst5percent.next week,40 percent.September 19,40 per cent,Oc-tober 3 and 15 per cent.later.It ishopedthatwhenthesemenassem-ble to go to Camp Jackson at Co-tumbia they will be shown some evi-‘ence of appreciation and interest intheirwelfare. DROWNED IN FLORIDA.Miss Luey Rice hag been notifiedthather.Wilbur Rice,ofZephyrHil-Was drowned Sat-urday.,was about 35 yearsoldandleavesawifetwochil-dven.He t a few s here re-cently with selnttves,a Road,; board.W and chof; on WORK OF DISTRICT BOARD In Iredell Cases —SomeRe-versals —Two AlexanderCases, The exemption board for theerndistrictTuesdayandWednpassedonfredellmenforthe armyasfollows:Oute!L.Mayes,Mooresville,ex-geal aceepted by local board.Haswife__Early Grady Mason,New Hope,exempted;accepted by local board.Has wife and parent,James Burton Brown Murdock,Troutman,exempted;accepted by lo-cal board.Has wife,dohn Henry Nicholson,Statesville,R-3,exempted;accepted by leealboard.Has wife.W.Brotherton,Statesville,R-5,exem :accepted by localboard.Has Wife.Carl Bloomfield Kiddie,Hiddenite,accepted;accepted by local board.Has wife.-—Edward Stewart,‘oint,accepted;accepted byboard.Aged parents.Silas Davidson,Eufola,accepted;accepted by local board.Has wife.Charles Sylvanus Johnson,Eufo-la,accepted;accepted by local board.Has wife.Sylvester Campbell,Statesville,ac-cepted;accepted by local beard.Aged parents.Joseph Lewis Harrison,States-ville,exempted entif January 1,1918.Has not been passed on by le-cal board.Clyde L.Williams,New Hope,ex-empted until January 1,1918;ac-cepted by local board,where he madenoclaim. Gibson,States- Stonylocal Walter Clarenceville,R-2,exempted;accepted by Io-eal board,where he made no claim.Wm.Harrison Wooten,States-ville,R-4,accepted;accepted by lo-cal board.Has wife.Burton Rankin,Elmwood,accept-ed;accepted by localclaim,Clarence Poole Abernathy,Elm:wood,R-1,exempted;accepted by le-cul board.Has wife.John Robert Pence,Statesville,ex-empted:accepted by local board.Haswife,William Melton Shoemaker,NewHope,R-1,accepted;accepted by lo-eal board.No claim.Sherman Cicero Goforth,States-ville,accepted;accepted by localboard.Aged parents.John Gaston Pruitt,North Char-;:accept by localboard.Has wife.Sherrill Cloer,Statesville,R-4,ac-cepted;accepted by local board.Noclaim. Joseph Paul Carter, cepted;accepted byAgedparent. James Harrison Steele,Statesville,accepted;accepted by local board.Has wife and stepchild.Charlie Martin,Newcepted;accepted by local board.Aged parents.David Lee Glaspey,Mount Ulla,exempted;exempted by local boardWifeandchildren.Graham Parks Ayers,Statesville,R-1,exempted;exempted by localnoard,Wife and children.William Alonzo Brown,ville,exempted;exemptedboard.Wife and children.Vernon Reid Rash,Olin,exempt-ed;exempted by local board.Wifeandchild,Floyd Triplett Mills,Mooresville,exempted;exempted by local board.Wife and children.Marion Levan Benfield,Long Isl-and,exempted;exempted by localhoard.Wife and children.Thomas Jefferson Tilley,Olin,ex-empted;exempted by local beard.Wife and child.James Lester Wells,Mooresvyi}l«exempted;exempted by local board:wife,children and parents.Oscar Matthew Campbell,States-ville,exempted;exempted by localboerd.Wife and children.Dan Mayberry,Narmony,exempt-ed:exempted by local board.Wifeandchild.George Samuel Day, Stateaville.R.3,exempted;exempted by loca!board.Wife and aged parents.Caldwell,Mooresville,ex-Odell empted;exempted by local board Corbin,Ky., Wife and children. Ralph Yqunt Deitz,}exempted;exemprea by local board.Wife and child,lo,Frank Overcash,Troutman,exempted;exempted by focal board.Wife and children.Ransom Asbury campbell,States-ville,exempted;exempted by localboard.Wife and child.Samuel Alden Robbins,ville,exempted;exem board.Wife and child.Preston Durant Bumgarner.|Mooresville,exempted;exempted bylocalboard.Wife and child.Doke Munroe Hartsell,Eufola,R-1,exempted;exempted by localhoard.¥fe and children,Henry Solon Morrow,Statesville,exempted;exempted by local board.Wife and children.Dowd =Stevenson Armstrong,Mooresville,R-2,exempted;exempt-ed by local board.Wife and chil- d ‘ile Mabel Summers,,R-2,exempted;tenat board.Wife PayAndrewJacksonEufola,board,Wite sind w oa"alterLee Smith,States-by local Eufola,ac local board. Hope,ac- States- by local States- by local Cleve-by eePage). board.No}the f D FRIDAY,AUGUST 31,1917.NO.18. "S PLAN IMPOSSIBLE. t Wilson Rejects Peace—Can't DependnyAgreementofGerman Ts, The peace proposals made by thePopeofRomehavebeenrejectedbyPresidentWilson,who has sent the‘ing reply through SecretaryteLansing:“Every heart that has not beenandhardenedbythisterri-War must be touched this mov-appeal of His Highness,thePope;must feel the ignity andforeeofthehumaneandgenerousmotiveswhichpromptedit,andmustferventlywishthatwemighttakethepathofpeacehesoper-stasively points out.But it wouldbefollytotakeitifitdoesnotinteadtothegoalheproposes.response must be based upon thesternfactsandnothingelae.It isnotamerecessationarmshede-;ye a stable and ————peace.is agony must not wonethroughwithagain,and it must be amatterofverysoberentwhatwillinsureusagainst‘it.“His Holiness,in substance,pro-poses that we return to the statusquoantebellum,and that then therebeageneralcondonation,disarma-ment,and a concert of nations basedsponanacceptanceoftheprincipleofarbitration;that by a similar con-cert freedom of the seas be estab-lished;and that the territorialelaimsofFranceandItaly,the per-ing problems of the Balkantes,and the restitution of Polandbelefttosuchconciliatoryadjust-ments as may be possible of the peo-ples whose political fortunes and af-filiations will be involved.“It is manifest that no part of this‘amme can be successfully car-out unless the restitution of thestatusquoantebellumfurnishesafirmandsatisfactorybasisforit.The object of this war is to deliverreepeoplesoftheworldfromthemenaceandtheactualpowerofavastmilitaryestablishmentcon-trolled by an irresponsible govern-ment,which,having secretly plan-ned to dominate the world,proceed-ed to carry the plan out without re-gard either to the sacred obli tionsoftreatyorthelong-establishedpracticesandlongcherishedprinci-ples of international action and hon-or;which chose its own time for thewar;delivered its blow fiercely andsuddenly;stopped at no barrieroflaworofmercy;continent within the tide ofb]not the blood of soldiers only,but the blood of innocent women andchildrenalso,and of the helplesspoor;and now stands balked but notdefeated,the enemy of four-fifths oftheworld.This power is not theGermanpeople.It is the ruthlessmasteroftheGermanpeople.It isnabusinessofourshowthatgreatoeoplecameunderitscontrolorsub-mitted with temporary zest to thedominationofitspurpose;but it isourbusinesstoseetoitthatthehis-cory of the rest of the world is nolongerlefttoitshandling.“To deal with such awayofpeaceupontheplan proposedbyHisHoliness,the Pope,would,sofaraswecansee,involve a recuper-ation of its strength and a renewalfitspolicy;would make it necessa-‘y to ereate ai permanent hostileombinationofnationsagainstthe(rerman people,who are its instru-ments,and would result in abandon-ing the new-born Russia to the in-trigue,the manifold subtle interfer-ence,and the certain counter-revo-lution which would be attempted ballthemaligninfluencestowhieheGermangovernmenthasoflate‘ccustomed the world.Can peacebebaseduponarestitutionof—itsowerOFuponanywordofhonoritouldpledgeinatreatyof settle-ment and accommodation ?sible statesmen must nowPveryresee,if they never sawbefore,that no peace can rest se-‘urely upon political or economic re-trictions’Meant to benefit some na-‘ions and cripple or embarrass oth-rs.Upon vindictive action of anysort,Or any kind of revenge or de-liberate injury.The American peoplehavesufferedintolerablewrongsathehandsoftheimperialGermanovernment,but they desire no reprisalupontheGermanpeople,whohuvethemselvessufferedallthingsnthiswar,which they did not“‘hoose,y believe that peaceshouldrestupontherightsofpeo-ples,not the rights of governmenttherightsofpeoplesgreatorsmall.weak or powerful-—their equa)right‘o freedom and security and self-covernment,and to a participationuponfairtermsintheeconomicop-nortunities ef the world the ~man pesple,of course,included,jtheywillaeceptequalityand—notcekdomination.“The test,therefore,of every planfpeaceisthis:Is it based upen thefaithofallthepeoplesinvolved,ormerelywponthewordofanambigu-intriguing government,ontheonehand,and of a group of freepeoplesontheother?This is a testwhichgoestotherootofthematter;and it is the test which must be ap-nlied, “The purposes of the UnitedStatesinthiswarareknowntothewholeworld—to every people towhomthetruthhasbeenpermittedtocome.Theydo not need to bestatedagain,We seek no materialadvantageofanykind.We believethatthewrongsdoneinthisWarthefuriousandbrutal to be repaired, gov- any people rather n vindien-bothofthose ‘ power by as t aja French musichall DEATH CAME QUICKLY. Miss Bessie Anderson of Siutes-ville Died Suddenly at PilotMountain. Her friends and relatives wereshockedwhenthenewswasreceiv-ed here from Pilot Mountain Wed-nesday night that Miss Bessie An-derson,daughter of Mr.and Mrs.om A.Anderson =ay mnt had died suddenly.88 lersonwenttoPilotMountainlastweektovisitforseveraldays.She was ac-companied by Miss Lucile Fulp.Wednesday night about 10 o'clocktheywereoutinanautomobile,about miles from Pilot Moun-tain,and Miss Anderson complainedofapaininher.Doctors weresecuredbutshelivedonlyafewminutes, Miss Anderson was a stenographerfortheJ.K.Morrison Grocery andProduceCompany.and was 19yearsold.She is survived by herparents,who live en south States-ville,and by four sisters—-Mrs,Rob-ert L.Reid,Mrs.A.C.Fox,MissesCarrieandMarieAnderson.The funeral of Miss Anderson wiilbeconductedthismorniato'clock by Rev.G.H.Church,assist-ed by Rev,Messrs.C.8.CashweillandL.D.Thompson,and the inter-ment will be at Oakwood.The re-mains arrived here yesterday after-noon,accompanied by friends of thedeceasedfromPilotMountain. A Place For Faking. For the first American “camou-flage”unit,the army chief of engin-cers has issued a call for enlistmentof“ingenuous young men who arelookingforspecialentertainmentintheway.of fool Germans.”It isplannedtoorganizeacompanyofcamoufleurslargelyfromamongironandsheetmetalworkers,sign andscenepainters,carpenters,cabinet-makers,stage carpenters,—_,plaster moulders and photogra-phers.“These men will devote their wits todevisingartificialmeansofdeceivingenemyobservers,particularly avia-tors,”says a war department an-nouncement,“wherever a machine gunissetup,or a trench {fs taken and re-versed,or a battery of artillery goesintoaction,or a new road is opened,or #new bridge is built,or a aniperclimbsanoldbuilding,or an officercreepsoutintoanadvancedposttoheartheobserver.”The literal meaning of camouflage, term,is “faking.”Apgtuaate are asked to communicatewiththechiefofengineers,war de-partment. Two Deaths in Wilkes. Dr.William A.Berry died on the25thathishomeinWilkesboroafteraJongillness.He was a native ofSampsoncounty.born in 1851.HemovedfromIredellcountytoWilkes-boro in 1888,and owned and operatedadrugstorethereforseveralyears.His wife died in 1895.Several chil-dren survive,Mr.L..M.McGlammery died SundayathishomeinLewisWilkescounty.He wes within aweekofhis67thbirthday.He issurvivedbyhissecondwifeandfourchildrenofhisfirstmarriage. Taylorsville Postmaster to Go? John L.Gwaltney,aster atTaylorsville,will not be reappointediohispresentposition.The officewillbefilledbyacivilservicecom-netitive examination under rules an®regulations under the direction ofPostmasterGeneralBurleson,ac-cording to the Washington corres-pondent of the Greensboro News.Mr.Gwaltney's term expired lastMay.The News’correspondent‘ays he was informed at the Postof-fice Department that the postmas-ter’s service had not been satisfacto-ry and for this reason he would not©reappointed. MR.HOOVER ASKS FOR FIGURESMr.G.E.Dull,county farm dem-onstratian agent,is getting figuresonthecostofwheatproductioninIredell,This information is called for byMr.Herbert Hoover,governmentfoodadministrator,who wants it as\basis for price -fixing.Demon-stration agents have been asked to‘t figures from ten farmers in eachoftencountiesoftheState,Iredellbeingoneofthecounties. “trong. Punitive damages,the dismember-ment of empires,the establishment~selfish and exclusive economicleagues,we deem inexpedient and inheendworsethanfutile,no prop-er hasis for a peace of any kind,‘vast of all for an enduring peace.That must be based upon justice andfairness,and the common rights ofmankind. “We cannot take the word of thepresentrulesofGermanyasaruaranteeofanythingthatistoen-dure,unless explicitly supported bysuchconclusiveevidenceofthewillandpurposeoftheGermanpothemselvesastheotheriesoftheworldwouldbejustiimae-copting.Without such guarantees,treaties of settlement,agreementsfordisarmament,covenants to set uparbitrationintheplaceofforce,ter-ritorial adjustments,reconstitutionsofsmallnations,if made with the German government,no man,ho na-tion could now depend on.We mustawaitsomenewevidenceof“pur-poses of the great aCentral,but|be those that are]peace vi. Fork township,|; —Old Folks’Singing at StonyPoint——.’-/éMr,BE.S.Millsaps,Jr.,agent ‘for Clay county,visitedtivesherethiswas Pre-turning home from-~-Mr.Lessessne Allison left ove otax w tne WeaBlectrieCompany.rysomnty a e,“ah is totwilteotGecomhouseinsteadofatHebronchurch,as was announcedatthelastsinging.——-—a ute Munday andseverarenlexanderypassedSreeah¥aTues.en route a".~——Canada,where they will makeome,:~-Lieut.Herman G.Baity did nottonevethedellofficersfeHieordersweretoreturntoLieut.Baity is in thepartment. 13)and CAN GET THEIR NUMBERS.Secretary of State Grimes has ad-vised Mayor Bristol hiscansupplya :romptly.is means that pasate.yoard cards on cars,a fe“License applied for,”noSomeofthesecardsThevasionofGelicensetax.:bers can be obtained without delayandthepasteboardsignsinfuturewillmeanahearinginthemayor'scourt.-nee MR.GRAY CONSIDERS OFFERS.Mr.R.M.Gray,formertendentofIredellschools,leavesdayforChapelHillandRa business.Mr.Gray has notwhathewilldo.He has been offeredseveralpositions,—.ae consid.ering.Among themis the superin-tendency of the graded schools atDunn,Harnett county.He has beenecleetedtothepositionbuthasnotcivenhisanswer. WILL LOCATE IN CANADA,Messrs.C.W.anti Cary C,hamer left Wednesday for atriptoChieagoandotherpoints,Mr.C.W.Boshamertoreturninaweek.Mr.Cary Bos.hamer will go from Chicago to Can.ada in ~_—of his firm,HatelyBros,,who are la meat exporters,Mr.Roshamer will probably -be lo-cated in Montreal. RAMSEUR REUNION. Mr.J.F.Anderson,Mr,GeorgeR.Anderson and twoMrs.J.8S.MeRorie,SaraandMr.Robert M.Rickert wereLineolncountyW:to akheannualreunionofkindred,—— present and aatthehome of Mr.ence,three miles from | WILLIS |.HENDERSON DEAD.Mr.Willis 1.Henderson,a promi-nent citizen and busi manCharlotte,died at hin home incityTuesday,aged 56.three children survive,son WasS.native of oun attendedBeatevilleacademywhen a rv. American vessels and only didwereatwarwithhis appeared tohehadheardbysubma-|believe lifeboats will ever sooen the sub-| Germans removed|supplies| The cap-our life- rection of near-courteous good-submarine was about 400carriedtwosix-inch CaWe a l y i i f i r } T E V A E E R ] 3 i|safely at fi J.w. Hy é if se F E H L E az ? ar i Clash in Pamlico County. W.Boomer,colored,is dead,M. Grady,white,is in St.Luke's New Berne,with a seriouswoundinhisbody,Will and Ay hyvencounti wi e aoa ofSS conn and feeling at ,Pamlico county,is run-high,all the result of the kill--_of one hog,valued at less than $10,says a New Berne special to the er.,80 say reports from Ara-,Tiding in his automobile,ranandkilledaownedbyMr..The latter asked him to payanimalandwhenherefusedrrantswornoutforhimscitedtoappearbeforeaThetrialwasheldand| of the court was against,who was ordered Eedeadanimal.Mr.Grady’sanddaughterwerewitnesseserandattheconclusion| the hearing he intimated that they|had not-told the truth.Mr.Gradycollaredthenegroandtheshooting|‘was on.|Will and Allen Boomer,sons of J.|W.Boomer,are c with the!.It is alleged that they shot’at y and killed their father byaccident.Feeling against them waseostrongthattheyweretakentoNewBerneforsafety.Since thenthefeelingatArapahoehasbeensotensethataraceriotisfeared.Twoautomobilesloadedwithnegroesvis-ited the town at night.The negroeswereaskedtheirinessandrefus-ed to state it.They were ordered toleaveandrefused.Then a battle.followed,many shots being fired,butitissaidnobodywashurt.enoeen Cee Destroyed Submarine With) :Bomb.Saved by a British cruiser after his|ship had been sunk by a German sub-'marine,a British merchantship cap-'tain who arrived at an Atlantic porttellsofseeingtheU-boat destroyedyabombpbythecruiser.|The submarine disappeared whencruiserhoveinsighttosavetheofthetorpedoedsteamer.Af-|the cruiser picked up the captainerewshecontinuedonherway.short time later the lookout sight-.the pe of the undersea,was hanging in the wake.cruiser.The cruiser slowedandallowedthesubmarinetoup. B f 7 f , ° 32 > ee was coming on and a speciallybombwasletoverthe"s side.She then put on allsteamandranstraightahead.The|submersible followed.By this time|it was growing dark.About 10 min-utes later there was an explosion,ahulkconvulsivelyraiseditselffromthewaterandflouncedback,a| mass.cruiser cameandwentbacktothescene.|Germans were swimming about| fi v e ! i in the water.They were taken onboardthecruiser.remainder ofacrewperishedwiththeir | Tries to sap Into Prison‘amp.Deciaring that he had been a sailorGermansteamshipVaterland, appeared at theup of United States Marshal Webb|Asheville and demanded that he bethedetentioncampatThecasewascalereed i official who hap-| said e fe5 be in Asheville,but the offi-he could do nothing for|The German insisted that heandseemedtoregardita 7 45 percent.,wh-|seule,tnevenced 2 per Ff U s z af not,will then take the mat-the President poeeeyMr.Doughton went to the depart-ment to call General Crowder’s atten-tion to a statement he made to the general had told him that suchwouldbethecase.The conversationbecameratherheatedandwasfinallyendedbyGen.Crowder asking theConmantowritealettersettingforthhisviewsandthathewouldthentakethelettertoPresidentWilsox..Mr.Doughton calls attention to thefactthatthefarmersofNorthCaro-lina and other States have been urg-ed to plant large crops of foodstuffs.He says they have complied with thisrequestandthatthelandinhisdis trict from the lowlands to the highest point of cultivation in the mountainsisnowplantedwithfoodstuff.He considers it an outrage to allow the War Department to send these youngmentothetrainingcampsuntiltheyhavebeengivenanopportunitytesavetheircrops. The Government Tightens theControlofExports, President Wilson has tightenedthegovernment's control of exports by issuing an order forbidding the shipment of any goods to European neutral countries except under li-cense,and by extending the list for which license is required for ship-ment to the allies and neutrals otherthanEuropeancountries,to include ,cotton,all meats,sugar and most ofAmerica's other commodi- ties. In a statement accompanying his proclamation the President said one of the first intentions of the govern-ment will be to see that no Americanproductsaremade“the occasion of benefit to the enemy,either directlyorindirectly.”Officials interpreted the order as forecasting a vigorous use of the export control as a warweaponandapolicyofthestrictest rationing of countries contiguous to Germany.Exports to Germany and her alliesalsoareformallyprohibitedbythePresident's order and this is under-stood to mean that the export con- trol is about to supersede the Brit- ish system of giving letters of as-surance for American cargoes.Up to now there has been nothing excepttheBritishblockadetopreventthe shipment of American goods to Ger-many.The order in this respect ac- complishes one of |the purposes sought in the trading with the ene- my bill pending in Congress. export Coin,bullion,currency and evi- dences of indebtedness are placed under export license restrictions to European neutrals,whenever regu-lations governing their export have been promulgated by the SecretaryoftheTreasury. The President’s order contains the first formal announcement of thetransferofadministrationoftheex-port control from the Department ofCommercetotheexportadministra-tive board,of which Vance McCor-mick is chairman. Chance For the Privates. Enlisted men of the national ar- my,National Guard and regular ar- jmy will be given every opportunity to fit themselves for commissions,says an announcement from Wash- ington.This in line with the fixed policy of the government to take no more officers or officer candidatesfromcivillifeafterthesecondseriesofofficers’training camps,now in progress,has been completed.There-after all additional officers neededwillbefoundintheranksoftheva- rious branches of the war army.To carry out this plan,it has vir- tually been decided to establish anofficers’school at each of the divis-ional training camps. ranks who show qualifications willbesenttotheseschools.With staffsandFrenchandBritishofficersofexperienceonthefiringlinesondu-| ty at each camp as advisors,an unu- sual opportunity for lecture courseswillbepresented. TEED Wages Kept Pace in Few Cases Iron,steel and woolen manufac- turing workers’earnings per capitaforthetwoandahalfyearperiodjustendedincreasedmorethanadvanceintheretailpricesoffood-stuffs for the three year period,Ju-ly,1914,to July,1917.A statementbytheDepartmentofLaborshows“|that iron and steel workers’per cap-ita earnings increased 53 per cent.|and woolen manufacturing workers’ile the cost of food- Men from the| the |Ion The children'sThei be t a f :2% : sure,ifease,as diph';yg whoopingcoughorscarletfever,‘lent in the community,the|physician should be called in for|advice.lexposed to any disease theyibekeptathometilltheirphysicianjadvisesitissafetostarttoschoo). Doughton some time ago,that farm-,“It is only by keeping sick chil-‘ers would be allowed to take care of dren away from sccol,”say thetheircropsbeforesenttocamps.teachers,“that school canWhenDoughtoncalledGeneralCrow-be avoided and the health of the chil-der professed ignorance of any such|dren,as well as that of the commu- plan,while Doughton insisted that/nity,can be best safeguarded.” PATSCCE‘Protracted Meetings —Other News. Correspondence of The Landmark. Harmony,R-1,Aug.27 Thedroughtiscuttingshortlatecorn;;in fact all crops need rain.Much‘land has been broken for wheat andalargecropwillbeplanted.In these war times it’s hardly possible to make too much.The protracted meeting is in progressatClarksburyandSocietyandwillcontinuealltheweek.There is some sicknessneighborhood.Mrs.H.F. right sick.Mrs.Ollie and John Mise of Ports- mouth,Va.,are visiting in this com-munity.Mr.and Mrs.L.W.Gaith-er are in the community.Mr.GaitheriscuringtobaccoforMr.R.F.Gaith-er,who has a large crop of the weed.The result of the revival meeting at Harmony was that a great manyjoinedthechurch.Dr.Beaman cameinlatterpartofthemeeting,but mainly Rev.Mr.Foster did most ofthepreaching.A union meetingwillbeheldunderabrusharboratPleasantViewBaptistchurchthefirstSundayinSeptember.Mr.D.C.Campbell was taken totheSanatoriumlastweek.We learn he is doing nicely. aa Scholarships For Iredell. Iredell county has one free agri-cultural scholarship and two free engineering scholarships vacant at the North Carolina State College of Avriculture and Engineering.Thevalueofascholarshipis$45 per in theHeathis year and it continues as long as the) older remains in college.This is avaluableopportunityforsomeambi- tious boy or boys in the county.Technical education makes a strongappealtocapableandambitious young men,especially in these timeswhenproductionofeverykindfallsshortofdemandandpricesarehigh- er than ever before. MINERS’STRIKE OFF. The miners’strike in the mingham (Ala.)district, Bir- which threatened serious disturbance to the ¢ industrial situation,has been avert- ed through the efforts of Secretary of Labor William B.Wilson. Prac- tically all of the demands made by the union,including recognition, were indefinitely postponed.The demands from which the miners re- ceded include not only recognition of| the union,but the’8-hour day,the“closed shop,”and re-opening of the wage seale, WEST VIRGINIA'S PART. Government action in fixing $2 asamaximumpriceforWestVirginia coal will mean a loss to operators in that State of $100,000,000,accord- ing to Samuel B.Montgomery,State! labor commissioner.e estimates that since practically 80 per cent.oftheState’s population is directly orindirectlydependentuponthecoalindustry,the resultant per capitaiosswillbe66.33. soeeereeeaiaaniaehedneiememienaieemmaaaenineemaman EGGS $1 PER DOZEN, The price of eggs will be a dollaradozenthiswinter,says an army of- fever whe has been studying condi-| tions in the country with a view ofdeterminingwhat°%:costs to produce! eggs.He thinks that on account of|the high price of grain,it will cost)50 cents a dozen to produce the egys,| A CHILD HATES OIL.CALO.MEL,PILLS FOR LIVER,AND BOWELS!| Give “California Syrup of Figs”| if Cross,Sick,Feverish,Con-| stipated. |Remember the “dose”on—castor oil,calomel,cathart-ics.How you hated them,how you|fought against taking them.|ith our children it’sMotherswhos.don mother insist-a7 ' different,|to the old form of|realize what they! revolt is well.|r tender little “in.|red by them.|"s stomach,liver and |need om.giv 1 m4jlicious“California Syrup me ign*|but gentle,this harm- |founded.-are i of“fruit laxative” now eoikdvenlavetotabs ie,theehneverfailstocleantheliverand that icanpoontul wen ae aa‘=yo — your ®50-congbottleofofFhashsgrown.:2 ziiiiiiili If the children have been |should |Look back at your childhood duye\! / KrippendorfandRedCross We have ready for your inspection many of the new styles. Comeinandtry themon,youwill be pleased with the comfort.Popular prices. <=SMILLS &POSTON.&| excel insyle,wearand comfort. Revival Meetings Conducted ByanttgLaeCorres’Rev.D.H.iialigdth,pester ofStatesvillecireuit,iatchuwithgoodresults.Sunday,26th,he closed @ splendidmeetingattpone|church.Therewereabout50professions,14 joinedthechurchandtenwerebaptized.The Lord came down in great powerandthechurchwasgreatlyrevived.Mr.Rhinehardt is this week hold-ing a meeting at Chapel Hill church,on the Salisbury .The meetingatConnelly’s chapel will begin next Sunday evening at 7.380.Mr.Rhine- hardt will conduct the meeting and ing.COMAug.29,1917.; Four Investigations at Houston A separate municipal investiga-tion of the killing of 17 persons dur- ing the indiseriminate shooting bythenegrosoldiersofthe24thin-fantry,at Houston,Teas,is providedforinaresolutionadoptedbythe vity council. There are now four investigations‘onducted or planned.One is by Colonel Cross,inspector general of the Southern department;one byUnitedStatesAttorneyJohnGreen, a third by District Attorney John H.Crocker,and the fourth by the city. Se a a The nervous system is thealarm systeusofthehumanbodInperfecthealwehave4networkofnerves,but whenhealthisebbing,when strength is declin-ing,the same nervous system gives thealarminheadaches,tireduess,dreamfulsleep,irritability and unless corrected, leads straight to a breakdown. To correct nervousness,Scott's Bmul-sion ie exactly what you should take;itsrichnutriment|igs into the blood andrichbloodfeedsthetinynerve-cells while the whole system responds to its refresh-|ing tonic force.It is free from alcohol. Scott &Bowne.Bloomfield,N.J. “ree 2 reeOSTEOPATH. Dr.S.W.Hoffmann. OFFICE OVER Merchants’&Farmers’ Office ‘Phone,324;"Phone,279 Green. Bank. House oe re eee:eeee ee s ».7 FOR SALE. Two hivh-class farms of 200 acres each,inheaithfulcommunities;good residences and all necessary outbuildings;fine shade trees.Most excellently adapted to all crops:accessible to markets;mails duily.One has graded top-soil highway of nearly a milv with ownership onbothrides:about eluding pasture,remainder woodland;newd-room tenant house and bern Other also on top-seit read:about half in cultivation;wired for pasture:good meadow; 20 acres fertile,dredwed creek bottoms These properties are especinily suitable tooccupancybyowners.No forced aale and no |ané@rifice,but prices entirely fair and rea-!sonable.If nterested,under these conditions, nee or address R.BL MceLAUGHLIN,Aug,%Attorney. TOBACCO FLUES. Don't take chances on curing your Tobacco with old flues,for the price of Tobacco is the highestthisyearinhistory. We can make you the best price on flues. Write or ‘phone us.We can make, delivery the day you order! STATESVILLE TIN CO. "Phone 65,114 B.Broad Street. ‘THE SLACKER |And nobody wants a slack Tire. Unless you keep your Tires re- paired you have a slacker with you at all times. &SUPPLY COMPANY. Phone201 Court Street. ?Full line Tires and Tubes in ne hardly realize that | 100 seres in cultivation,in-! : io |{ ‘ Mr.&.©.Shaver will lead the sing- |\ | | ||| } | ||| |||||| ' | | i| ‘delay and learn how it cuts kitchen work in two. Will ContinueAllThisWeek — —--——Or until we close out.—-——- 1 lot Hats,sale price,1 lot Middys,sale price,1 lot Collars,sale price,1 lot Feathers,sale price,1 lot Flowers,sale price,1 lot Baby Caps,sale price, We also have a nice line of White and Colored Skirts we are offering at a great sacrifice.See our line and be convinced. SS SS ae MRS.MARY SIMS. The Cash Store. ATws*LprareryDsaetieee ;de -».a ‘s The Thoughtful Husband Supplies His Wife WithModernKitchenHelpers. No man wants his wife to work her fingers to the bone!He wants her to have everything that will make her workeasier--save her time give her leisure—for this makeshomelifebrighter,happier,sweeter,|No wife can do herself and her family justice,whensheisallfaggedoutbyneedlesswork.Every woman who does not know the value of theMcDougallAuto-Front should visit this store without ee ai Oe Om CO le Williams Furniture House. A Regular Picnic Ws z i s z > ST For you if you carry one of our new Thermos Bottles |on your outing. We —large,enedonsBgcome —can —| vera just ’Shveshing Then eonvied in these nage bottles.| Keep hot or cold indefinitely.Indispensible to 1automobilists. We'll be glad to show them to you. POLK GRAY DRUG CO.“On the Square.§: LEST FORGE soem,&6gadtnetoextent MonumentforNemoto,Gutetod Mae ng earn oe 2s > Dwelling Burned —Fever Diss)f -gpesering —Mooresville.;y ieews,\<oa |Breccia!Correspondence of The Landmark. PRN ROAD,|Ore .wonel ofTh,weet-bound,due 6.40 |Mom evil,Aug.30 About 3 +:‘ae :;west-beund,due 10.10 @dlock Wednesday morning fire of Ve SEIS NS VOCEeonrpeues,due 3.50 anki origin destro:the dweil-COPS Ma GeerfeeeaeoecupiedbyMr,Claud Lowrance TD ee»ennt-beund,due 22.50 family,near No,2 cotton mill,|/catt-hound,due 6.45 Everything was lost except some.eant-bound,due #.00 bedclothes from one bed.c fire3re|had made such headway.before dis-‘rem tte eover«(that the fire company couldTrainNo.14,ar.9.50,lenves 10.20 a.m,do nothing,as the building wasTrainNo.24 ar.8.10,teaves B10 m.From Taylorsville.=about burned down before they couldTrainNo.23 ar.9.50,leaves 10.28 .m.|get to it The dwelling was owned Ly .! "—.Biel te oe en on tne te M:.J.M.Geedman.No insur-f Two dollars aren’t worth anything|ae Ret sopentedonGum |ies..unless you buy somethingwiththem.—Mountain Sheep W |Fever Decreases.,p Work.|»The scarlet fever is not spreading,7WiththeagreementofMr.8,T./@inee Mayor MeNeely put on the ,You couldn't eat two dollars if you|Henry of Spruce Pine,Mitchell|Stfict qurantine regulations,A y Pp|county,to allow his 1,250-acre farm |#Fy'pity it was not done sooner 4 were shipwrecked on a desert isle.Gy 5 little daughter of Mr.Paaljtobeusedforexperimental)::;|with sheep by the wach a oes work |Bar scr,who has had the disease,is G But two dollars ave full of splendid!the almest well,No new cases reported.1 EBs iment Station,and wi i;:4 oat ‘pen carina a age es Radford A nomber of peopie have had it who y postibilities,if you know how to spend;pagintment of Mr.W.were not sick enough to have a docjefYanceycountytotakechargeof|ee ee ee o‘this work,the Animal Industry Di--,and who theretore were not un-y themwisely, |vision bas berun its campaign for the a oe 7 =i ae 'production of more sheep in the!®vss to reach them and had to (For only two dollars a week you cantakethedrasticstepsofbarringall|State and for further study of all)4 serejtheproblemsaffectingtheindustryavablieaeaae cpevate0 Memwell autemnatilie.lon the farm.Mr.Radford is a yrad-publie meetings;and —this;hard is put on the’children byjuateoftheStateCo-veve of Agricul-:;::;That mea 000 per cent.profit——intureoftheclassof1917,and special-ee —some:=>ized in animal work.|ey ad wee ee heelth and joy for you and yours.{It is the purpose of the station 9!Quarr,renal —han;syste ange :develop a system of range sheep Themas.und attended services at We don't knowofany investmenthalfhusbandrytodeterminethepracti-|the iutheran cherch Sunday.Thisjeabilityoftheindustryfortheao:rj good,|State.Along with this will be ex-/|¥®*>iret sat te eorsecive “:we nd they were highly pleased with{perimental work conducted for adap-7 oes ‘::{tation to the small average farm,me os rate the Har ——‘|where 30 to 40 sheep are maintain.|(Oe"%:0"the same lot,iiiForabagofDavisBros.Some Serges,Jed.|Mr.Henry's farm will be divid-‘iS "Sey Up se nice and newtedintoasystemofsevenoreightfaseaemeeapea rtsGrahamFlour,fresh lot sheep corrals,each of which will ac-|4:oe eee ed here Wednesda)?£126 .lsommodate from 140 to 200 head.|°"their way to eastern South Carofightfromthemill|Pifty breeding ewes etii he purchas:ing on a prospecting tour. j ’°°ied this veer,as x first unit oF “the The communion meeting at Amity Don t forget that we have Some m Satins {work,and oo lambs will he bought Luthera:chure a which embraces ,i i |next spring as a second unit addi-Sunday,Peean Wednesday night.“,anything you want in the onal unite of the ware unit,addl'The pastor,Rev.J.L.Morgan,Jr.et::oe ane of Troutman,will be assisted in theoe2°a of Spices,Vinegar,be bought as the iand is cleared,meefing by Rev.L.A.Thomas,pas-Ci Touring Car $748pastureprovidedand«ether necessa-S.b :3 Re ee ang:he maintenan-e |lr ef the Lutheran church here,whotracts,Ru bers,Jars rv feed wrown for the maintenan:e preaches Thursday and Friday at the :Rondsce 6766:Cound $9000|5 fof the flock.and Jar caps.'|The work will be cenducted for atjEVENine Service.Berline 61008:Sedan O2008‘aad lteact @ Tariod of)AG .ae od Mrs.J.B.Houston returned Tues-All pricesf.o,6.Detroit Phone89 line:er if autinfacte-arra:‘ements day from a week's visit to relatives:lnrc wede “Fi Statesville.Hazel and Oni Housfeceeton,who visited in Charlotte last Eagle &Milholland.Russia's Sad Plight.week,have returned home.;a;|.Prof.Allen,who has been elected °.|Ed.G.White Motor Company, Cc, |iF z5; i le aFsiteFs PE P P E R EP | ge * zi ‘ iti etL :if z;zg i, H e C o t H e a d F H i t giit t it si e 3if &B 5s S 2 2 iiac SS S SN S AN G E ee ee e e oN SS N S ES ‘Gen Korniloff,commander-in-principe!will open the Mt.Ulla Some Wool and silk iehiel of the Russian army,address-)high School September 11th /.:!pimaeoa conference at Moscow this Mr.W.A.QOvercash of Amity Statesville,N..-week,said the death penalty,restor-passed here on his way to Liddell!"/F INE ion of which he had asked,togeth-!nigchine shops in Charlotte,where ,vt|r with other measures,constitutes}.4.,paged in work.=rejenlyasmallpartofwhatisneees-Real Estate Deals,’;is ,very in oan army stricken with the,Th.Wm.A.Kerr farm in Coddle es :|? SO O O SS S NN a Pha ahah a ,en loff by Dr.Hoard of King’snthepresent menth,reneral Mountain at $4tt per acre.The sale is|Korniloff said,seldiers had killed jefe goer 20 days for)per cent.our regimental cemmanders and bids.This uy aluable farm.other cffleers and ceased these out-Mr.W.A.Haitheox,a near neighCOUNTRY[f All Well Tailored,(278tr sk REGS toa sot an TP she Reo fa °e “s A I OT Combinations.ferrite evils of disorganization and ©»,which wa sold at)auction,CMT hee :el eae AI yJ. -:Z veek sold his farm of 453°aeres to f ihe reriments of Siberian rifles.Megfocke Geodman of (abarruvhichhadfoughtso-plendidly at county.He has bowcht the William.wry ‘7 th Peet,?¥>th heyinnis of the —revelvtian,Perry farm,near Barium,and will7. MEAT thandoned its positions on the Rica nove there with his family this “win°.°"rion Nothing except an order to .He made this move so as to beStylesRightandterminatetheentirerewimentartheyoodschools,having a longvailodtocauseittereturntoitsrmatTroutman.This is one of°.vosttieg He said “The situation t :,!:uddle Cree}bv families,whoWiler-McLainSupplyfo.a m the front iw hat,Wp have lost pve mere of foond ee on7hewholeofGalicin,the whole a!Gmone ihe Penim singers of old CodNukewinaandallthefruitsofoutCreek,but all aroundeeertvictoriesAtpresenttheerSecialandfersenal Items..And Hay Rakes,McCormick Corn F a“yee sae.>:°}2Hl:}Prices right.(ny has crossed our froniiet urd is Phe first criled mecting of the Idle Bind 1 Shredd TI:Schoo hr atening ou ertile southern (Con -i.al whick 'J ;‘Ts ‘i.»>?armony High ro .uvinees,He is endeavoring to de-|)maqam cre nich Mrs.a 8.sinders ang iredders.ese ston eer ele|ov th Roumanian army and i omit .+he ‘30)f hi 44segss.eee enlled for rest Friday,dine 6th,|Machines you will need for the:A Farm Life School ur one ot hold th Aas a 1 he lca ae Hay and Cora crop now ¢iForGirlsandBoys.Colors Golf of Riga the road te Petroyrad “Mp.and Mrs.Morris McNeely of |y and Lore p how growing,he opened wide—SPECIAL COURSES IN-aif Russia wishesto be saved the -iaday to.vie Bb ovd and Home Economics,Agriculture and |a Mies Mary be ine.th My ne *machines this year will get it for »Manis Arts.:>}ithhier af pred 4 i 3 f . Recetas i N His Will the Law,ng,ha ned from the Char-,less money than for a Jong time toPreparesforCollegeandUniversi-avys,law Notes,ay eat ar cehanata at mprov-i ty entrance.letral profession,in vais we She had bes eet tment come,as prices wilt be muchFa})term opens TUESDAY,Sep-has the followin,fie he past th)mo tember 11,0 1917.Engage board |‘Te may not be penenathe |W edding. th ‘cats ‘esi)«}r ‘red R ay Mi aynowatDormitories.hat som ips ope C1850)aon Ir.Fre q M Kv Mpson Were mat Sunday at;!cocsor of the pres ont reag ‘‘For further information and new 'Blacks Hichest,’Frederi Whilinn:TV in 3 7 MB.at the .home,peariMustratedannouncementwriteto’came a suitor in tt me ap VW)fh ohe.Revo Wo OR.Hoaleor of ,(oaustonia came ’ooresy ithe fed-~40 Sangin wicks to |ai Ahi ee The man who buys one of these yore yy tir higher later. ¢..Ti,S@CCKIN LO recuVve ft et :resville ae me sh Re7R.H.LANKFORD,Principal,tata devease |post no eee ee}i owhieh he pl nde o Am fae re '“.uJ Harmony,N.Cc.°°(With of }?ie en oe me and happy ! ae ~ew Wisterias,eke .be .“te \USE THE RAISER Nt.THE EARTHDIDYOUFEVERBUYaeetiesatireie| |A Door or Window,and find it would Hie ,;Not fit the Frame’?©.WATKINS bas |the Doors,Windows and Frames,|Yeady-made.YOU CAN TRY THEM Ei aes Sam :saneBEFOREYOUTAKETHEMFROMBrownsandGreens.as ae ie maser “SEESRESTTLEREETECELRSESEESES EERESS CSNSTLSSEEESG 1 CEPERIASESE COSTTEEN TTI Lazenby-Montgomery Hardware Co.| Peat 7 i gut STURARaN Ayn ’we soeapt:ry ‘aang eve 5 a al ite oamebiWAG.osale~ 9s ie + Si ne ea t ol ee the effertSCRAPBRASS—HeavyBrass7c.Sizes 14 to 42.Bie or wives per pound,Ligh,Brass 5c.per vorid ascendancy eeoeee,eepou:d nainet (the ret FOR SALE:wee Wwenxespay,PS be,——In Condition ——Now end second hand riachine .al the most pematiaiie ooforsaleandallkindsofboier1Omsalenowanduntill«7c yates ee !room suppiies.abigsidvlnhdaar Sait tea .el ‘my om ;. C,H.TURNER.re iy which “motorists may of +te [h:iL Ss FE it |O Smoke.Wedell 'Phon:No.74,Bell No 17 ed mileage from their tire;would imagine that tire dea!f ‘Battery Trouble Righted.$chawss would be necemary,But this a8 sean you 7 That’s The Way We Keep House. Ce et ee lt a SE ee ee NL A NT is not wenerally true.There is mo Ms rejoicing today over one car ow) if youhave Batter trouble,whore tire rin 10,000 to 15.008BingusyourCar.ell locate mie than over a hundred whiaaAllworkdonebylackofcarepreventsthemfromect Meare weanexpert}?ting many miles they are entitled to Ai ¢ym cE ()I (y’’\I IT Y ‘STATESVILLE MOTOR co..This national tire eonservatior »the .‘4 ¢*4 4 e movement ill reach Statesvi!!ae. ans :—s f Wednesday,Septemper Sth,whe a cn eee ry ’ Cedarand PineShingles {the Tire Conservation Day will be did well,of :St t V j \,Com ;-RAMSEY-BOWLES-observed Carrying ont the idea of ha waa onig pray §;a es 1 ie aw ru y All grades —lowest prices.Nails,helping all local motorists to secure »heme eld bRitigeRoll,Valley Tin,Brown and more service from their tires the 1 the stare and etrty saptescitigaaty om r Shingle Stains.Statesville Moter Company hoe ar vee to you thes he wate =”ee ranged to have an expert from The Ctpempenemantoee ‘"a '|tame |6 INGERSOL DOLLAR WATCH_©.WATKINS,Shingle King of Ire-;Goodyear Tire and Rubber Company Sepresentatthedrmenstration,who Durio®(he bet weather of or *:=will give an entire day over to the ~cUMAame member of almowt cocry family |War price #1.35.See me if you are in need;consideration of the tire problems of |likely to be troubled th an wnemturs ::all local motorists,pointing out the '"inpmdint written were |=Of any Kind of a Wateh.1 can supply thatmostinsignificant“ch emponty w done when the medicine Is ff need.In stock,Hamilton,Souke~~a ,Rewtten .2 Py 5eeeSome,will ‘-e's a Be.be Brot,Soataviae Waltham,Elgin,New York Ce ee“er met mate rool Ghd Digreboen Remedy ax os five |Reliance.idua}_attent ‘ach ofbagminengomplaint ahdsae saiceine 4 have sitice wed it with/eee A =ge is sound if itcable.But so long as vacant propertyintownisassesedlikefarmlandsandvaluedforsalepurposeslikecitybleeksatsomuchperfrontfoot,so long will the population grow on the me outside,the town will not get the ad-' vantage of the population in the cen- sys reports and will suffer materially in consequence.The remody would be to assess vacant property inside in prevertion to its sale value and make those who hold it for the unearned in-erement pay for the privilege.Thereisnoprospectthatthiswilleverbe done,Eeoes the agitation for expan- sion.The second proposition is an eco- nomie one.If the people believe that the extension.will prevent the loca tien of cotton mills and other manu- facturing industries in the suburbs arid that it is better to have them on the outskirts than nov at all.whichwouldbegenerallyéoneeded,then they would oppose extension.If they do not think that such results would follow,and that cotton mills or other industries on town lines should not prevent the town’s expansion and arenotentitledtoanymoreconsideration|than indust:ies on the inside,they will vote for expansion.The question is for settlement by the voters next Tuesdzy.The Land-mark hopes that it will be settled with consideration only for the general community good—for those outside as well as inside;and that whatever the result we will all unite in puching for ep better and a greater town and com minity. ASEDTED Eaker,the school teacher who conducted the anti -draft meeting at Lincelnton,took a fling at the news-rapers.He is reported as saying) that while about all the newspapers| ave preaching war,none of the edit-ots have volunteered.The Landmarkhadn't «considered Eaker’s remark werthy of notice,but the Greens-boro News resents it.The Newsgays“that six of the best men thateverwerkedinthissnopareinkha-s ,,volunteers all,prepar-to go out and fight for the coun- aly,which.we regret to be compell- Tas on observation,that more men “8A for him.” fighting for suchAndThe belief, add,meansasthis Eaker.” adds to this the have from newspaper offices inNorthCarolineintothewar,in pro- to numbers,than any othersion.Of course Eakevy's re- mark was palpably false.It mayhavebeenduetoignorance.But think of a fellow like that instructingchildren! AIReS OEYAEEOTT The Lincoln county school teacherwhoengineeredtheantidraft meeting and secured signers to a pe-tition in.favor of the Hardwick bill,said he didn’t expect to accomplishanythinghythepetition,but ‘vanted an expression of sentiment astothewar.That is,he was simplacitatingandencouragingopposi- tion to the war,with no hope of ac-, complishing anvthing good;and ifhehasanvsensehemustknowthat the agitation can only result in harm.If any evidence is wanted offreedomofsptechinthiscountry, notwithstanding we are at war,it is the fact that such fellows as the Lincoln man are allowed to run at large.The Spaniard who spoke at the meeting in support of the gov- ernment,reminded these Lincoln ag- itators that a meeting like that in al- most any other country,in time of war,would call for a firing squad. TeaNN “Sometimes we are inclined to think,”remarks the Greenshoro News,“that the <tranvest fact in history is that net only did Tom Wat son twice run for President,but that on both occasions several people vot- And it would be more amazing,were a presidential cam- Hgign on this year and Tom a candi date,that he would get any votes atall;but the number he would re cave would probably astonich —the News as well as The Landmark It is not believed that symnathy with Watson's views nor belief in +porposesareanythinglikeweneral,but anti draft propaganda this Rtate,in’Georgia and elsewhere, most of it directly attributable te Wateon's influence,show that he yet has considerable following. me ee Talking about conservation of food,elimination of waste,ete.aStatesvillemantellsTheLandmark that his information is that there isthegreatestwasteoffoodinthear- my camps;thet the allowances areliberalandtheresultantwasteis enormous.This information,heenya,comes from soldiers.It is verylikelytruethatthereixmuchwaste and unnecessary waste in camps.The government =is rendering agreatservice,through efficiencyperts,in teaching the people how to food,then how to con-serve and save it.It is possible that effort is directed to the cown-try at large government hastoeweepbeforeitsowndoorcan't begin too soon.Put the ex-in army camps and show them OS Company &ae States- thestreets,wave-Ahutthe .could not be exempted. “men who have z ¥l been shot by a po-|liceman,that Snow told them the po-iliceman was entirely at fault.Ifthatistruehehadjustaswellhavetoldthemoutrighttostarttheriot.They needed no further encourage- nt,All the reports indicate that the negro soldiers resented the authori-ty exercised by the Houston_police.|they not only felt that the policehadnoauthorityoverthembutthattheyhadarighttointerferewhen‘olice arrested other colored people.Whether the police were in any meas- ure to blame for the friction we don’t know.Policemen are not al- ways blameless in such matters,Butsefar.as the evidence goes the blameforthetroubleimmediatelypreced- ing the riot was with the negrotroops.If their commander had told them,in a way not to be misun-lerstood,that he would see that their comrades got just and fair treatment and that they were not to interfere,there would probably have been noriot.Instead he is alleged to havesaidthepoliceweretoblame,and the negroes,doubtless recognizing ‘him as a weakling,disregarded him entirely.The Landmark is of the opinionthatasensibleandconservativeSouthernwhiteman,who knows the negro and knows how to treat him,is the only man fit to command ne- gro troops. AARNELENT THE DISPUTE. Congressman Doughton Crowder told him that =farmers would be exempted from the draft until they had garnered this season's crops.Gen.Crowder appears to have no recollection of the promiseandthePresidentisaskedtosettle the controversy.With no purpose to break into thedispute,The Landmark will say thatitsunderstanding—and it believes that was the general understanding hereabouts—was that men engaged in farming,who appeared to be ren- dering as much,or more,real servicetothecountryintheproductionoffoodstuffsthantheycouldrenderinthearmy,would be exempted;andthesamewouldapplytootherindus-tries considered necessary to the government in the prosecution of the war.For obvious reasons class exemptions were not made in suchcases;that is to say,all men engag- ed in farming or anv other businessSothismat- ter of occupational exemptions was left to district boards,not to local!boards.The farmers have represen-_ tation on these distriet boards.The chairman of the board for this dis-!triet is a prominent member of the Farmers’Union.It is believed that these boards will exempt as many ‘real farmers as possible;and that(they will grant partial exemption,toallowthemtimetogathercrops,to others who can't be exempted =en-tirely.This is a matter that must be considered by individual cases.To jgrant wholesale exemptions in eith- er case is not practicable;and we aresatisfiedthatthedistrictboards,du-, ly impressed with the great impor-tance —the necessity —of food pro- duction,will be as liberal as possible,|in justice te the public service,in_granting exemptions and partial ex-| emptions.While labor is very scarce on the farms and the removal of any real workers will be felt,the com- paratively small number taken inthefirstdraftwillnotproveso yvreat a hardship,possibly,as antic- ipated. savs Gen. SRR EEEAREASSTSTES, Enlisted men in the army —al!branches—-will be given every oppor tunity for commissions,it is an- nounced,After the conclusion of the second series of training camps,nov in progress,no officers ov officer can didates will be taken fron civil life If the private in the ranks wants t« rise he can show by his conduct that he is fitted for promotion,and then he will be sent to divisional training camps,maintained for this)purposePersonalandpoliticalpull,there fore,will not secure the oppointment of incompetents to offiee.It will } a matter of merit:shown by)good sork,and the humblest private in the ranks has a chance.That's the true American way and tnat method,strict ly applied,will make an army invinei bole Mr.Horace Williams,the Universityprofessorwhoholdsweareat war with Germany because of racial feeling and not as a matter of prin- ciple,is receiving some attention. Mr.C.F.MeKesson of Morgantonrecentlygavehima_going over intheGreensboroNewsthatshouldhavegottenunderhishide,but he has so far said nothing.The youngwhogototheUniversitythisfallcanlearnfromProf.Williams ,that his 13 associates in the facultyandtheseveralhundredUniversityantweredthecoun- try’s call,are fighting Germany | simply because the Germans aren't)English. They're calling for recruits for theAmerican“camouflage”unit.Theliteralmeaningofcamouflage,we are|told,is “faking.”Well,if the gentle-men of talent in that line to!the call there should be no ity,in filling the ranks of several units. REREAD i E t 4 _later, F .Horwitz, ia and recentlymayorofMoorehaven,a téwnFloridaEverglades,has .pointed on the mili staff of the|Governor of Florida with the rank ofmajor.aed Gulf South _sians have suffered heavily in menomecoco.ae all a killed or wounded and have lost more! ments of foodstuffs destined for ex- port to Europe is planned as -. ernment war measure to econgestionofrailroadsandportsintheEast.Word of the first casualty to an officer in General Vershing’s forees in France has been veceived by the marine corps in a cablegram|an- nouncing the death in a le accident of Second Laeutenant FrederickWalstromofthemarinecorps. James E.Ferguson,suspended V-ernor of Texas,has refunded to The State $2,043 of the executive mansionappropriationforitemswhichthecourtshaveheldcoulanotbepaidby the State.This is covered by one of the 31 apticles of impeachment brought against the Governor. In accordance with instructionsoftheWarDepartment75,000 copies of an English-French phrase bookpreparedbytheNationalSecurityLeaguehavebeenorderedshippedt National Guard and national armycamps.The book is intended for in struction of soldiers going to France Miss Emma S.Lansing and MissKatharineT.Lansing,of Water-town,N.Y.,sisters of Robert Lan- sing,Secretary of State,will sail forFrancesoontoengageinRedCross work at the canteen stations on rail-road lines running from the trench-es.They expect to be away for six months..Thirty additional Germans have heen arrested in Hutchison county,.D.,for violation of the espionage act.They are charged with havingsignedapetitiontotheGovernoroftheState,protesting against the draft and the war.Since August14,60 Germans have been arrested in Hutchinson county. Six men and a woman are in cus- tody in Chicago,suspected of com plicity in the murder and robbery oftwomessengersastheywereabout to deliver the weekly payroll of $9,- 600 to ai Chicago manufacturing company.The robbers opened fire as the messengers approached the gates and fled with their booty —in automobiles. An order fer one million khaki pocket Testaments for American sol- diers and sailors has been placed bytheNationalWarWorkCounciloftheY.M.C.A.,with the AmericanBibleSociety.The first delivery of100,000 Testaments to the Y.M.C.A.will be made early in October and a slightly larger number will be made each succeeding month. Probably Cloture in Senate—) Increase on War Profits. Ikvelopments in the Senate .Wod- nesday with reference to the war tax bill,were: Petitions for cloture signed hy Senators to limit debate and early passage of the bill wer: sented by Senator Simmon:,in charye of the bill.A vote on cloture cannot be taken under the rules before today.| Increase of the bill’s levy on war profits from $562,000,000 to 81.980,-| 000,000 was proposed in amendments| kh 56 force i than 1,000 wing Sandethreegunsand50machine guns.Meanwhile M.Kerensky,the Rus-|sian premier,has reiterated to the! closing session of the conference at!Moscow the determination of the pro-!visional vernment to protect the! results achieved by the revolution and)declared that no counter-revolutionary| attempts will be countenanced,iAcontinuationofthe stermy! weather is still holding up major op- erations in Franee and Belicia,al-| though the British here and there!still are engaged in minor trench raid-|ing activities.The fighting on the!Verdun front for the moment also has| reached a pause,only the big guns) being active.Herd fighting is in)progress between the Italians and,Austrians on the Bainsizza ovlateau!and on the heights cround Gorizia|More than 1,000 additional prisoners and numbers of machine guns havebeentakenbytheItalians. Fighteen British merchant vessels of more than 1,600 tons and five of less than 1,600 tons were sunk by mines or submarines iast week,throe more in the larger category than wer sunk the previous week and two morc in the smaller category. A OEESORTER ce GERMAN PRISONER ESCAPES,| Sigfried Sonneck,one of the Ger-!|mons interned at Hot Springs,es- aned Sunday night. The prisoner is about 32 years oldindisthefirstofthelotatHot Springs to attempt to escape.His wife had heen staying at Hot Springs for several weeks. IRONIZEDPAW-PAW 3 POWERFUL FORCES IN | A Combination of Nux, Iron and Paw-Paw. Gives Joy—-Prolongs Life! If vou desire to preserve youthful vim and vigor to a ripe old age,you must supply the iron de- ficiency in your food by using some form of prepared iron,just as you use sult when your food has not nough fron is absolutely necessary to en ible your blood to change foed into living tissue.Without it,no matterhowmuchorwhat)you cat,your food does you no good.You cannot ret the strength out of it,and as a consequence,you become anaemic, weak,pale and sickly looking.If on will use ftronized Paw -Paw,1 tablespoonful 3 times a day before meals,you will very quickly find re- urning strength,digestion normal and the nervous system restored. Everywhere you go some one canhefoundwhohasbeenbenefitedhy ts use or knows of a friend who has found the desired relief:all are wrnising it,and each expresses sur- wise that cures of the most stubborn ‘yses of indigestion,nervousness andsleeplessnesscouldbebroughtabout ot)speedily. your presented by Senator Simmons for a!¥.1. majority of the finance committee,You have only to get a bottle,take designed as a compromise to prevent)|according to directions,and you more radical increases.The Senate|Wil a.use ay _— made changes in the bil which,in-|aoe i.aa ches bo Taal takingcludingthealmostdoubledlevyon)vonietone up your system and pre-war profits proposed by the cormmit tee,would bring its total to $2,522... 470,000,| Provisions for a 5 per cent special income tax on publishers to raise S7,+| 500,000 was stricken out without a roll call.In lieu of the House zone system for increasing second class} vent your vital organs from becom- ing disordered or badly affected. A system that is overworked —or run-down requires a harmless stimniant.Alvohol lis but lets youfall.trenized Paw -Paw lifts and holds you!Your druggist probably keeps it,but if he doesn’t,it is soldpostageratesby$19,000,000 and the!jn Statesville by the Polk Gray finance committee’s substitute propos.!Drug Co..7 ing a flat rate increase of ooe-fourth! Jronized Paw -Paw,price $1.For-cent a pound,estimated to raivc $3.-/mula on every bottle.Mail orders 000,000,the Senate by a vote of 40 to!sromptly attended —to Interstate 34 substituted Senator Meckellar’s!Drug Co.,Inc.,New York.-—ad. zone system to raise $12,600,000 addi-| ditional.An effort to strike out the | "|‘ section entirely and leave pres postage rates unchanged wil!be mod be ——rejected,39 to 20,the |rial prices.There are eight WAT-, proposed letter postare increase from]KINSES in the Lumber business and|2 to S cents,estimated to raise $50,-|Y BUY IN IANTITIES! 000,000 revenue.|THE N QUA)! University Men in Army. Two hundred and thirteen students! |Portable,together with one bread meal mill,and former students of the Unive: of North Carolina have heen commic- sioned first and second lieutenants in the army and 13 members of the fac-ulty have received commissions,ac- cording to an announcement by Fd- ward K.Graham,president of the in- stitution,after completing a war roseterofthestudentfody.The Uni-versity is represented in every train ing camp in the country,PresidentGrahamsaid. It has been generally conceded thatinhandlintheEnglishlanguave President hh is a master.His answer to the Pope's peace eoalswouldestablishthateuetery,taditnotalreadybeen.Force.harshness,thefullyandwithoutPresident,with a clearness andconcisenessthatcannotbesurpass.S =& says No Solution for Submarines C.WATKINS,who has been play-| ling such havoc with Building Mate- FOR SALE. One ten-horse power International Engine, aity|sleo feed mill Entire outfit fer anie,‘Termsreasonable,Can be seen at Fred H.Cou.gers THOS.J.CONGER.Aug.28 St.. The rtnership heretofore existing between %.V.Lone and dno.A.Seott,Jr,under the name and style of Long &Scott,attorneyes-at- law,has been ditsolved by mutual consent. with .Leng.Any acounts against the firm will be qoeent ©M for payment.vet iJNO.A.SCOTT,IR.Aug.28--4t° r. Worm’Maat ‘PRONE NO.400. NE REGISTER Furnace.The The Entire Let us quote you prices on thesizerequiredfarpaartauie. Crawford-Bunch Furniture Company. “The Store That Always Welcomes You.” At persona indehted to sald firm will nettle | NOTICE OF DISSOLUTION.| If you are nursing.a want to get rid of it don’t come_here. Our customers are a happy,contented,carefree lot because they turn all their motor troubles We are equipped proverly to handle any com- plaint you may have to mzke of your car. When you come to us you have the satis- over to us, grouch and don’t faction of knowing that the work aials ee Souvenir Day! is done right. Fe CEEETION US ° VDA The Public ts Cordially Invited on SATURDAY,SEPTEMBER FIRST To attend the opening of the new pgaiheCAROLINA fuast Statesville Inn. Every car driver will receive a souvenir Clean,cool, of the occasion. district. Your Presence On This Occasion Will OTOR COMPANBroadStreetjustopposite the handsome in appearance,anddesignedforthequickdispatchof_busi-ness,the citizens of Statesville shouldwelcomethisnewadditiontoitsbusiness Show Your Appreciation Of Our We hope to register the name of every guest a record of friends and business associates that we will cherishont Progressive Spirit. his .day for all time to come. “Look for the Garage with.the Green Roof.” a)W K Carolina Motor Company. NEVER CLOS see¢ A AE Cc,H.L ISTER, =99 4 oe Fe e Be ma e oa 9s ge s aa a aa d ct # 2 3 of iif f co s ie 4 FF = ae =? Fe ei* ii<=. Fe °; isP§ EF $? s c r i; ;RE.»Bl;.Buther,$1;HarveyOstwalt,3 Mes..M.Troutman,25¢.;.7.8,Lofton,Sve,;i A.Le Derr and wife,|1.RK.Ontwalt,82.50; Bhe.;»J.S&Waush,.;Miss Kluts,26¢.;C.H.7 Brown,59c.;Mr.Morgan,Rrown,$1;W.W.Williamson,$1;ng.$1;Mrs.Christopher,50c.;brahe.;Mr.Litton,2he.;Chaska}carh,b0c.;O.C.Litton,.Litton,26¢.;J.J,Littem,|i,A.Qlodfelter,.M.Ontwalt,82;Ostwalt,2he.;Mary Ostwalt,6c.;Pearl Ostwalt,iGe.;Ethel Oxtwalt,ie.;C,B..60c.;MH.M,Hartline,S0e,;C. 26e.;J.¥.Moore,S0e.;KB.J,;Edwin Troutman,Ife.;EistelOc.;Mrs.H.L.Suther,25e.;-Ontwalt,26e.;T.€.Ostwalt,31; »Clodfelter,26e.;Rev.R.E.Huey,Neilson,S0e.;Mre.8.FB.Lipnerd, 2 od.LL.Turner, Union Grove.Alice Campbell,S0e.;J.T.Jennings,$10;»F.Robertson,$6;J.C.Templeton,Suc.:»&Templeton,$1;&.C.Henderson,81;.PF.Rolin,81;Huie Templeton,“1,J.G »$1;J.W.Sharpe,$1;4.Wo Wind p G0e.:;W.A.Cooper,50¢.:T.M.Jurney,;RC.Sloan,$1,7.Wo Jurney,$1 =..,From Eufola Community. Correspondence af The Landmar! Eufola,Aug Cool nights and rustling ves remind wa that fall is heseMasterJ.C.Shook had the misfortune to sprain bie ankle last Sunday it may keephimtohisroomforseveralweeks.Mr do &Morrison has been confined to her room withrheumatiam,Misses Laura and Bert Bradford and MarthaCarter,whe have been attending the instituteinStatesville,are at home.Mr.Ralph Aber- nathy and Miss Kila Moore of Cool Springwereweekendvisitorsinthiecommunity Mewars.Arndt of Claremont,Ray of Detroit,Mich,and Colvert of <ireinia,who havemaeanextendedvisitwithMr.Ralph Summers,have returned to their respective homesMra.Burney Sherrill of Arkansas,who has been visiting relatives bere,will return home ext Monday She wiil be accompanied by ber brother-in-law,Mr.Wo KE.Sherrill.MiraW.EE.Sherrill!and daughters will he withMrs.Sherrill’s mother at Lenoir during Mr.Bherrtit’s aheeneeRev.and Mrs.Kester of Jobneton,c.are visiting Mrs.Kesters parents,Mr.andMrsRC.Little,Mrs.Cullen Ostwalt hasfonetoPetersburg,Va.,to join her husband.Mre.Blake Gantt is vistting her mother atClaremont.Mr.Rowet Gantt,whp has beeninMaxeachusettsforseveralyears.is visiting*people before sailing for France.Me M.F.Nash,Mr.and Mrs.G.W.NashandchildrenmotoredtoUnioncountylastweektovnitrelstives. Quite a number of young people from thiscommunitywereatBali's Creek Sunday, Social ‘and “Personal Items. Com vespondence of The Landmark Hiddenite,R-1,Aug.29 The friends and avighbors of Mr.and Mre J.T.Sharpe wath-ered at their home on the 22d to ceicbrateMrs.Sharpe's birthday About 150)wereuresemt,there was an sabundanes of gooddinnerandeverybodyhadafinetimeSeveralofourfolkswenttoStonyPointthe24dtoattendMr.D.A.Sharpe's birthdaydinner. Mr.and Mrs.T.J.Williams of Union coun-ty visited relotives around here fast week.Miss Nora Allen has returned from MonroeMr.and Mrs.Boyee Willams and littledeughter,Lucile,from Florida,are visitingtheMissesMarshMesses,D.A.and V.Hf.Iaekey,W.A.and H.ON.Sharpe.RD.andTv.b.Lackey went to Ball's Creek to attendthecampmeectingMra.T.Ho Lackey camehomelastweekfromCharlotte,where she tadbeenwithMr.Lackey,who recently under.went an operation in a hospital there.MrLackeyisimprovingsiowlyMrs.FredLackeyandlittlsonhavereturnedtotheirhomeinHamlet.Mr.MeLain and Mr.Set-ser,from Caldwet!county,have been visitingotMr.Cleveland Sharpe'sTheprotractedmeeting et Carson's chapetbeganSundayevening.The pastor,Rev.J4.Edvards,is doing some fine preaching Notices of New Advertisements The Masque of Life at Crescent todayTireconservationday,Wednesday,Septem.ber 5,at Statesville Motor Co,New line toilet soap a:Hall's drug storeColoredmenwanted.Tallnssee Power CoNewfallfootwear.Sherrill-White Shoe CoTailoreddressesinserges,satins,etcRamercy-Hov ies-Morrison Co.Caloric pipeless furnace.Furniture Co.Dine harrows.Iredell Hardware Co Flooring,cedar and pine shingles,door andwindowframes,ete.C.Watkins.Ladies’shoes.Milla @ PostonCarefreemotoristsmakeheadquarters atStatesvilleMotorCo, Chiekens end eam wanted.A.L Charlotte,N.C Gold medal lont.-J.A.Arey, Sale of city property Monday,Octoher Let,Fred L.Heupe,commissioner. Seven-room cottage for rentPantslost.Return te srsStatesville,R-2 tacles lost Landmark Bunch of keys boat mark Brick masons wented.Camp Greene,Char- ” 8 Crawford.Bunch Mauney, 8J ¥.Lone A.Abwher, Return to H Return to The CC.Gaither wv Land. et i i i f | i t $= z z s Etlarneyronss,"Me.lefton No.16andA ¥“3 2s Z g5 g zz:i .viously hurt at h ae two li s t = “Z a" Fe d Fort.Mrs.Kelly is the eldest dlofRev.and Mra,C.8.formerly lived inhasbeenteach CharMr.and Mrs.J.S.Alexander havereturnedfromatendays’visit toNashvilleandErwin,Tenn.Mrs.J.W.Ward has returned fromSalisbury,where she visited Mrs.Ed.Morris and Mrs.Charlie Shu-ping.d.!Mrs,Chas,Anderson and son, township,this county,and has beenlivingatthehomeofherbrother,Mr.T.P.Morrow,in Shiloh.Mr.Dickinson formerly lived in thatcommunity. Miss Beulah M.Kerns and Mr.P.8.Carlton,both of Salisbury,wereiedinAshevilleTuesday.Mr.‘arlton is a well known attorney ofSalisburyandrepresentedRowanintheLegislature.The bride is adaughterofthelateThos.M.Kerns.The ceremony was perfFirstBaptistchurchof Asheville bythepastor,Dr.W.F.Powell. The engagement of Mrs.Heppie|Adams Grier of Barium Springs andMr.John Terrell Henderson of Gal- veston,Tex.,is announced.For seven years Mrs.Grier has been a matronattheBariumOrphans’Home and she is held in high esteem there.Mr. Henderson has been a resident of Gal- veston for several years and is a rail- road man.Mr.and Mes,Henderson will live in Gastonia. Misses Lucile Tharpe,Catherine Matheson and Willie Sloan entertain- ed a number of friends at Tharpe’s Wome last Friday cvening in honor af Miss Satlic Greenwood of Elkin.The affair was a masquerade party and Miss Luctle Canter and Robert Harris won the prize for the best disguise.After diaguises were removed,rook was played at sever tables.Miss Margarct Shean an Max Hedrick received prizes for the highest score while Miss Mildred Bed-ford and Junius Harris received thr consolation prizes.Miss Greenwood, the guest of honor,was presented a hox of correspondence cards,Re- freshments of punch,fruit gelatin, cream and cake were served. Miss Carrie Hoffmann and Mrs.W.H.Hoffmann entertained at three tables of bridge Tuesday af-ternoon.Mrs.8.D.McPherson ofDurhammadethehighestscore.Fa-vors weve presented to Mrs.McPher-son,Mrs.Aaron Clarke of BaltimoreandMrs.Nathan O’Berry of Golds- boro,who were guests of honor. Mrs.EK.M.Land and Miss Rachel Rorden of Goldsboro and Miss Lila Parker of Birmingham,Ala..were other out-of-town guests.Following the same the hostesses served a sal- ad course.The house was prettily tleeorated with sutamer flowers. Mrs.T.M.Crowell was hostess at a took party yesterday morning in honor of her sister.Miss Geneva Parks of Concord.Rook was plavedatninetablesandMissLeeofRal-cigh made the highest score.There were no prizes.A salad course and mints were served after the game.Pink and white were the predomi- nating colors in the decorations. Out-of-town guests beside the quest-of-honor were Mrs.Boyd Mullen of Huntersville and the Misses Lee ofRaleich. Master John McLaughlin entertain- ed about twenty of his voung friends Tuesday evening,in honor of MissEvelynWilkins.A number of rol- licking games were played and thevoungfolksenjoyed—themselvesthoroughly.There were —refresh- ments of cream,enke and candy. Mr.and Mrs.L.W.MacKesson en- tertained the night bridge club Wednesdayevening.Mr.and Mrs.Eugene Davis,former members of the clubwereguestsofhonor.There were nec prizes.Two courses of refreshments were served, Mr.and Mrs.Eugene Davis of Lynchburg were guests of honorwhenDr.and Mrs.J.F.Carlton en-tertained the Night Bridge elubMonday—evening. luncheon was served after the game Miss Sarah Adams entertained th: Why Not club and a number of oth-et guests Tuesday afternoon. Double Birthday Celebration. Corresipendence of The tanamart At the home of Mr.Gus.Moore,near Trinity Methodist church,Sun-day,26th,a double birthday dinnerwasgiveninhonoroftheanniversa-ries of Mr.and Mrs,Moore.About|75 friends and relatives were pres- ija splendid dinnerent,a number from Statesville,andwasserved—ex-cellent in quality and abundant in quantity. -People's ase ete convene thropjends’church next FridaycontinueSunday.sessions Saturday, lormed at the| Miss;¢ two-course | ‘Master Percy,have returned from astayinTennessee.|.Mrs.J.H.Hoffmann leaves todayforDanvilletovisitherdaughter,Mrs.Kaufman.Mr.Hoffmann will join her Sunday.Mrs.Janie Jacohs of Columbia,§:C.,and Miss Flora Brown of Gaffney,8.C.,are guests of Mrs.F.M.Cun- ningham.Mrs.C.W.Baker and children ofWinston-Salem are visiting Mrs.M.H.Somers and other relatives in townMrs.A.G.Moore of Nashville,Tenn.,is visiting relatives in town.Miss Lois Sherrill has returnedfromavisittofriendsinNewtonandHickory. Miss Maggie Sherrill is visiting herbrother,Mr.Charles Sherrill,in New- ton. Mr.and Mrs.W.M.Stevenson and children of Bennettsville,8.€.,spentMondaywithMrs.W.R.McLelland.Rev.Dr.J.N.H.Summerell ofNewBernespentTuesdayandTues-day night with his sister,Mrs.A.MCoit.Dr.Summerell was en route home from Montreat.Mr.W.G.Templeton,who apenthisvacationherewithMrs.Temple-ton,has returned to Washington,D’.Mr.Templeton travels for theRadcliffeChautauquaandhashis headquarters in Washingtun.Miss Geneva Parks of Concord istheguestofhersister,Mrs.T.M.Crowell. Mr.G.L.Crowell left last nightfortheNorthernmarketsinthein- terest of the Crowell Clothing Co.»Miss Hannah Wallace is spending a few.days in Greensboro with Miss Frances Price.Mr.C.Watkins has returned fromMontreat,where he spent several weeks.Mrs.Watkins is visiting rel- atives at Gastonia. Miss Corrinne Morrison left Tues- day for Greensboro to visit MissKatherineWhite.Miss Louise Sher-rill is also visiting Miss White. Mr.and Mrs.A.G.Corpening of Rockingham =spent Monday nichtherewithrelatives. Mrs.W.C.Carmichaelson.who spent the summer herewiththeirparents,Mr.and Mrs.C. W.Stimpson,jeft last night for their home at Cordele,Ga. Misses Laura,Virginia and Edna Yorke of Concord arrived Wednesday to spend a few weeks with Mr.andMrs.W.H.Tomlin.Miss Avrelia Vance,who was the guest of Miss Margaret Brady,re-'turned Wednesday to her home atGainesville,Fla.Mr.C.B.Webb,who spent sever- al days at home,has returned toWashingtontoresumehisdutieswiththeSenatefinancecommittee.Mrs.Webt accompanied him and will spend some time in Washington.Mrs.S.N.Peters and children, who spent several we ks in States- ville with relatives,left last nicht for their home at Sharon Hill,Pa.,neat Philadelphia.Mrs.R.A.Campbell,who has beenspendingsometimeatBuffaloLithia, Springs,Va.,and at Hickory,arrivedhereTuesday.Dr.Campbell,who has ,been making headquarters at Hick- ory,has joined her and they are at the residence of Dr.M.R.Adame until they go to Greenville.Mrs.S.MH.Boss of Seattle,Wash. and Mrs.Annie Ford of Cleveland and little are visiting Mesdames W.T.and H.¢ L.Kineaid. Miss Katherine Kinenid left Wed- nesday for a stay at Davis SulphurSprings: Mr.and Mrs.B.F.Russell have re turned from a visit to Clemmons andWinston-Salem.j |Dr.and Mrs.H.M.Parker are spending a month at their summer home at Pauley’s Island,8.C.Mrs.J.C.Wakefield is visiting themthere. Miss Luola Overeash has returned from Cynthana,Ky.,where shespentthesummerwithheraunt.Mr.R.P.Lazenby of the countyhasgonetoChapelHilltodosome|fendan preliminary work at the Universityvriortotheregularopening,Sep-tember 11.Mr.Lazenby was at theUniversitylastyear.Mrs.8S.D.McPherson,who was aguestofMrs.Ross McElwee,has re-turned to her home at Durham MRS MKEE AT HOME. Mr.J.M-McKee and Miss MecCol.|lough,who have been in the Northern||markets in the interest of J.M.Me-|Kee &Co.,returned yesterday,accompaniedbyMrs.MeKee.Mrs.Me-!|Kee underwent an operation in a Bal.|timere hospital in early summer andsincesheleftthehospitalhasbeenin}Baltimore with relatives. PICNIC AT TABOR. To_the Mar of The ft tttor— i ' TaborIts+children, invited fu e melons,He for grain on the |market; bridge force in aes.Fs =Heywood iMrs.ann °Messrs.Everette and Vance redofElmwoodarerelativesinthiscommunity.Mr.y Rimmerandsisters,Misses Grace and Mag- Saturdadalene,went to Claremont Blues,of urday night and Sundayrents,Mr.and Mrs.8.M.n.We are sorry to hear the Blues areexpectingtoleaveanyday,as mostofushaveabrother,cousin or eweet- Messrs.Marvin and John Lippard,who have been ill with typhoid fe-ver,are able to be wea Mr.A. Q.Waugh has beet sick but isbetter.The condition of Aunt Nan-cy Hobbs is.about the same. WORK ON SCHOOL BUILDING. The painters and calciminers are atworkonthesouthschoolbuilding.The Charlotte company tHat securedthecontractfornewheatinglanthas-oe oa. hompson hopes ting plewillbeginnextweekandgetpysideworkoutofthewaysoasnot to interfere with the opening of school at the regular time—Septem- ber 10. Un eens th, A Ea The NET RESULT of a year’s work is what counts.If one man earns $10,000 a year and spends it oll,hedoesnotreallymakeasmuchasthemanwhoearns$6,000 and has $2,000 in our bank at the end of the’year. Put your money in our bank and fet it STAY:there;this is the one SURE way to get ahead. Make OUR bank YOUR bank We pay 4 per cent interest on time deposits. There is more Catarrh x of ‘the|THE FIRST NATIONALBANK, Statesville,N.C. country than all other put together,|and for years it was supposed to be incurable.Doctors prescribed local remedies,and by con-stantly failing to cure with local treatment,pronounced it incurable,Catarrh is a localdisease,greatly influenced by constitutional|conditions and therefore requires constitutional|treatment,Hall's Catarrh Cure,manufacturedbyFP.J.Cheney @ Co.,Toledo,Ohio,is aconstitutional,is taken internally andsetsthroughtheBiontheMucousSur-fu of the System.One Hundred Dollars!reward is offered for any ense that Hall's Ca-tarrh Cure fails to cure.Send for circulars and testimonials,‘.F,1.CHENEY @ CO.,Toledo,Ohio.Seid by Drugeists,Téc.Hall's Famiiy Pilla for ecanstinetion. Statesville ProduceThefollowingpricesforproduceonthelocalmarket: Sorina Chickens,18e.per th.Hens,ie.per Tb.Eves,36.per dozen,Roosters,Je.to Be.per Ib. Tub Butter,26c.per th.Heeswax,fe.per tb. Green Hides,18c.per Ib. Hams,25.to 28c.per tb Sides,Zhe.to Zhe.per th.Shoulders,260.to uke,per Tb New Red Honey strained),16-18.per th,New Red Honey Comb,Ihe.to ie.per ib,| Sourwedd Honey Comb,w2e.to tbe.per Ib. Extracted Honey.22c.per tb.}Old Auto Rubber Casing,4c.per Ib iIrishPotatoes(new)$1.60 per bushel. P }The following were paid yesterday Wheat,82.25 per bushet,Corn,$1.90 per bushel Oats,The.per bushel. 24 cents eotton. On the local marketx.pound was paidhetfirm. LOST—Spectactes.Please return te A. GAITHER or THE LANDMARK Aug. LOST—-Pair of pants between Statesville andBethichemchurch.Please return to MRS,| on yesterdaybest J.A.ABSHER,Statesville,R-3 Nuy ige FOR RENT—Seven-room Nerth Mulberry street.Aux.31 LOST—Hunch of keys. LANDMARK newB.FP.cottageLONG, Return,te THE!FAug.31. |WANTED—Two messcnger boys with wheels.WESTERN UNION TELEGRAPH CO.|Aus.31 ' WANTED—Chickens and Eggs.t pay cash.Noy»Write me A.L.MAUNEY,,|h St.Charlotte,N.C. LOST—Geld medal.Information willAREY.States:ile WANTED—Brick Masons,Charlotte,N.¢Rate 60 CONSOLIDATED ENG.CO FOR SALE—Fifteen three-months oldR.HW.KENNEDY,Houxtonville,NAug.24 zt’ FOR SALE—Mare and mule colt;wagon andbugey,cheap.WALTER NICHOLSON, Statesvilic,B.1 2t*.ent inncpemenentnenee ie mn sprainasemmennesillisiite¢sWANTED—Ambitious young men,mechanical-ly inclined,to learn the moulder’s trade.Will pay $1.60 per day to start with,in- creasing Se.per day for each week of sery-tee,SOUTHERN DESK CO.,Hickory,N.C.Aux.2 4t. WANTED—Young man for work at Soda Fountain and Civar Stand.Apply with ref-erence to P.O.Box 849,Winston-Salem,N. >Aug.28 2t. with my name on back. be =apprectated,a.ALiAug.31.| Camp =Greene, cents per hour. Aus.31)Bt. sheats,|c. Aus.28 WANTED—Oid false teeth;don't matter ifbroken.*1 pay $2 to 815 per set.Send byparcelpostandcheckbyreturn mail.FF.TERL,N.Wolfe St.,Balti-more,Md Aug.24 4*, WANTED—Giris to wait in dining room atHotellredeti.Apply to MRS.JNO.HGRAY,Aue 21 FOR RENT—Storeroom formerly occupied bymFAllixon,RO A.COOPER, u@.2, SALE OF CITY PROPERTY. Ry virtue of a decree of Court of Lredeli county.rendered in a special Proceeding wherein Kred tL.Houpe et al arePlaintiffs,and Mary £Mentey et al.are de ts,the andersie¢ned commissioner will#08 at public auction to the hiwhest bidder,attheewurthousedoorinStatesville,No C..on MONDAY,OCTOHBR tet,191), at the hour of noon,they following deserthedhouseandlot,in the city of Statesville,to-witmningatastakeonsouthsideof Stackton street,about 320 1.2 feet east of the corner on fost street,and /fh.Hoeupe's cor fer;thence with P.R.Houpe's line south 49 dex recetve405 the Superior |Sree east 225 feet to a «take in Irvin's finetheneenorth45dewreesenst651-2 feet to astakeintheH.A.fost line:thence with‘s line north 428 |-2 degrees weet 218 feetteStockton«treet.thence with Stockton|street south 66 dewrees weet 66 1-2 feet to thening.of ante:One-third cash:one .thirdin@monthsandone-third in ic month:PRED.L..HOUPE,R BR.Metaughlin,Atty.Commissioner. ‘Pine Shingles $1.88 Car Just ‘atai.te { Bs ii beet «:'Get your wheat land in Good condition with one of our#1Harrows,ghfromaotWehaveafewleftthatwecanmakepriceon.They leave the ground soft IREDELL HARDWARE:CO, ~--—-OUR-—— NEW LINE OF TOILET SOAP 10c.and 25c.per cake. pn AP HALL’S DRUG STORE, PRESCRIPTIONIST. PhoneNo.20, ’ NEW FALL Our new Fall stock of Shoes forMen,Women,"Misses and ChildrenispreMosmanandvsaanpleasure in stating wehave the mostlineforFallthatwehave ever hadthepleasureofshowingyou. We will take real.pleasure in show-ing you through our very large andcompletestock,and are very anxiousforyoutoseewhatwehavetoofferinFallFootwear. If it's Footwear cailin and give usalook,always a real ustoshowyouwhatwehavetooffer, PHONE 83, SHERRILL-WHITESHOEC a ."- oerx é il a” ity 4 “:a a a ed Hoey Core Dee?Tare pory packeddepot,with ban-Montgome county,by coming in|Hobbs,Jo.86 acres ............. huazasresound-'contact with a live wire at the Troy |Lauublin,dno P..00mera +--+: ore and valleys,to Cross Arm Company.He wasom-|Groen:So Baeechooftneironsteed.”ployed at the company as carpenter.|Parker,R.B.,54 acres .............‘ Twenty -five minutes later a second w 4 Bivins,editor of the Albe-|Parker,Sam.,8 1-2 weree ...eee i :-po,FF.B.,OP QAMdD ow.eee.arle Enterprise,has quit the news-|Gdiaed. = light join in the fete”!Still a third traini )with hundreds.By thousandstheyitamefromIredellandadjoining cou “in wagons,carriages,horstback and ‘on foot,until the im- menge area was filled with a dense mass of human beings which no mancouldnumber,to unite in heart and)feelings in celebrating the most im- portant —_—which has ever hap- in this portion of our State.”Pew .Ww.w Allison was chief 1 and formed his procession in the following order:OrangeGuards,Hornet's Nest Riflemen, Rowan Artillery,Salisbury BrassRowanifleGuards,Inde s of the day,Governor andttsofState,members of the years. president and directors of the who was serving a 25-year sentence estern North Carolina railroad,in the State prison for killing a man, chief‘engineer and corps,officers cf was pardoned byhadn't been out ofrailroads,stockholders,con- tractors,visitors and citizens.TheprocessionpassedthroughCollege store.ave to the campus of the college|; and ‘then by counter march to the University has been appointed one ofchu(Presbyterian)grove.where the trustees of were made by ex-Governor versity Union of Europe,with head-, one:Gen.John A.Young of quarters in Parisjelubquartersfor American The attendance was estimated at sity men in military service in eause of the allies will be maintain- ed several thousand ravre and noth-|ed and all possible aid given institu-|tions,parents or friends in securing nformation regarding those in 15,000,the dinner would have serv-ing occuptedta.marthe dayANIMAGINARYVACATION. How the Man Enjoyed the Va-jeations He Had Never Taken‘in Reality. ly,leaned back in his chair andid,“Yes”!He said he had just rned from a two-weeks'’stay in néxt week for the const. rarely spends a week at a and yet have the rested look of meadows and green fields.Thenexplainedhisvacation.He didhavetimetoleavetheoffice,but kept imagining that he wouldfindtime.So he planned a delight-fy “to the mountains.He tookfishingtackle,several books thathad necessities of lite and proceeded train,by automobile and—afoot in the mourtains miles awayftowns,offices,—_telephones,ins or newspapers.There hetaleisurelytwo-weeks,fishingforthemostpart,eating a bit—andreading.Early in the morning he was cooking his breakfast by a campfireandwatchingthesunriseamongthemountains.In the heat of the |ippard of Catawla county was held Catawba Superior Court,after na hearing in the record- ‘r’s court at Hickory. mitted to jail in default of bond. day he was fishing in a little old ca-noe that drifted cown the creek among the trees.In the evening he was watching the wood-folk go tobedorgetup——for the night,as thecasemightbe.And always he wasbyhimself,no other person to be seen all day.And he did not have ~mail,not one piece of mail.Mf course it was al!imagination. letters,listening to the Jingle of thetelephoneandattendingtobusiness © erally.But he said he was great- ly‘refreshed,if it was only imayina-tion that refreshed him. Furthermore,he is planning atriptothecoast,a trip which he willnottukethissummer.He will spend«days out on the rocks with justhimselfandtherocks,the sky and sea.Lots of peuple who takelongvacationsandleavetheirimaginationathome,don't get half thefunoutoflifethatthismandoes. Sugar From Sorghum (ane. Mr.J.H.McElwee has read inaKansaspaperthatthey're making ar in Kansas from the ordinary hura cane,such as we have in'Tredell,and he thinks the processmightbedevelopedheretoadvan-tage,considering the high price of r.w th investigating.Probably theDepdrimeofAgricultureinWashoncouldgivetheinformation.Itisnot.supposed of course that thesugarobtainedbythisprocesswouldequaltothebestgradesofthenulated,but it would probably do*~» .ReportFoodonHand. Bince the Federal law requires sks of foods shall make returns of on Aoguet 31,the United StatesrtmentofAgriculture,charged carrying out the provisions oflaw,has designated certain places:each State where the blank paper job to become principalGreensborocityschools.merly taught school.;D.Bivins of Albemarle is the chiefowneroftheEnterprise. Marshall,Madison county,two hovs driving cows home from pas-ture,attempted towitha few bruises.Theother,Fred.Webster,had a rope at-tuched to the cow's horns around hisarm.When thrown from the cow he|was dragged some distance and his, rain from Salisbury,having ,,on Salisbury band,“6 vards,Rewan Arti! ;Orange Guards of Hillsboroornet's Nest Riflemen,“withsstreaming,the artillerypealingsalvosand=martial musicswellinguponthebreezetothede- ‘of assembled thousands whegatheringfromallquartersto Postmaster J. convieted of the murder of his wifeinFebruary,1914,sentenced to deathandlatercommutedtolifeimprison- ment,has been pardoned by Govern- or Bickett on the recommendation of the advisory board of parole,createdbythelastLegislature.investigated Bolepack’s case. Superior Court week Logan Meadows was convicted pendent Iredell Blues,Minna cadets.)of store-breakingsentencedtotheState prison for tenAfewweeksagoMeadows, prison 24 hours Prestient Graham the American Dectors Under 32 Drafted. Physicians under 3 are amenable to the draft for soldiers ‘The man who sits at a desk and |according to information received fron handles important -looking papers the War Department at Washinstonaskedifhehadtakenhisvaca-As the law now stands every physi-tipn yet.The day was hot and the cian who iv physically fit and underaptwashot,yet he smiled pleas-%2 years of age,is t whether his name has been called or The need of young physicians in themauntainsandexpectedtoleavearmyisimperative.Major Joseph € Bloodgood,chairman of the Southerrsitwasasurprise,for he is a man committee on National Defence,says.‘Every physically fit doctor 31 years from his work.t:e 1s one of old owes it to his country to be in the unusual men who work all the Medical Reserve Corp: .I of fact,he is a drafted man whetheraimanofiisure—of a man just back his number has been called or not.” awhile spent out of doors in The army calls for young physician: train of army life better than older men,and,as a rule,they are not held by so many family and fi chairman of the Statewantedtoread,and a few of ee ee blank:r meking ¢lienacortalytumble-down shack ee oe ich was on the vank of a North Carolina has net yet civen her quota but she ranks aheod of the as erage State in the nurber of men she has furnished the army In Trouble About An Auto. £500 bend for He was com- sith receiving the stolen goods,gave The automotile was stolen j ry and driven into Long Island com- munity,where The man was in reality in nis office "UMber of the machine were trans-all through those hot days,dictating ferred to Little's automobile. IRLS!WHITEN SKINWITHLEMON JUICE! Make a Beauty Cents to Remove Lotion For a Few tore or toilet counter will! orchard white into the face,neck,arms and hands and just see how freckles,tan,sal- roughness dis- skin hecomes havmless,and will surprise you NEW SEED BUSINESS. Turnip Seed in packages and in bulk. variety of other garden andField Seed. All New. T.N.BROWN. t all firms having commercial| t they have on hand or in tran-| Alison,Comer,14 acres .. Palla,Perey,4 acres ..... y-Renton,Mrs.C E.,77 meres ........-Combs,Felix,5 acres ’ Houpe,J.F.H.,26 acres Da ers Houpe,d.B.,so ne@pes «wee eeeHayes,Mre.P.A.,176 acres ........Hartness,J.F.,5 acres waees Hampton,Mrs.A.,Bet.,141 1-2 acresMoore,W.A..S8 meres .i aertreMoore,J.W.,45 1-2 aeres agNicholson,Miss R.B.,#6 1-4 acres...Nieholson,C.R.,50 acres recPressly,D.J.BL,25 acres Seott,L.FL,bs acres Sowers,Jno.,341 acres .... |Sowers,Miss Jane,192 acres Allison,Jno.,5 acres . Bailey,David,2 acresBailey,Victoria,15 acresBrocher,Ellen,5 acresColvert,Wiley,1 1-4 acre .. |Cowan,Julius,1 acre * Chipley,Anderson,1 acre .Davidson,Will,45 acres . Lynch,Dock,18 1-2 acres rg.Base,C.S.,82 1-2 acres .Brown,N.E..222 acresChester,Wo.L.and W.N.Summers 63 1-2 acres Farm,Red Crest,1,100 acres ,acres MeCoy,J.W..118 acres MeCoy,T.F.,108 acresOvereash,Mrs.D.W.,831-2 weres Tage,G.8.,(0 1-2 acres Voteet, Shepherd,Somers,W. Tucker,EB. Webb,J.W.,160 1-2 acies Christy,M.A.,104 Keres Gibson,A.A.,32 acresMaddin,Miss M.J..2)1-2 acres Menia,J.Y..24 aeres Milla &Moose,219 acresMitebell,J.W.,185 acresMurdock,Austin,82 1-2 acres MedLain A.,111 acresPhifer,J.P.,1-2 ereSmith,W.L.,97 aeresWhiting,Mrs.Annie,60 acresColored. Allison,Abner,57 acres . Avery,Hordy,4 1-2 acres Chambers,Arthur,1-2 acreChambers,Mack,1-4 acre Glover,Doras 1-4 acreGlover,Thos.1-4 aerePatterson,Foyett,1 acrePatterson,Herman,1 1-2 aere Verrson,Armps,12 acresPearson,Richard,1 acreRobertson,BD.7 1-2 aeres Smith,A.C..10 acres Stevenson,Jule,7 1-2)acresry.Patsy.5 aeres .Alex.2 acresland.H.D.,4 acres. |Chambers,Sophia,3 1-2 acres ray,Jno and Guess,22 1-2 acresHall,Lizzie,2 acresMcHenry,Lina,|acre White Delingurnts.Brown Heirs,105 acres .}Goodman,J.1L..97 1-2 weres!Plyler,Mrs.8 R196 acresGray.dno,22)1-2Lentz,Mrs.A Smith,Mrs Ro M.,Sryder,Mix Annie.Watt.No PL,suardian,1 acreBass,Mrs.W.R..87!acres Ss acres ’ Caddie Creek. Arthur K.W.,1 bot Barver Bros.204 acres Basa,L.¢»jots Benson,J.Fo 1 bet mn,WoO,d lot Brown,Wo AL,72 weres,3 lots rown,James W..22 lots Colson,AW 6 lots Cranford,N.F..1 bot Crarferd,A.1...1 botCraven,Fo M..299 1-2 acresDeaton,Zeb,1 det J.W..6 bots n J.1 het !shiids,J.OF.2 Jote Fleming,Ro B..1 lot ollett,J.©,1 bot Q ‘.Mrs.J.C.,2 hota ; coodman,Poo 2%aeres,1 lot Hombrivht Tom,|dot fart,DD.F i det Honter,BoD.3 lote ties feii barmers’Warehouse,2 lotsmn,J.H.,3 lote : Johreon,JW.HL.298 acres .. henneriv,X.PL.1 det oe heaner J.P.61 1-2 aeresKerr,Katie,1 lot 1 lot .Wo Wi bk bet! WS iets’... Patterson,Ro 1...150 acres Reid,I A..1 Int Robertson,Tom,1 lot Sherrill,J.¢1 let Shue,Mr Eien,1 botmp,HA.1 dot a Stotlinus,W.P.,1 bet .. Wallace,#lot Warren,J lot Woot W lots Youngs,J acres,1 jot Brown,Mos 147 acresCashion.M bet Christy,PG,estate,110 acres Davis @ Wiley Bank,194 aevesDearman,Frank B.,1 lot Cy.1 et herre (Va}betMatheson,James A.,1 fot'dno.M..1 letSmith,Mrs.Laura,27 acres Templeton,Grover,14 acres Vanderberth,,Mix,1 lotWagoner,LoL...2 lots Wileox,A 1 bot Brown.J 38 acresFertner,J 132 acres Hudson,Lee, Brown,Stokes,1°lotCampbell,Mattie,1 lotawford,Jennie Teors,34 acre ;Do dno,1 lot Enell,dim,1 lot : Praulkner,Jno.B.,1 lotFaulkner,Frank,1 lotKnox,Will,38 1-2 acres Knox,dno,1 lot Mills,Will,1 bot Murry.Franeis,2 lotsMurry,J.G.,1 Jot McRae,Tom,1 lotNeil,Allen,2.lotsPhifer,WIN,Jr.1 botRameey,Wm,2 lots Torrence,Charlie,1 lotWhite,Leroy,1 lot ..Campbell,Martin,1 lot Myrtle,1 lot.Capias,1 lotMoore,Arthur.1 bet|Moore,Charles,1 JotNewby,A.L..1 lot Osborn,C.A.,1 botPinkston,Walter,1 lot Titman,Jame,1 lot Knox,Jay,1 letJetton,Bid,1 lot ....Little,HC.66 geree ... Young,Walter,1 lot .......:Caneerd. st Bi acts |Hed he thteresJenkine,C,Sh, an ee(4s hern Power Co,30 geren.P12 3-4 aeres ¢GR BOBWD on.cece.Woods,RK.E.,%1-4 geres .......Colored,6.59.40.11 Baity Connie,3 aeres sister,16 acresacres viieon,Q HH.andvidson,Lemuel,2 .W.,1-2 acre yeutt,Mra.G.C.,White acres 198 acres acres «c n ow L 4 s. 1.8. 1 ia4ia o 3 ar e ek e Se 5 aS te 4.11 |Gilleland, ve r t 6.16 Marteel!,W Howles,Mrs.Jane 7 on e s Base,BR.A.,1 lotBenton,Mra.C.E., f ij acres.40 acresnerves,@ xerves »,28 aeresColored.Malinda,100 aeres . 10 aeres :hite Delinquents. 73 acres148)aeres Hardin,70 acres 23 acres BO aeres .18 acres acres neces nsemn,Z.OR.estate,1 detRobb,Iva,63 acres... lotTreusman,H.N.,60 acres. 110 acressvohnaon,J.O.,52 acres Davidson,Charles,Houston,Lewis,Remsowe,J.L..17 acres olored. 10 aeres New Hepe.Dichman,Mra.Naney,74 acres y.A.,$2 acres 213 acres »,1h acres ",25 acres .»687 acresWhiteDelinguents.on Olin.-Amanda,estate.4 acres .161 acres .36 acreseres 5 aeres-Logan,1 acre .acres M..20)aeres Reres acres acres nerves uere 1 acreTren 7 oneres 46 acres 197 acresHartneas,N.F..extate,34 acres hO acrestneres acres ‘ neresners,Miss Al and Tal,68 acres Colored. ey,Billy,estate,25 Keces acres res ,aerea !peresWhiteDelinquents, Lydia,26 acres 1o acres 65 aeres. Shiloh.acron 120)neres .205 acres ef)aeresHousten,BE.M.,estate, »35 acres... acres. y..43 acres acres »186 neresStewart,Mew.leabell,76 aeres . 5®acres 100 acres Colored.Clork,Frank,2 neresSherrill,J.A,,74 aeresStatesville (inside). lots ween ee 1 Peete tenes ween eeeeee aae e a c o e Be th o n eee ef Tete eee eens * +4 44 4 4 0 << 2s " a ;= ce s t e s e s e s BS c "a edeCe oeImperialFurnitureCa. Statesville Gas Light &PuetColered. 90|4.88)Wilson,6.84 Watt,1 etkesnes ‘Bailey,Annie and 3.05|Watt,Barnhart,Andy,ver,Ernest,1-2 acre ..4.88 |Weaver,Millard,1-2 aere Davidson,Nannie,1 lot ivay,Jno.HL,ft - SK MI A H AK SN SH mere s Seca meen Hampten,James, Howerd,Emma,Howard,Houston,Jobnavn,James,Kerr,Henrietta,Kimbrough,Will, Marsh,Susan,1 lot Sx s h s z e s Ktta,48 acres-.estate,103 acresOOMcos5 Se Oe DOOR Sekar.6MissCarrie,26aeres ....Mi 4 > MeLelland,W.P..1 lot.Nicholson,Josephine,|letPearson,Jennie, ~ ~ Sh K n e e sz e s e 2 z s |White,Joseph,1 lot oe . &=Woods &Carson,1 lot Statesvitle (Outside). Barnhart,E.J.en Barkley.H.A.5 acres Byere,Cari,1 let #8 |.23 Feimater,Nell,1lot ............00ee ot11,Petmater,M.8.A.,1lot ............4.48 Po a gee Oe eee eerricond Hh46Gentry,Mollie,1 lot .0 0...ee alOp|Miaiem,Mare,1 let noi cc cccceees 61.66 |Hampton,Lorena,1 let .............2.39AB|Hiren,Bae.W.,1 bet...ecco on G6 |Bree,Fa 1 bah wcceeceenens 2.44aeae8Oe6.84a8|G.,3 lots.Sets 92 ae |OM crest eaevsaes 1.87 83 |Seite 240 24}S58 ONG oe cea 1.41684)Di Serer cuits raters 2.06 6.462 L :ale AG isut eo a ate 1.28 6.90 Lgmem.Gawk,1 bet ............‘14s6.23 |Morrivon,Carrie,1 lot ..............61 Morrison,Emma,|lot ........Meas a I 26.96 |Mheeria,duo.1 bet ..........5...1.282.44 Murdock,Addie,|let ............#1Myers,H.C.,1 lot .......Steen:1.22 Myers,H.E.,1 lot :See erster!:1.227.89!MeLelland,©L..2 sere ..........3.66MeLelland,Guas.,1 lot .............1.22|MeNeely,Laura,|lot ......:1.22MeNeely,Jane,1 lot ................1.22 O'Bryan,Nancy,|let ..1 ;.Herman,|let .46 2. 5 Carre 1 WR icc ee ce .2.—tsse e es ‘|Caldwell,Ett C1 bot aw e cs ||Dellinger,B t— > Be e r e s nal Lyon,SC,Mo and M.,2 > on e “|Mayberry.8.Rt lot.Miss Julia A.,42 acres Statesville Devglapment a3)Keller,O.A.190 acres |Williams,D.8,Williams,Carric,Woodward,Roy W White Delinquenta. “|Ntexander,Mo C.,3 3-4 acres |Brown,Jesse and Annie,1 fot M.K.,30 nerves Cashion,Mixx Louise, - Colored. Campbell,Jim,10 1-2 acres 3.92Foote,Orng,37 meres 4.18 Gaither,Laura,55 acres...8.69Johnson,Frank,31 acres 7.38 Nichels,Diek,4 acres 2.37Turner,Geo,acres Q 2.12Turner,Rev.d..15 aeres .3.16 ‘Torner,Stokes,15 acres...‘rtFurnes,Sandy,5 1-2 neres ....2.61 Dalton,Cass,acre 5 on Current,BR.8.27 acres...3.338UnionGrove.Vennett,H.C.,123 acres 'ans 14.89 toumpbell,W.B.,80 aeres ..eae.6.08Cans,JM.8 1-2 geren ..reece 4.86FraleyHiroe,&Helmes,fl acre ......4.itCoodin,Mra.Catherine,7 1-2 acres 66 a,Hemrick,Mrs.Sarah,20 acres ...1.94Jurney,M.J,164 1-2 acres wens 20.7Morgan,Will,2 1-2 aeres ite 26 ‘Mullis,J.W.,80 acres Vata cele R14Mullis,KO OS,19 neree....ies 11.06Privett,Mre.Permelia,75 acres ....5.16 Redmend,Rubert,54 acres.4 447 Robertson,J.J.@6 meres .......,4.06 See,WW.OF ,8 ORR 68 ee cs 16.735ere,N.T.,119 acres mare 13.40 Templeton,Mrs.Mollie,71 acres....4.96Templeton,James M.,10 acres vas .-Templeton,J.C.,81 aeres to 13.76Trivett,Lev',48 1-2 acres...ae 4.78Walker,J.R.,60 neres eee yey 10.27Williams,A.,heirs,54 1-2 acres ....4.1WottenHeirs,98 acres .........65 5.76Freeve,D.L..1 Tot Goodman,M.R.,88 acresoo S Re s Se = 2e 2 23 3 22 s en @2 e r |eounty,N.C..im the sam eof 850,andc~ $2 8S 9OO ~MeLain,W.B.,1 lotPeLena,1 bot .....Pine Lumber Co,2 acres . bh,Chas,5 ou vas S2 S r s E A R S S S A N S S pt i ii a gi e s : bp + SF t? BO e P e m e i e Sa r Re e s l e a n , SR B S R L R A L SS N s wages,the will sell for cnshtotheKE-bh in Stateeville,N.C..at 12 o°™,on,SEPTEMBER34,1917,|ms Og ee eeSe |tral nant,deere”and efile ond of my nine edjlning JimGatton land on the south, —— o = =. Sh e e r HS E S e n c n - pe r s - > S2 2 a 2 co t Ce aka, FFPReeeeee 6‘theweee e eeetees thee eeneereeeeee cn.econ1seeneenens Sr ES h S g e e h a s e e s h e n s s e h se n s e er eereeeeeWs2.44|Wi 8.38 a ee e Sm a HE R S S L A S E R .Hall,1 lotReavis,Jno.,1 lotSeott,Maggie,|lot Simonton,Nancy,1 lot Spann,Jack,1 lot Stevenson,Henry,|lotStevenson,Rebecca,1 lotStewart,Jno.,1 lot Stewart,Sam.,1 lot A Stockton,Francis,estate,1 lot se E S t e e e e s t z e ts Stockton,H.8S.,1 let 3.0Summers,Malinda,1 lot .1.22Summers,Lettie and Lena,1 lot 1.22Summers,David,3 acres 6.84Thomas,Ellic,estate,3 acres .2. Turner,Will,1-2 acre ........3.Turner,Maggie,1 let ..1 Turner,Naney.|lot 9Warren,T.W..1 lot 3White,Arnest,|let 1.Wilson,Lewia,1 lot SB e a c e e s k e s Witherspoon,Mowrice,1 lot 1A'lisen,Tom 1 bot 8. Bennett,HOB,L lot 1. Holtsclaw.W.ML.1 tot 7.238 Howard,Wo AL,1 let wives 6.18 King,Beti,1 lot .uaTurnersburg.Doughit,Mo L..BO neres :Danner,J.A.1 were Fowler,8.A.TL 1-2 acres Ciieen Sisters,56 1-2 aeres Gaither,J.A.,28 neres ...Gaither,RL EL,5 aeresGaither,Wo L.,5Y neres ireen,C.OW.38 acres Galliber,J.A.TR acres (Grantield,A.Fo.1-2 acreHarpe,Wo ML,55s acres Mason,Roy,|acre Rarer eeriee Nichols,Rebecen,estate,21]acres. Strowd,64 acres eiirelessShaw,RB 1-2 acresSummers,J.W.,67 acresWest,©.J,45 aeren “MORTGAGE SALEOFLAND. Under and by virtue of the power and au-thority contained in two certain mortgagedeedsaxfollows,to-wit:Int:One mortgagedeedexecutedbyJ.A.Maiden and wife,LuteMaiden,to Chas.C.Tharpe,on tet day ofNovember,1914,in the sum of $146.76,and recorded in Book 44,at pawe 266;2d:morteage deed executed on the 30th dayNovember,1914,by J.A.Maiden and wife,Imin Maiden,to Elizabeth Guwyn of Yadkin af ThePresidentof Mitchell College has issued «call forseventy-five Boarding andone hundred Day pupils. Earnest,ambitiousyoungwomen from the age of to twenty will be in the firstcall. enlistmentwill takeplace at the Office of the College Wednesday,September Sth.The sacrifice will cost something butit willbe worth the price andmore. SuperiorOfficers will be in chargeof the training. The advantages will be great for the development of a richer womanhood.Failure to enlist will be a reproach. Bear in mind the date of enrollment,September 5,and the place.. Mitchell ,College. i 73 esi L i \there were so many yards of SMOMIOO cr POOL woe Your Hands| Are not tied from carrying out your ex- pectations and desires when you have moneyIN THE BANK. Your Bank,Account depends on whatyousave. It is not a matter OF GOOD FORTUNE. Acquire the saving habit while your in- come is small and it will be casier as your income increases to Increase Your Bank Account. Nowis the opportune time to open an Account with us. People’s Loan and Savings Bank. “MONEY MAKES THE WAY EASY.” GEO.H.BROWN :President. 0.L.TTURNER -Cashier. FOR SALE 206 acres,level,productive,red land farm,fronting quarter mile on the most travcled,public,sand-elay read leading into States- ville;nice two-story,frame seven-room dwelling,located in a beautiful grove;barn and out-buildings,fine well water,two branches;abundance of fruit;quarter of mile frum school and churches;80 acres in cultivation,30 acres in meadow,balance in woodland,part of which is inclosed in pasture.An exceptional opportunity to buy a fine grain and stock farm.Will take in part payment,small farm if well located. ERNEST G.GAITHER. Insurance,Stocks and Real Estate. |Phone 23.Satesville,N.C. pon SS ib ETEtei eede all PATRIOTISM *BUSINESS Every good citizen at this time shouldhissharetowardthe ee j <FHt nf —©North Carolina and a<# are located on the other side.electric car line. was in progress.werejerseverywhere.We had no ideakhakianywhere.And then a number ofkhaki-clad figures separated |rt from the group that comesandcametowardus.|were the tesville men who aretheLincolntoncai.There wereRobt.White,Henry Nicholson,PaulWard,C.L.Rhinehardt,Frank Fuller,George Feilds,Richard White,FlakeChipleyofStatesvilleandHughMil- ‘ler of Hickory.We,a long time fron:|home ourselves,were delighted te see 'the Statesville fellows,and they were anxious to hear “from home;”and the bulldog,the company's mascot,stood by and wagged his tail in high glee.All of the men locked browned and healthy.Some of them had reep-tibly lost in weieht.They said theyhadbeenworking.Then they told of wetting up in the morning at 5.30 ri eating brenkfast at 6 (and some of them told of their experiences as cooks).Then there was slways e@hardday's work,wheth:r it was rid- ing horseback,drilling or learninghowtodicatrench.And at 10 o’elock they all went to bed.Fridays,Sat- urdays and Sundeys they may cometoGreenville.And in Greenville theyar’treated royally.This place is in-deed a frieadly city and deiights inmakingstrangersfeelathome.Thecitymakeritapointtobegoodtothesoldie:s.All of the churches en-tertain for the soldiers,and the majorityofthechurchesmaintainread- ing rooms for the use of the soldiersNumbersoftheboysareentertainedinprivatehomeseachSunday.It is a familiar sight to see a motherly lady ushering two or three huskyseldiersintoherpewatchurch.You may be sure that there is a good“homey”dinner waiting at that lady's home fer those soldiers.Shelton Henninger,John D.Pat terson,Clarence W.Boshamer,Jr red from the Lincolnton cavalry te Company C,engineering corps.of the South Carolina troops.These young men are etationed at CampSevier.We did not see them,but the.other boys said they were in exeebe|lent health.They transferred to this:branch of the service because theypreferredit.They will probably seeserviceinFranceearlierthantheothertroopsnowhere.The Piedmont Battery arrived at Camp Sevier Sunday afternoon.Ma-jor General,John F.Morrison,com- manding officer at the camp,has saidthatheexpectsalloftheNorthCaro- lina troops within two weeks. Social and Personal Items From Cool Spring Community. Correspondence of The |andtmn:« Cool Spring,Aug..0..-Mrs.O-car |MeCarn and children of Alabama avevisitingherparents,Mi.and Mrs.P’.W.Swann.Mr.RO Paul LazenbyleavestodayforChapelHill,where he will reenter sehool this fall:Messrs.Mack Abernathy and Dewey Mocre teft last week for Richmond, Va.Mr.Paul Foster of Washington is spending a few weeks with friends‘and relatives near Cool Spring.Misses Velma and Mildred Reece,who ‘have been visiting’in Winston-Salem,jare expected home tomorrow.Mr.‘Clyde Yates of Cool Spring spentseveraldayswithfriendsinThemas-|ville, Miss Katherine Abernathy gave awatermelonpartyfortheyoungpeo-ple.We had some splendid music ,which was rendered by Misses Katie lou Steele and Lois Goode.After we were ushered out to feast on wa termelon. Miss Katie Lou Steele gave a porty.for the young people who intend leav-ing for school.One of the interesting features of the evening was a suitcaserace,which was won by Miss |Mabel Guffy and Mr.Robert StecleThe candy.There was some good sing- ing by the yourl®people,accompaniedbyMissSteeleonthepianoAfter‘that refreshments were served.The prayermeeting which is being‘held at Cool Spring academy is veryinterestingtotheoldpeopleaswellasthe,young.May God bless |young men who conduct these meet- ings. ,Gees to Navy Yard —Other ews,|‘Wrreenondenne of The Landmart Statesville,R-3,Aug.29shortrestthattofarmers af- jter crops are ed is rapidly\drawing to a close,as roughness-making time is right here.=;setae anoperationforappendicitisinStates-ville and is recovering nicely,as thejmaaetcomes.|r.Voit Kimball of Winston -Sa-‘lem is a visitor in this section,Mr.jand Mrs.Fife Troutman of Ashevilletehomefolksthisweek. |r. —The for Phi iaeteGes6ae > thejsionatWashington. Used ft.eraforinBe0ee6“Talabilcy,ook‘any me and Erskine Johnsoi;nave transfer-| the musie came the “best’time,for)3 were presented with a box of| the| to leaveSiat,where navyServiceCommis: 4* i afternoon |little |Shteh is stveseed Ss ieiaure.One cropis scarcelygath-, ‘Greenville.From the camp,jered until for another‘gn rolling hills jeeslt,we see Must begin,and jobs of buildingand ‘the mountain and the other |noah See buildings usually oc- [ountaina in thedistance,amt sins |¥..and before the aanceo|‘This section is needing rain bad! pected.The largest number of folks everfromthisvicinitywenttoBall'sSouthCarolinaticvagityoftheNorthcosaliies|reek campmeeting last Sunday.Ev ry automobile in the country wasimvse,and then couldn't take all who wanted to go.Automobiles werelinedupalmostaquarterofamile,weitine to be transferred at theLongIslandferry.There was a gathering of nonde-script humanity at this camprround. Some in search of spiritual help,butCupid,novelty and the pleasures theplaceafforded,seemed most in evi- dence.The sermons preached on Sunday were the very best.and it is to be hoped that although “sin abounded, grace did much more abound.”The cantata,“Indian Days,”givenbytheGleeclubofTroutmanHigh School,was highly enjoyed by pa-trons in the surrounding communi-ties.This Glee elub is the volunta-ry work of Miss Nella Rowe,who has given of her time and talent,outside of school hours,and withoutpayandbyherunselfishaccom- plishment has gained much for thesuccessofTroutmanHighSchool. Mr.R.L.Troutman was taken to Rillingslew hospital and underwent an operation for appendicitis lastSaturday.Miss Jettie Troutman en-tered Gibson's Sanatorium Monday and will undergo an operation while there.Mr.Gaither Ostwalt is at homefromBethune,S.C.,for a few week,’visit.Mr.Flake Clodfelter of Washington,D.C.,is visiting his mother,Mrs.M.J.Clodfelter. Auto Party to Blowing Rock. Correspondence of The Landmark., Mrs.J..W.Watts and =son,Mr. Will Watts of Taylorsville,gave adelightfultriptoBlowingRockFri-dsy in honor of their guest,Mrs.Harvey Boney of Rose Hill,Duplincounty.Those participating in theeventwereMesdamesJ.W.Watts,A.C.Payne,A.M.Edwards of Tay- lorsville,Mrs.Harvey Boney of RoseHillandMr.Will Watts of Taylors-ville,. Leaving home at 8 o’clock in the morning,two stops were made—one*Dadley Shoals and =enother at fenoir,before reaching the beauti- ful summer home of Mrs.Watts inPatterson.There,dinner,consisting of some of the choicest viands,was spread upon the expansive lawn. After dinner the party continued on the trip to Blowing Rock,where all the points of interest were view-ed .The return trip was made by way of Hickory.All of the cuests ‘oined in pronouncing Mrs.Wattsthemestcharmingofhostcsses. CLIP THIS AND PINONWIFE'S DRESSER Cincinnati Man Tells How toShrivelUpCornsorCal- luses So They Lift Off With Fingers. Ouch!!?This kind of rough talk wil’be heord less here intownifpeovletreubledwithcorns will follow the simple advice ef this Cincinnati autherity,who claims that a few drovs of a droge eatled freezonewhenappliedtoatender,aching corn or berdened clus stops soreness at ence,end coon the corn cr callusdriesupsad“ifts right off without pain.He seys freezone dries immedci-ately and never inflames or even ir- ritates the surrounding =skin.Asmallbottle0”freezone will cost very little at any drur store,but will positively remove every hard or soft corn or callus from one’s feet,Mil-lions of Americen women will wel-come this announcement”rinee the inauguration of the high heels.If your drugyvist ‘oesn't have freezone|tell him to order a small bettle for ore ~PARM NEAR TOWN For sale,76 acres.Good build- ings;well fenced and watered;high state of cultivation.Good road, 2 1-2 miles from Statesville. W.J.MASON, Statesville,R-4.Aug.21—4t". The Brady Printing Co. Has taken over from {|}R,P.Allison the |agency for various |Magazines and Book Publications and wants ‘|‘your orders for sub- ‘|seriptions to Maga-||ines of all kinds.Will ‘|order any book wanted. All Magazines on coun- ter soon as out. namite,breaking it up.That's whenyoufeelthatawfulnauseaand lar.cramping.Deodson’s Liver Tone isListentome!If you want to en-vegetable,therefore harmlessythenicest,gentlest liver and bow- el cleansing you just teke aDodsor'’s Liver Tone tonight. dvuggist or dealer sells you u 1-centbottleofPDodsen’s Liver Tone under eonnot selivate.Give it to your dren.Millions of are Ueverspoonful expenenced, of harm/easYour gereus calomel now.Yourwilltellyouthatthesaleof A Sells fat work oxen to butcher Mr.L.E.Standford,Wadley,Ga.,has been feeding work oxen Buckcye Hulls for over a year.He states that four of the:n got cc fat he soldthem tothe butcher, T8oe MemeVEE LINTLESS are not only concentrate’roughage free from linttheyarehelpfulalsoinwsettheycarrythemeal, best advantage and permit these fattening feeds toassimilated.Use Buckoye Hulls es we suggest and it easier to provide a perfectly balanced unt then with any cther roughage.And the feed much less. To sceure the best results and to cevelop the onsilagetheroughlyiwelvehoursbeforefeeding.Nt is easywettingthemdownaig!’and morning for the next feeding.this esnnet be done,wet down at least thirty minutes,Iffeedthefullsdry,use erly Aaif as much by bulk as of old Bookof Mixed Feeds Free Gives the right formula for every cornbinetionoffeeds in thehowmuchtofeedformaintenance,for milk,for fattening,work.Buckeye Hulls and gives ircetions for us.ag properly.Send for yourcopytonearestmill,pet.k The Buckeye Cotton Oil Co.oem.«4a:Gots"Sou _~eon “Restore this normal attribute oftableindependencetoisritheesteemofourworldofsocietyas as business.” This bank offers every opportunitysibletoencouragepeopletosaveand beTHRIFTY. A good way to siart is by openiag a sav-ings Account,if with only a small amount. Drop in any time we are always glad toseeyou. Merchants and Farmers’Bank.| Of Statesville,N.C. “The Bank For Your Savings.” Vodson'’s Liver Tone matead of dane — is almost stopped entirely here, wi n g , ee Fi ee ll i i MR \way d A bedspring that can’t sag because of the patented flex- ible hollow strand construction; that does not roll you toward the center because it cannot sag; that is absolutely noiseless,having nothing about itto creak or groan; that conforms to the shape of the body; that has no loosestreuds,open linksorsharpcornerstotearbed clothes. Quarter century guursatee,30 night's free trial. ernte ji n 5 For the Education and Culture of Young Women. Classical,Literary d Setentifie ©leadingtodiplomas.Geadustes credited ww State Recon Education for Teachers’Certificates.ial diplomas awarded in Music,Voice,Art andExpression,Excellent Commercial Course,Domestic Science. ;enempted by local board. mes Owen Woodsides,Loray,R 1,ex $exempted by localboard.Wite and children.Carl Chambers,Harmony,exempted;exempted by local board.Wifeundchildren. Alex.Clinton Beaver,Statesville,exempted;exempted by local board.Wife and children.Earl ©.Fesperman,Mooresville,exempted;exempted by local board Wife and children. dames Amos Sharpe,Statesville,exempted;exempted by local Soard Wife and children. Alexander Ross,Statesvillk er empted;exempted by local maid Wife and children William Thomas Christopher, Statesville, loeal board. exempted;exempted ty Wife and children William Herbert Tomlin,St ville,exempted;exempted by loca heard.Wife and children Palmer Alexander Morrow,} la,R-1,exempted;exempted ‘ board.Wife and children Leroy Cakdwell,Moore empted;exempted by local boa Wife and children James Carson, Hoeustonvs ile t empt#@d;exemptet vy local board.Wife and children,Clyde Graham Bus States exempted:exempted by local board Wife and children. fioward Gregory, empted;exempted Wife and children. Charles Dobbins,Obln,Red, Moores by local ou empted:exempted by local boat Wife and children Royal Gwaltney Money,Olin.R-1, exempted;exempted by loca ard Wife and children dames Samuel Overca Poore ville,R-5,exempted:¢«d local beard.Wife and renMarvinStimpsonCampbell Statesville,exempted;crxempte Jocal beard.Wife and children, Mason Edgar Brown,froutman, exempted;exempted by local ard Wife and children,Jubal Ransom Early,Stat le exempted;exempted iv loond board Wife and childre dames Frank Brown,Moore He, R-1,exempted;exempted local board. Harrison Nicaves Troutman, Statesville,exempted;exempted by Jocal beard.Wife and childrer Walte Davidson Brown,Moorevile,exempted;exempte:local beard.Wife and children. William Andrew Heath, States-ville,exempted;exempted by local beard.Wife and children, Louis Luckey,Troutman,cxempt ed;exempted ty local beard Wife and children. 'Thomas Jeffersar Statesville,exempted; local hoard Wife Herbert Herman exempted;exempted by lo Wife and children. Troutman, exempted —by childre n Pope,Tr and outmap, ab bowed Troy Garland Shoemaker,Eufola,R-i,exempted;accepted by local board.Wife.Clyde Erasmus Gaither, States-ville,exempted;accepted by local board.Wife. Fred.Hyarts Beaton,Statesville, accepted;exempted by Jocal board on aceount of underweicvht.Has wife. Arthur Morrison Steele, States- ville,accepted;exempted by local board.Physical disatility and wife Dr.Vanee Hasty,Statesville,ac cepted;exempted by local board Aged mother J.Sherman Ramey,formerly of Statesville,now at Long Island,Ca tawba county,was accepted by the district board.He claimed exemption on account of depeneents and physi- eal disability.Alexander. The board reversed itself in one Alexander county case.Psanc A ;Stafford,who wa refused exemp tion,was reconsidered and exemption allowed.Arthur Swan 9 Blankenship,who asked exemption as a farmer.wa refused. The board,which was in session Tuesday and Wednesday,adjourned Wednesday evening to mect at the eall of Chairman W.B.Gibson. South Yadkin Association — Church News. The South Yadkin Baptist Aationmetinannualsessionterday at Bethe!Baptist church,Fast Mon- bo,and will continue ';to day.A good many from Stu itl attended terday ane wil today.The delegates from the | Baptist church weer sir \\| Reece,H.Wo Cliftere,WR.Merrdl and J.M.Davi Re Dr.Ch \ derscor 'attending Archdeacon Hard:{S;ory will hel er ind adn ¢the commu to ul Dearest hy pal church Sunday morning at Vo o'clock Court Items, Re fore United Struts Comnry . er W.J.Lazen Trae i borr \ Isanc of Catawha county o:e300) bond to appear at Federal © answer a charge of ilheit ad Mary Hail and Jim Joh . @d,were before th Mm: @harivre of fornication ind on Charves were not sustdismi«sedChildren of Mr.tee Wood 4.BR.Wright,who live neigh Rell street,were before the n Wednesday for agreed to whipallowedtogo Another Application For Royal Areanum Receivership. A bill in equity is filed Wedne@ayintheFederaldistrict:court Boston,asking for the them :' appointiner of a receiver for the Royal Arcanum on the grownd that its funde had been impaired by unwise invest *.The bi charges that the orabheeomehopelessly.insolvent t it is unable to meet ite ob- is the second =receivershipbroughtagainsttheRoyinthevastfewmonthsfailedinthecourtsafter Waugh,Statesville, to Board, The lerol exemptior board has passed on the following additionalmensincelast$1112860,William Logan Hobbs, Mooresville,R-5,exempted;wife and hitdren2462-361,DeWitte Parks Elliott,Olin,exempted;wife and chikiren,YO16-—46R,Hugh Ivey Tomblin. Statosville,R-5,exempted;wife and children245-368.William Thomas Col- vert,Statesville,R-7,exempted;physical disability.1595--364,John Lleyd Elder,Eu-‘ola,R-1,exempted;wife and chil- ren,‘184 365.William Smith Thom-as,Statesville,R-7,exempted;aged ents, S68 Vidk«Lundy,Charle empted;wife and children. 03 867.Henry Peeples,States- accepted;failed to appear.”sum,Campbell,Olin, and children Queen exempted;wife so.369.Emery Harmon Del- Statesville,R-6,exempted; \children 370.Charlie Hampter Hen- Statesville,R-2,exempted;wife hildren. “1-371.DeWitte Talmage Jur- luoresville,transferred to At- Tre 372.Earle Fugene Gibson, yresville,crxempted;iependent Cleveland exempted; Sigmon, Ne,exempted:wife ata chil vt '(Lee Austin, ile,R-ti,accepted.No claim. ATé James Vanderbury, man,exempted;physical disa- Latta Little,Stat R-1,accepted;wif iS.James Reuben Mycrs, le,R-1,accepted;no claim it)The Chain ! cnee,Statesville,exempted;wife )children. TIT 3260.Emmett Lackey,States Ile,exempted;wife and child in vied J.White Move R-1,exempted;physieal disability2M382.Wm.McKinley Comp- on,Ostwalt,accepted;aged purents. 107%3835 Sam Stevenson Braw R-5,Mooresville,}exempted; ed parents a.384 Ralph Revere Mills, Stat ile,R-4,exempted;member leedell Blue i BN Hallie Gill Bennett, *t ville “e “ds;ne claim ss si Willie O'Neal!Dear man,Statesville,exempted;physical abslity 122-887.John Brown Marshall, tatesville,R-5,accepted;aupyed pa- 'ts 24H8 —-38x,Fred.Lee i Statesville,exempted;physical bility. 17 i0.--Bs Geo.William hiller, y Pout,R-l,exempted;wife |hiidrer “ay Jame Wash,Siatesville,R-6,accepted; Robert Bailey,States- accepted;wife Claude Hilton)|Forcaum, exempted;physical di S02 Bas Lee Franklin Rash, Olin,accepted;no claim if 4,H.B.Oveccash,State ‘pted:no claim, i 305.Carl Vaughan Ak Moor ile,Red,exempred;w ad childrer 2308 Julius Neely Kinenid Statesville,exempted;member Pi mo Battery 5)887.Coleman Anderson Deal, Riatesville,exempted;physical disa ity, Mm]Franc Edgar Trout nan,Statesville,RES.OX t fe and childre 1 300.Joseph William)Beas Mount Ulla,R exempted;wife Mdren -het hom Ensley Venova iit Mooresville,exempted:wife iw hile n. tod Laude TF.InmetS:exempted;member Mredmont Battery 11668.402 Aleir (a Tolbert, Moore i pted:farled to ap ear !|tt uh oH I wok recepteds no claim ‘ise 40%Samuel Tomtin.Har wemy :aged parent “it Riehaed Gaoley Woest teeville,exempted;ph al Yt i ‘Willi \W parent Soh i \\Harrison D\nit u nd WON.dou i ’ it \,‘:re 1 'i Dexter olla t ‘mpteds wife ie Ww m ot Harrres ])emptec pt i {‘ lit my !(hes }Oxetwal "|‘)ph ' i!(M Oxtwaltiaw mr Smith Whiff }I exenipt Cw 1 {DD (}VW h !empt de Chia }Lew )empr i chi!' ‘Willian ’r Phere Hlope,exempt 'and och, i}irth Var Overensh |exemy ph eal adi il Hug!1 i David R24,accepted:no clanm 'Wo (suria Shoemaker! {g exvempte wife andidrer 48 120,Lemuel Russell Stikeleather,Loray,exempted;wife and children n 187 121.Walter EW Sherrill,Eu foia R,-1,exempted;wife and chil- “renLocal and District Board Excmptions The local exemption board has sefarpassedon421menforthearmy' Tw the Batter of ——a ‘So muchhasbeenStatesvillepapers an extensionandnothingatthatItakethisaym why I think it a the corporate limits.Wewedmilesofroadsand that have never been imcomeofthemainroadslead say town the roads are very ile ter ‘than they were 25 years # sidewalks are exactl fields of corn all over town,right along the streets.Some of these small fields are in sight of the post- office and the business part of town. We have enough vacant land inside the corporate limits to out two orthreetownsofthesizeofStatesville 1,but so leng as the owners refuse to sell and will net improve their real tate,so long will these same lots and fields be cultivated. It is stated that the corporate lim- nave been changed fer 80whichweadmitistrue.We mught also say some of our lands in-side have been cultivated in corn and cotton for 75 years,and unless these aeant places are sold)or built up, corn and g¢otton will continue te show str We aie a verycommunity.My idea of b net Vears, angers ilding up wu town is to o something.Since coming toe town12yearsagoThavehelpedbuildthe Jloomfield Cotten Mill,Paola Cotton Mill,Bradford Knitting Mill,States- ville OU &Fertilizer Co.,lredell Tel- ephone Co.,and have also built the husiness house now occupied by the Carolion Motor Cy.;and have built neide and outside around eight to ten other buildings;also in a smalliyhelpedtobuildtheCommercial Bank.Yet Tam called aNational ack number and am being cursedindabusedbysomeofourcitizens :opposing the proposed extension, caused one placed mm a ay's work to a barre Ser of these erities for eors have dene nothing more thanvseatittle:lettuce ora bed of rad- ishes,yet have walked the streets rooting off their mouths continu. sly without saying anything.Let ts build up our town by building,net by wile talk.Help those who are ying.T would be glad te see any lumber of mills locate around town de the corporate limits.-We all iow this would help yvreatly those A}l of us who think,know extend the corporate limits inge incall the good for mills,will only prevent these built up and will keep who are trying and wish »do comething,from attempting ythi Y Same vem iby men who never rie on tone to be vulding or peave a lon tiens atte ACES vt rose oof us Con- mits Cannon to now has Yn ! town of corporate J.OW. whichthanConeord int 4.aGr BWer. State neo the 1 extended the Y this enused {Kannapolis adit e Yop t heer ‘ this help or h cord?Any bofnows the ar It the people of end this proposed nur to dive thousand acres of farmwiththecottenmills, of corn,cotton and wheat row,Where cotton manufacturing en- and will be built,if sition fails to car thle vote to line,taking in unds along ela will coutinue to vil other heuld prope i Bloomfield are The Fein school and the QOal are both in sight and n from the mills attend ]f wish to ask the cople of Statesville to help an uxt propositio: ive our town.Don't keep menufacturing oonting near town,Loask tl vote against exte rot help but injure all It looks to me that the hat are in’control wish te the necks of the 'wrors und the outside labo ro other reason than 1 out of them to pay make improvements it nt corporate limits,without ition of helping those pro in.The three cotter its sil pay to the United Star t nt for war purposes around }+dred thousand dollars for 1} ir HOLT.Is this not enough”?|) 1 to place greater burden mem extension?The textile i: hast the hope of the South.[bs h more mills located around If so,vote agains exte H.A.YOUN! i RMERS IN RALEIGH. N of the farmers from Iredell,so far as lonrned ‘he farmers’meeting in Rvrhtoisweek.Mr.E.S.Mill ; demonstration agent;Mr | saps,Jr,demonstration Clay county;Mr.R.E.Lawrences, lemonstration agent for Transylyaacounty,and Mr.G.BE.Dull,de stration agent for Tredell,ha: n Raleigh the pact week st dine the meeting of farm deme ration agents, PONT SPIT ON THE fio maver has issued the officers,and notice oF rmined te promiscuous It ix not only a fil of such detriment mayor will use h the nuisance people of Noo, Nsion mi to ’ Money »take WALKS.Instenetion The Ta the yu puta spoittanes asksittee ot bre fey uch walks 't,but that the to have dete lth abated vid has necepted 170 of this docertified them to district number board The district board has reversed the leciston of the loeal board in 24 thus far,granting exemption men who had been aceepted by the cal board.In addition to this the have granted temporary exemption »aceount of men being engaged inndustrialppreuitsthattheycannot well leave now.The =district boardeceeptedthreementhathadbeenirneddownbythelocalboard.So Var,the distriet board has passed onnearly150menfromthecountyandhaveacceptedforserviceabout125,This ineludes men who have joined military nies,districtboardyesterdaycertifiedtotheto-cal board 123 names iforservice,. ‘7? and ive they were. We don't“wa years agro,territory,but we do need to buildamthevacantlotsnowinside!We rural it hadaccepted | The Film of 1001 Thrills, Marvelous Different Spectacle, Real Romance-Heart Throbs. Laughs-Tears. —Th— Seven Reel Novelty That Has Startled Two Continents. Prices 10c.and 20c. service in dence patrons,“WE INSURE ANYTHING INSURABLE”and PAYALLHONESTLOSSESINCASHWITHOUTDISCOUNT.We will be glad to haveforanyifformation,or teneeded. Wedo NOTARYPULICworkalso. J.F.CARLTON,- you call at our officeephoneNo,54 if our Our Clocks Will GetThe Children To SchoolOnTime. \lonw with @he other ood lessons your children are tatsehool you teach them right in the home to betaLali PROMP| AGGUE cell —froin It pays in life to be PROMPT. acy is the thiny we demand in every time-piece weakitchenclocktofull-jeweled gold watch.boo you need a kitshen clock ont you want a inantel clock? Whieh one of your family desires a new wate!? Ack r boy.\yc R.F.HENRY,Jeweler. FOUNDED 1838 CHARTERED IN 1859TRINITYCOLLEGEDURHAM,N.C. A College of liberal arts with an established national reputation for high standards, traditions and progressive policies. low. partments,Schools of Engineering, noblettsInegeexdowmentfundmakespassibleitefirstclaseequipmentandlargefacultyofwelltrainedandcarefullychosenteachers.Comfortable,inexpensive reoms in carefully superivined hygienic dormitories,Classical and scientific courses leading te bachelor’s degree,Graduate courses in all de-Education and Law, Students feee Por catalogue and illustrated booklet,adAress R.L.FLOWERS, WEDNESDAY, SEPTEMBER 5TH. is a very important day for the motorists of this city and vicinity.It is Tiireews shall receive the benefit of expert information which is being given in all parts of the country in the great national move- ment for the reduction of lire expense. The free. exhibits for you to see, besides and inspection —better demonstration—is Many important expert advice than you could get any other time other way. or in any You are invited —no matter what kind of tires you use.Remember the date and the place. Statesville Motor ‘ed last year than ever before. |it yourself - | |di Secretary to the Corporation THE POPULARITYOF increases al the time.More of it us- Tryyou'll)know why.FUR SALK BY Lazenby-Montgomery Hardware Co. en Your Crops & Are the best they havebeenforyears.Alsoices.Give the wife amptolelpherwithher work, Myers Pump and repairsforallmakes. W.E.MUNDAY. Your Plumber,116 B.Broad 8t. NOT cas Commencing today we will discon- eICE! tinue the Jitney Service in the usualwayandestablishSchedulesontheerentprominentstreets.FirsttobeoperatedwillbealinefromBloomfield(at W.T.Sumpter’sStore)via Front Street’to SquareandSouthernDepot.This car willruncvery30minutes—on the evenandhalfhour.,Others will be put onlater.No Schedule on Sunday. RIDE THE JITNEY. JITNEY TRANSFER CO. Statesville,N.C.en eteaoamanemend DR.J.M.HOLLAND. DENTIST. OFFICE MILLSBUILDING, Over Mrs.Sims’MillineryGtore. Statesville,N.C. [nouns +ws "PHONE 81. WOOD.SAWINGAmtosawyourwood,seeme or If You Wanta Flooring that wont wor'’s cup,and }that won't buckle,