Loading...
HomeMy WebLinkAboutThe Landmark, January 1916McNeely of NorthtoAden,ished ’WhenunkinMedi- ubtiess:Work @’—Many Lives ely Was FromWasEnRouteto of Monroe, at cNecly 've sparished wher.the gh linet Persid was sunk in theiterraneansea,off:the Islund’of Thursday at 1 o'clock. news of the loss of the ship id not reach this country until Sat- ;und ay.Whether the vesse:was sunkyyasubmarineisnotpositivelyknown, aati5. Ithough it is ‘believed tia:an uni- bntified submarine was responfible.h is'said the Persia was sunk-with-out warning.‘Whe Persia carried 160 passengers,luding women anc@ehildren,and aof250to300.“Tt is said!thatabont153.survivors.who escaped infourboats,were landed at Alexandria, Bert,she including 59 passengers,of whom 17 wére women,and 94 mem-hers,of the crew.The last seen of leely,according to the survivors,Was in the water,and it is notlieved-he ‘was picked up.The onlyAmerican:among the’passen-so faréas mentioned,was Chas.Grant ‘of Boston.who was among he rescued..The first report statedtDowdMeNeelyofWaxhaw,Un- county,was with his brother and#among the lost,but this is de- fics i. Reports of the sinking of the ves- |are méager.According to thesepinwentdowninfiveminitesaf-rag were without ‘warning.There n@ panic and no.submarineWas‘sighted.although some of the)‘survivors think they saw the wake ofperpen‘A dispatch rom mr t +two boat loads of ©people Gwére drawn down with the steamerwhen:she sank,as there was to cut the ropes.Four boats Ly but it was:30 hours before i”Picked them up.Severalftbywithoutassistingref- afraid,presumably,of iy passengers,were throwna’ba versel heck. We A has been this shouldanAmericanridusnessofAmerica‘and hich “had been Pys ago by the an government he zncona.Wash- awaiting details e Persia before on Erich Zwiedi-Austro -Hunga- Washington,askswithhelduntilthewn.He says: Appened in many place,it is not yet bmarine ‘sank theinAustriansubma-termined whether -were such as to taken. at lea8t I hope,planation will be “If ine command- e disobeyed his in- ure my.government ‘o satisfactorily ad- rom the answer te on the Ancona vident.that the rovernment ~~will “tact which is a 4 tmation has been Neely,it is nowhate,was drown- eelywas born.inR3.His father and hers and at sister other suffered a last Wednesday freen told.of herh.Mr.MeNeely, e been an excep- i promising youngtourseattheUni- sensed ingil907.He jon const in bothegisiature.his last he State Senate of o.In w74 he tookfortheconsularappointed’consul.toHesailedfrom‘post November 27.ht several days®intohisdeparture.nds aia a the ip road but he tion lightly.He saidshipwentdownhealozsohecould is said ,that whenbndon,the Americattvisedhim,to¥sail for representations mikdefates,thé:French gov-ed the immediate nim subjects’recentlymericanshipsontheyeterichoruigerDes- poMtently but a few‘ow the steps ‘ofoodlenf,,No.clueseenin Vand “iNareotic Taxes * MR.CARL H.WHITE KILLED. 4ExpressMessengerFrom States:ville Meets Death in a Wreck. Express Messenger Carl H.WhiteofStatesvillewasfatallyinjuredand twelve other trainmen and passengerssufferediniuriesofaTessseriousna- ture late Friday night when the Southern railway’s “Augusta Spe-ial,”south bound trafn No.31,ran fas ar open switch at Shipman,Va., and collided ‘head-on with a_freight train.The express car of the pas-senger train,occupied by Mr.White,was.totall¥wreeked and his limbs were caught beneath the heavy safeintheear.The wéieht of another car was also on the sate,making it im-possible to liberate Mr.White until a derrick arrived from Charlottesville, e remained in a sitting posture with*his limbs held fast.beneath the safe for four hours.During this time he wa&conscious and |talked-freely. After being liberated he was removed to a hospital in Charzottesville,where he died Saturday morning 2t 10o'clock, Among the passengers inujred.in the wreck:were the following:Monia Hill,Catawba,;and Rio “Hickman, Charlotte.Ae Mr.White’s body arrived in States- ville on the early morning train Sun- day and was taken to the home of his mother,Mrs.Lola White,on Allison street.Mr.J.BE.Skaggs of Char- lotte,local superintendent of the ex- press company,and Mr.E.Morris, express route agent at Charlottesville, accompanied the body to Statesville. Funeral services:were conducted at the residence Sunday afternoon |by Rev.S.W.Haddon,assisted-by Rev. J.H.Préssly,and the interment was in Oakwood cemetery. Mr.White was 20 years old and had been on the road as express mes- seneer since last June.For a time he had a rity between Charlotte and Taylorsville.Since October~he had heen running between Charlotte and Philadelphia on the special.Two years avo he was for a time connected withthelocal“express office.Mr.White visited,his mother last week,going back to his work just two davs before he was injured;His mother has been prostrated with grief since Saturday, when news of her son’s injury reach- ed.her.Besides his.mother Mr. White is survived by a half.brother, Mr.I.H.White,of the Vicinity of Statesville. President Returns to Weshigg- _ton-—QOther.Vessels Sunk. President Wilson ‘will return to Washington today from.Hot Springs, Va.,where he has been since his mar- riage on the 18th of December. Secretary of State Lansing has in- structed the American ambassador atVienna.to.ask the Austrian govern- ment for any information which might establish the nationality of the submarine which is said to have sunk the Persia and°which would de- velop the facts in the.case.It is stated that the Persia carried a gun, and this may or may not figure in the matter. Two British steamers—the Oswald and the Glengyle—have been sunk, presumably in the Mediterranean. There are no details.The Oswald was in the service of the British’pov- ernment...The Glengyle was a_passen- ger steamer en route from Shanghai to London.It is reported that ten lives were lost by ‘the sinking of the Glengyle. A squadron of Japanese warships has been ordered to Suez canal,pre- sumably to protect Japanese shipping. Poultry Show This Week. The Iredel}:Poultry |Association’s fifth annual show takes place thisweekinthe‘store room on ,west Broad street,adjoining the-StatesvilleGroceryCo.The coops were placed in the show room yesterday and the entries are being placed today.All birds and pet stock for competative exhibition must be in the show room by tonizht.The judging will begin tomorrow morning and the show will be opened to the public tomorrow af- ternoon and will remain opén through Saturday.An admission fee of ten cents will be charged.Indications.are that there will be a.fine display of poultry,pigeons and pet stock,‘the pet stock’and pigeon deparvment being a feature.The public is not only invit- ed;but urgedito visit the show room, If the poultry associationgis to ‘sur- vive another year the public must show its appreciation of its efforts to further the poultry industry in the county.The breeders of the county are showing more interest this year than usual and there is a large number of local entries. Revenue Collections for Decem- ber. During December Gollector Watts, of this district,collected $937,688.21 internal reveriue taxes,as follows: Tobacco ;$925,539.75 Emergency 9,991.96 Income.Taxes 1,460.62 Fines and Penalties 440,49 Liquor License 141.68 Oleoraargarine 91.50 22.21 This is a decrease from last month of $62,098.50 and.an incréase over December,1914,of $336,36949;or 56.9 per cent, For the half year ending December $1at,the collections have.been $5,- 914,435.72,an increase over the cor- responding period of last year of-42,~ 201,221.54,or 62 263 per cent. The Statesville friends of Mrs.Sal-ie F..Watson’will *be .interested to know that shevis now reporter on the moe Rapord,Hickory’s daily.pa-Rae or daha Seba yy saa!oF,* WILL MEET AGAIN Commissionersto Decide Impor- tant Matters Then —Jurors For Next Court,* “Mr.‘Aaron.A}Sherrill,whose crit-ical illness has ‘been mentioned,died Sunday morning about 10/o’clock atbishome,the,Henry House,on southCenterstreet,death resulting from Bright’s..disease.»Funeral.services were conducted at the hotel yesterday morning by his.paster,Rev.J,_A. Pressly of the First Associate Re- formed church,assisted by Rev.S.W.Haddon,and.the burial was in Oakwood,cemetery..The local lodge of Odd Fellows,.of which Mr.Sher- rill was’a member.had charge of his burial.Having realized for some time that his case Was hopeless,Mr.Sher-rill had arranged-all his,business af- neral arrangements,Dx Mr.Sherrill was a native of |thi county and was 61 years old.He was: Miss Caldwell of Catawba county;and for many years we resided in Ca~ tawha county.Fourteen years ago he married Mrs.Lyons of Statesville,who survives,and-has since lived here. He was for some veurs in the restaurs ant business in the (vicinity of the railway station and was widely known. in that.capacity.Surviving are his father,Mr.J.Arlington Sherrill of the vicinity of Shepherd’s;.several brothers and sisters.and the follow- ing.named children by his first mar- riage:Mrs.Louis Love of Statesville and Messis.Rockwell,Floyd,-Roby, Ralph,Bonnie and Everett Sherrill of Catawha county.Suryrving also are three step-children,Miss Carrie Ly- ons and Mr.Lento Lyons of Sitates- ville and Mr.Otis Lyons.of,.Atlanta, Ga.Mr.J.A.Sherrill,who is 92 years? old,was here for his son’s funeral. Mr.Lazarus Hayman died Friday at his home in Charlotte,from the cf- fects of paralysis.He was a native of Germany,69 years old,and had lived in this county 42-years.Soon after coming to America he located in Statesville and was %n business here several years,Mr.Hayman is sur- vived.by his wife and six children. Mr.J.T.Q.Alexander,father.ofMr.Neil Alexander of Statesville, FRIDAY, fairs and made requests as to the fu-|bags twice married,his first wife being af. STATESVILLE,N.C.,,TUESDAY,JANUARY 4,1916. ASSOCIATED CHARITIES. Organization ‘Launched at the Meeting Sunday’Afterncon— Committees Appointed. The purpose of the mass meetingheldatBroadStreetMethodistchurch sunday afternoon at the call of the‘Ministerial Association,was accom- Dlished.The Asse ed Charities of Statesville was or ed,in accord- ance with a 1 olitlined and recom-mended by #@emmittee appointed by the minister mG fad given the mat- ter much con!ation and had made investigations Into the plans and methods of the associated charity or- ganizations of quite a number of oth- er towns and cities.: After being explained by Kev.John ¥.Kirk and Rev.C,By ®aynal,and after some discussion by other mem- of the assembly,the following ecommendations of the committee ere adopted by sections and then as &whole: 1.That the citizens of Statesville establish the Associated Charities or- ganization for our city. 2.That a board of directors of 15 members be elected by the citizens of Statesville,ten of whom shall be men. Tn addition to the above members, the mayor and city physician and the chairmen of the department commit- tees under the organization shall be members of the board of directors ex- afticio.8.That there -be provided the fol- wing committees:Three department eommittees comnosed of five mem- bers each,as follows:Benevolent and relief,visiting uurse and juvenile fourt,a canvassing committee of eight members and an executive committee made up of the president of the board of directors,the secretary and the chairman of the department commit- tees.4,That a salaried secretary be em- ployed for at least part time,and that the secretary be required to keep office hours for a specified time each day.For all-this work,including the vis- iting nurse,it is estimated that at least $1.800 will be required.It is éstimated that about $1,600 per year has been expended for the work in the past.A list of persons suggested by the committee ‘for ‘the board of directors died Saturday night at his home in Alexander county.The funeral and) burial.took.place yesterday at Elk, Shoals church.\Mr.Alexander was 80 odd years old:brid “is -snrvived:bys hl wife“and seven children. MR.e A.A.SHERRILL DEAD. Mr.Hayman,a Former.Resi- dent,Dies in Charlotte—Mr. Alexander Dead. The county.commissioners,in ses-~ sion.yesterday,drew jurors for the term of Superior Court which con- venes on the 31st: First week—J.H,Miller,D.M, Gudger,C.B.Ostwalt,H.C,Bennett, J.F.Orren,J.D.Cook,R.F.Sloan, H.S.King,W.A.Renegar,J.Ross White,J.W.-Summers,J.B.Coley,J. H.Postian.T.O..Hoke,J.C.Lambert, C,W.Williams,W.D.Tharne,P.W. ‘Swann,A.D.Goodin,F.M.Aber- nathv,J.M.Rogers,G.W.Stikeleath- er,J.W.Overeash,0.C..Morrison, KF,G.Stevenson.M.L.Branch,J.H. 3rawley.A.C.Plyler,M.L.Patter- son.T.QO.Sherrill,M.A.Wooten,J. L.Shimpock,M.B.Hager,-R.E. Beaver,C.D.Dingler,J.P.Haves. Second week—R.J.Stroud,W.A. Massey.L..M.Edwards,R.I.York, 8,W.Harbin.W.W.Bobbitt,T.V. Jailey,A.A.Murdock,A.M.Litaker, H.B.Ritchie,W.W.Hair,R. Cass,J.E.Moore,G.A.Tomlin,J. D.Ingleburt,R.R.Goodnight,O.N. Mize,E.H.Stevenson.J.C,.Trout- man,M.W.Smith,J.W.Deal,J.F. Waugh,W.R,Stevenson;C.A.Trout- man.; The board adjourned to meet Fri- day to consider the question of med- ical inspection of school children,and confer with representatives of the board.of commissioners:of Catawba eounty and the Southern.Power Co. relative to the building.of a bridge over the Catawba river at Lookout Shoals.Dr.W.8.Rankin.secretary of the State Board of Health,was be- fore the board on heaalf of the med- ical inspection of school children. te On Gambling Charge-—Court. Henry Bennett,‘Hal Bennett,Robt. Bailey,Buek Brown,Chas:Allison, Isidore Allison.Pervy Houpe.Hub McLelland,Jo.King and Lee Eccles, all colored,appeared in the mayor’s court yesterday to answer /a charge of gambling.™There was no.eviderce of actual gambling,but the ten were eonvieted of disorderly conduct and “imlawful assembly for the purpose of gambling.”Judgment was sus- pended on the payment of the costs, which amounted to $3 each,Officers found the negroes in a house on Steele street Saturday night, Tom Massey was before the mayor to ar .for ‘shooting within the corpa:.«ce limits.He plead guilty and was discharged. Bynum ‘and ~Hilliard Souther of Wilkes county were given a prelimi- naty hearing before United States Cimmissioner Lasenby yesterday oh charges,of retailing,Bynum was held under $800 boyd for his appearance in Federal Court att Wilkesboro and Hil- liard,his son,was released.It was at the home.of the Southers that the officers found @ barrel of,peach bran- dy.ae : Will Domel of the Flat Creek sec~- tion of Buncombe county was.shot and killed Saturday when a gun held by BlbertgWenver was accidentally discharged,: was elected as a whole as follows:R. R.Clark.J.Gi-Shelton,.B.F.Long,Ww.A..Thomas,Dorman ‘Thompson,),M.Ausley,L.G.Wagner,Wiliam Wallidé.©.BY Staniev,Cy-M.Steete, Mra.Jehn FE.Bowles,Mrs.J,B-Arm- field,Mrs.C.V.Henkel,Mrs.T .D. Miller,Mrs.M.F.P.Troutman. Members of department.commit- tees were nominated by the ‘commit- tee and elected sas follows:Visiting nursd-——-Mrs.Charles Anderson,Mrs. R..V.Brawley,Miss Mamie Adams, Mrs.R.E.Nooe,Mrs.¥¢H.Pressly; benevolent and relief—Mrs.A.L.Co- ble,,Mr Orin L.Turner,Mrs.L,.Har- rill,Mrs.J.F.Anderson,Ma,R .R. Clark:juvenile cnurts-Rev.J.H Pressly,Mrs Vera B.Jones.Messrs. Dorman Thompson,W.L.Gilbert and J.B.Armfield.ey Messrs.R. R.Clark,|DormanThompsonandi,E.Stanley were named as a committee to prepare a charter for the organization. The mass meeting was not so large- lv-attended,but it-was a-representa- tive audience,composed principally of those persons who have been identifiedwiththepubliccharitywork‘of the community and who are dlways ready to give their support to any move- ment for:the betterment of the com- munity.Mr.Z.V.Long was chair- man of the mecting and Mr.W.L. Gilbert secertary. Russian Offensive—News War Zone. Russian advices indicate a power-ful offengive movement by the Rus- sians in the campaign in Galicia and Vothynia:along a front of nearly 200 miles.The Russians have made-con- siderable progress and their,efforts are considfred as tending to relievetheSitiationintheBalkansandlikely to have an influence over the future attitude of Rumania. There has béen no fighting in the southern part/of the Balkan peninsula and at.Salohika the Kentente Allies have made(good use of the period of quiescence \to add to their defensive position./The British have transfer- red seme froops from Salonika to Ofa- no,2 small Greek port 60 miles east of Salonika,with the intention of thus checking any possibility of a hostile advanee from this.quarter.A second landing was made by the French on the Greek Island Casteleroso,off the ‘southeast coast of Asia-Minor,not far from Adalia. In the Dardanelles,Constantinople reports continued engagements in which both land and sea forces took part. It ig announced that ‘the British cruiser Natal was sunk after.an ex- plosion,but the location of the vessel and the particulars of the disaster are ndt mentioned.The.loss is generally attributed to foul play. Basketball. In Saturday night’s basketball came Statesville defeated the Y..M. G.A.team of Charlotte by a s¢ore of 26 to 30,A good crowd ‘enjoyed.the eame,which was one o”the best,of the season,Following was the 'Iiie- up:Charlotte —Crook and Corbit guards,Bobbitt center,Wyatt and Davenport.forwards;Statesville— Anderson and Newman forwards,Eth-~ eridge center,Guy and -H.Brady guards.a Statesville goes to Charlotte Thurs- day for a game with the Y.M,C.A.ilnyers Thursday night.‘ i* .|pounding if absolutely necessary. mya INDUSTRY AT »TROUTMAN. New Enterprise BusinessChange—Local News. Correspondence of The Landmark, Troutman,Jan.8.—One of the nice little manufacturing enterprises «to be started up here.within the next two weeks will be a wood working plant, which will turn out dressed lumber, mouldings,pick and axe handles. This little industry will be started up by our good citizen,Charles Ll.Clark. dust such an enterprise is badly needed. Mr.J.W.Johnston has sold his mercantile business here to Mr.J,L. Arthurs,who operates a general store at Belleville.Mr.Arthurs will con- tinue his Belleville store,which will be in charge of Mr.Fred.Nesbit,and will move his family here within a couple of weeks and take charge of his new business.which will be con- tinued in Mr,Johnston’s stand.Mr,Johnston began the mercantile.busi- ness here 12 years ago.His many friends’réeret his’retiring but heneedsanddeservesares:Mr,Arth- urs was formerly in business here with Mr.Johnston and is also popu- larly known and liked. Mr.D.BE.Thomas,who has resided here for a dozen years,moves today to Barium Springs,where he will have a position with the orphanage.There’sonethingcanbesaidaboutDan. Thomas.Instead of leaving here ow- ing everybody he leaves with most ev- erybody owing him.If not in dollars and cents then for the inspiration ab- sorbed from his everlasting good |na- ture and.friendliness.Sometimes when things looked dark to him he would rear his shoulders and laugh adeep,hearty laugh aid you could tell that laugh was coming up through a elear conscience and a good diges- tion.The Lord blessed him with one talent.He is delivering up two, Mr.and Mrs.Van D.Patterson and the-junior member of the firm,Vando- rin,junior,aged four and a_half months,spent a few days here last week at the Patterson home. Mr.B.G.Allison,who was married last “week,will move to Statesville this week,where he will make his home. The local camp of Woodmen gave an oyster supper Friday night,whichwasareal-enjoyable affair.TheWoodmenarealittlepeculiarinsome respects.When they give a blowoutinsteadofhavingitallintnefamily they feed everybody who comeslaroundofwhomthéycanpickap. spent the holidays at the nome of hisfather,Mr.John Clark.He returned to Knoxville Friday.Mr.Rock “I. Johnston,who has been traveling in Tennessee,is home for a short stay.Rev.J.L.Morgan of Columbia,8. C.,preached at the Lutheran church here last evening.‘ The new Methodist minister is nownicelysettledintheparsonageready to receive friendly calls and to take a Wallace Bros. Trade,i The Wallace Bros.Co.,the fwholesalehouseinthissection-of the State,announces its.prepared- ness to supply the trade.The handles dry goods and notions .andmakesaspecialtyofSouthernmade goods.The stock for the.spring trade is much larger than usual and was bought before the recent advance in many lines,the advance being due to scarcity of dyes,etc. The.Wallace Bros.Co.has long en- joyed a fine trade in this section of: the State.In recent years and espe- cially within the past year,the busi- ness of the company has increasedlocally.This is due to the fact that the house handles the goods the tradewantsandmakesit.to the interest of merchants in this section to buy in Statesville. The jobbing trade is becoming more localized because retailers can get supplies more promptly from local jobbers and keep their szock fresh, while at the same time they save in freight.In otehr words,when a retail merchant in this part of the State ean get goods in Statesville for the same money,or less,than he can buy them for in the distant cities,it is a mat- ter of business for him to buy here; and all this tends to build up home enterprises and.help home _people.Our people are’learning this lesson slowly,but it is gratifying to know that it is being learned,and the Wal- lace Bros.Co.is prepared to helponthiscommendableworkbysupply- ing more customers this year than ev- er before. ‘Co.—Wholesale o Governor Denounces Freight Rate Increase. Governor -Craig issued a strong statement.relative to the North Carolina situation in the matter of the application of the new freight tariffs from Virginia and North Car- olina points of origin into Southeast- ern territory,effective January Ist by order of the Inter-State Commerce Commission over the protest of the North Carolina Corporation Commis-sion,in which he declares that North Carolina shippers.are,“getting it in the neck going.and coming,”‘and that unprecédented activity .and develop- ment leave not the least.bit of excuse for incréased freight rates at this time such as the new schedules are fourid to contain.The Governor main- tains that the 1914-depression has passed and that the business of —the railroads has so inegeased that there is no warrant for‘the’iheréase \in house |- freight tates.The rates also discyim-|, BRIEF ITEMS LOCAL. —Box supper at River HilSaturdaynight.Proceeds folofsehool, —-Box supper at Elmwood —schoolhouseandKestlerschoolhouseFri-day evening,j AEs —The graded school resumed yesterdayandthecollegewillresumeits sessions tomorrow.x—The Iredell County Farmers’Un-ion will meet at the court,houseurdayat10.30 o'clock.ee —The next term of Iredell Superior:Court begins on-.the 31st and ‘Ferguson is scheduled to preside, —The New Year was given eusualnoisywelcomeinStatesFridaynight,by ringing of bells,set- ting off explosives,ete.(Ma Collector Watts will be aasmokertobe.given by:the iCityclubin.Winston-Salemmonthandisbooked:for address: —Mr.-Gus.Lewis,who”was’illwithpneumoniainaCharlotte‘hial,was brought to his home here Sat-urday.His condition continues to im- prove.:Sa.—The Landmark has.no ¢alendars.This for the information of temanycallerswhoask.for them.Calendarsareexpensiveandtheydonot:seemtobeasplentifulthisyearas —Mr.S.A.Foster and famispentlastweekinCnhariotteMocksvillewhileMr.Foster's pof,business on Colirt street was herenovatedandimproved.|In..Mo ville they |visited Mr.’Foste rents and other relatives. will bé seen the real musiceree—“Don’t Lie to Your,Wifdaynight“The Chocolate Solthemuchtalkedofcomic.opera,be given.This attraction hagpopularwhereverseen. License has been issued:for.marriage of the followin:couples:Fielden.C.dViolaAlexander,Wm.SylvesterlerandMissMartha.Leona FBArchie:Alexander and Miss Mayfield,Wm.Franklin Siimmers Miss Estelle Honeyeutt.-.Agent—Division PassengeroftheSouthernrailway| the proposition to’make €]stead of Mooresville thethebranch‘line of the Sou way from Winsto em.ville,was considermonthagovand -.My.Percy Clark of Knoxville,Tenn,E _+=Mr.Rosstohishomehere’rc]C.,a few months ago,and’peAsbeenwiththeSanitaryBarbewillgo.back to Rock Hill this weekresumehisformerpositionthere.family went to Rock Hill lasttovisitandwillprobablynot:to Statesville.ho ei An attempt to break intosafeoftheIredellFarmers’VUWarehouseatBloomfieldwasSaturdaynight.The combthesafewasbrokenand’thetwistedoff.A.‘y pipeleftbeside’the.safe,+suphavebeenusedbythewou!ber.in his efforts to breakSafe,aon bo ; —Mr,P.P,Purnell,who secertary and-treasuvilleIce&Fuel Co,s zation,will within a”tcomemanageroftheofficeplydepartmentoftheCaroltorCo,,succeeding Mr,R.HyThechangewill’not.taketheCrystalIceCompany.Salem,which pureStatesvilleiceplant,takes” it.Bene at~The:board:of education,regular monthly ©sessionOnaccountoftheabsenceW.Lowrance of.Mooresville,ber of the board,who isillp littnesswastransacted.Mr..C.nelius resigned as attendanceforDavidsontownshipandMr.|Harwell was appointed his.‘suceTheboardadjournedtomeet,with UcountycommissionersFridayto”.sider the question of medical inspec:tion of schools,~‘te * residence on.Stockton:street.foJohnT.Holland of Cool Springship,who will move to town this’ and occupy it.Mr.Leonard,who withhisdaughter,Miss.Janie Leonard;spent two months in Kinston and ington.with his san)and®eMr.John B.Leonard and,MrsSwaim,respectively,will,duringremainderofthewinter,dividetime.between Statesville ©andbury..Miss Leonard —wit,present,make her home jh:with her sister,Mrs.H.1,i Engineer Killed, Engineer John J.Clark:was killed,Fireman ©.Kn pher.of Asheville,was badly and several passengers susnorinjurieswhentrainNo. Murphy,division,struck a. near Barker’s Creek,about 62 from Asheville,Sunday,morr 11.30 o’clock.‘The enginey‘completely over and thederailed.the other ¢ars® the:track.:: Engineer Clark wes cautheengine.Hehad been onabout25yearsandwasrailroadman,.0 ® Tho BrookfordorywassoldA.Dy Juliard &Cprincipalistoetheamoungear inate against,Nofth Carilina points in faver of Virginia cities,* * get oe 4. —Mr.J.S:Leonard has:rented hisMr. howVv cor-has figured —hoyknow—that ‘the totalofthepeopleof‘the United |about $35,000,000,000 a‘this,$10,000.000,000 is de-agricultural products,$2,4minerals,and $10,-O,from manufactured arti- **©a ‘publican pow-wow:held _inursdayex-Vice Presi-Fai 8 was not only endorsedasIndiana’s choice for the Republi-san presidential nomination,but heasoliddelegationfromKentuckybyEdwinP.Morrow of thatState,who proposed the name of Mr,-Fairbenks..The former Vice Presi-‘dent spoke briefly and didn’t saynay, *** Dr.W.H.Doane,who died recent-dy atthe age of 83 and whose deathoolittleattention,was the au- or of some of the Gospel sorgswhichhaveattainedworld-wide pop-ularity.“Safe in the Arms of Je-sus,”“Rescue the Perishing””and“Tell Me the Old,Old Story.”were products of his pen.An interesting“statement is that Dr.Doane,while i eectDeniesAlmostTotal Responsi-bility But Has Punished Com-mander and Will Pay Indem- nity.=The Austro -Hungarian ©govern-ment has answered the last AmericannotewithreferencetothesinkingoftheItaliansteamshipAncona,onwhichAmericans’were passengers.Giving ‘What it says is the result’ofitsinvestigationofthesinkingoftheAncona,the Vienna governmentholdsthattheAnconadisregardedthewarningofthesubmarineto.stopahdtriedtogetaway.Sixteen shells were fired at the Ancona and threehit;the vessel finally stopped.withthepassengersinapitnicandboatswerolaunched;the submarine com-nder waited 45 minutes and,as it qa not appear that proper effortsWerebeingmadetogetthepassen-eérs off,then decided “to torpedo theship.in such a manner that it shouldremainaconsiderabletimeafloat,inorderthatontheonehandtheget-ting of the people into the life-boatsshouldbehastened,and that on the other,adequate opportunity should remain for rescuing the persons still aboard.”Another vessel was sighted and operations were hastened,Ample|time Was given,it is alleged,to savejall-nboard the Ancona and the crewlofthatvesselisblamedfortheloss oma nihil ay | *\PON ODES A i HIE feemen Learn ineet (eeeepee q ’Happenings Here and There in _the State.Mrs.D.A,Fox of Gastonia,ap-varently,mentally unbalanced,_at-tempted —suicide.by slashing’‘herthroatwitharazor, Mr,Jake.Newell,a well knownlawyerandpolitielanofCharlotte,and Miss Fannie Black of that cityweremarriedlastweek. The Raleigh tron Works,which hasbeenmakingshellsforthegovern-ment,is bankrupt.‘The munition con-tract doesn’t seem to have been sosrofitableinthiscase.i Mrs.John Simonds of.BlizabethCitypouredkeroseneonasmouldering fire and was fatally burned,dying the same day.Her six-months-old baby was seriously burned. While carrying a piece of glass,a 12-year-old son of Zeb Harrison,aLenoircountyfarmer,fell and cut his throat on the glass and died-in 15 minutes,according to a report fromKinston, The Wilmington Dispatch,after- noon daily,has not passed into thehandsofW.B.Cooper,ias reported.{t is-taken over bya company ¢om- posed of James Owen“Reilly,Wm.E. Lawson and Thos.W,Davis. While givihe a party on Christmas lave,Mary Bethea,a negro woman of |(TEMS OF CURRENT NEWS|. lina under the age of 16 years areepovedin’the cotton ee:The entire capital of the industry in.the ‘State is ‘estim uae teaccordingfo»ual repoCogegnloetaboradPrintingDb,now under’prepara-M.L.Ship tion.i raeThenumberofcottonmillsis 318.These mills use spindles to the num-ber of 3,880,417;67,288 looms and 9,-123 earda,requiring 187,012 horse-|bower,“The approximate amount’ofrawmaterialusedwas851,050,270oounds,The estimated value ofyearlyoutputis$84,549,678.The total number of persons emplo:(figured on a basis of full time for the year) was $1,494.Of these 31,841 are males, 19,653 females.Included in the listare7/292 parsons under 16 years ofbore.The number of salaried officers jand employes,not included above,is 11,187;wages amount to $16,542,121,isalaries to.$1,427,539."The averageHengthofday’s work is 10 hours and}\{7 minutes.Week’s work,60.hours.|Righty mills use steam tas motive |vower,73 use electricity,20 steam and |water,16 water,65 steam and elee- jtrieity,18 steam,water and -eleetric- ity,8 water and electricity,1 internal |combustion engine,1 stezm and inter- ‘nal combustion engine. 5 | ) {{} Our monthly shipment of new ns’featuringCaldwelbPolkSawAeroplane.arinsmartideas lonth PagerThey've been ‘seeing airships in|f the mid-winter styles is here.an the author of popular religious songs.!of life."|Robeson county,was shot andkified in|ta Toy sanrneae arnt see |was also a practical business man.| Denyine some of the statements in|ere ae Sot bent oie etc |.:sacut }wy aos f j2ccount of the crime but the man wheHewas2manufacturerandamassed|the American note,it is admitted that!‘a fortune in his business.jthe submarine commander did not give|:.S jdue consideration to the panic aMONE|“Onartie Narchirides piNotwithstanding“check flashing,”|the passengers,and “the officer Beaches ypuAP oe Aisa8itiscalled(passing bogus checks)!nunished in accordance with the*ex-)aii shea.licd ‘tat KWaate ne Yaa.‘is extra hazardous and the flasheris!isting rules for exceeding his instruc:|tal ak Hockey uM nd Fag ;°almost certain to be caught sooner ot|tions.”:ie ..i cy oct reilater,the number of people who try|Denying also that it is liable for ae iC a ps ie aetogetawaywithitisastonishingly|damaces:the Vienna government,“in|hile Ronan Sw Acre 1YSlarge.Almost every week cases are!consideration for the humanely deep-}me CentetreportedintheState.and the peo-/ly regrettable incident,and by a de-|While Oscar Sarit oFvlewhogetstunganddon’t mention|sire to proclaim once again its friend-|70Unty lay in a hospital at Lumber-it are probably more numerous.Last ly feelings toward the Federal gov-{|{00 With a broken ler,the result otweeka-young man who gave the!ernment.would be gladly willing to|2!automobile wreck.his 15-year-oldnameofFerguson,which is not be-|disregard this gap in.thelievedtobehisrealname,landed in|and ‘to extend indemnities also [an |:mpjailinCharlotteforthisoffence.Atithose damaged whose cause cannot}‘ation.was necessary,The boy's in- 1 charged with firing the shot escap-| the ef-/. shot |: before,| Robeson | evidence|“0%Was brought to the hospital with’*.to|9 arm so badly mangled that ampu-.. iMaldwett,This particular airship was | loseribed to the Lenoir Topie asa large cigar-shaped aeroplane,”which| jnassed over.Caldwell county on) i Thursday before Christmas.If was! ;movinge eastward and appeared to be| hout 50 fect long.‘Two ladies made}roport,A-man reports that he}‘ow it andthat it appeared to be 4,-/1909 to 5.000 feet above the earth.eeIfonlymenhadhadthisvision The Londmark could aecount for it,speciaily as it was Christmas-time.|sutias ladies say they saw it,why it)must he so.Probably Germans —and|Austrians reeonnoitering with a view|ito dropping a few bombs on Lenoir.||Or,a more cheerful thoughtis that} it shown in this lot.Send.for.the February sheet:showing the new cocames.*[i gill be sent fortheasking.We'regtill selling Suits at .1-2 and 1-3 Off.- ReWehaveaSuitfor| you—and you'llsurely get your money’s New Berne a young man who came)he established.”Taking ‘it for grant-|UtY Was the-result of the accidentalfromSyracuse,N.Y..is in jail forjed that this will settle the-matter|lifcharge of a em“the same offence while his bride,®|Austro-Hungary,however,“reserves}A couple of doctors atmemberofanoperatroupewhomhe|io itself at this time the right toj|performed a _operation known..as‘married at Kinston.is cared for by|bring up for discussion at a later pe-|tracheetomy ~inserted a tube in aycharjtablesympathizers.In both|riod the difficult questions of interna-|*hild’s windpipe—and it was heraldedcasestheattemptwasmadetopass/tional law connected with submarine |'n the ne “an unusual op-*bogus checks on hotels,i warfare.”ration,”a matter of fact the op-:Pe Tt is announced ration is common in cases of diphthe-Adventurous Americans not afew)the reply to the t the Gastonia dectors-got-the‘have enlisted in the armies of |r the advertising,rope,most of them in the British orjjcan demands but gives assurances |:French army.Sometimes after they|for the future.which are:considered,Practicedenlisttheygetcoldfeetandthepow-|more satisfactory in their extent.than}py;ry of tho practice Of medi.|r of the United States government |those given by Germany.ine hist sirable ia sent the daily pa.|4 invoked by anxious relatives to get'|—ersten foant:nny‘them out.Great Britain’has grown}a pee Tee Sony :i i ime’medicine.bystiredofthissortofthingandthe!‘Scailie xoaslitts?a'call of Gis.State Department has been informed|tron ae af A:pink “hake| spat mee we Peltiph military ab|Secretary Lansing fas |sugges hip 800 miles off Capo.Hatteras‘thorities will not release adult pliensito 2)the’nations which,with the anton peink told and .stibted*..;|:.SOMms LEeMEpy 1a as‘Yegularly enlisted in the English ar-|t{nited States,comprise the Pan-}.an prescribing and the child’s‘my Americans under age may be re-)American Union.that they join in + bding savoducis.ranorted beclo:E.‘Tensed upon anveals of rezatives.The!convention for the arbitration of all.Bell of Cape,Hatteras:Mr.Helles.sBritish_say.this is m line with the}boundary line disputes e@ Tor:the sivas how:the wiruless aalitora phy-‘United States’practice during the!nrohibition of shipments of war mif-|-icinn’s Aid was received ‘at the Hat.(War Between the States,when nitions to revolutionaries.teras “station from.:sae.pessenewele®‘._try}“aliens were freelv recruited,especial|“Seeretapw Lansing’s proposal,which|.o..;>Riiantin’hour tho distres#2s—moisten a cloth with a litte :hikes Se a:namie~Jy as substitutes for Americans draft-|has the full support cf President Wil-|call waa answered and Dr,Sutton of |Denderine and carefully draw ‘gai mneruioe nmi ARNIS ereed.son,is being forwarded by the Latin:Hatteras was summoned,~Heinquir-}thvough your:hair,taking”one small,That last sentence sure did strike|American ambassadors and ministers|oqthe symptoms.ribed and the}*trand ata time.This will cleanse):thome.During the conflict of the Sec-|to their home foreign offices for eine seceorintiae Was 4 from the limit-/‘he hair of dust,dirt or excessive oil,|:tions the Federal rovernment enlist-/sideration.It is regarded as one of ad Rupply of drugs embraced in the|and in just a few.morkents you have’=_ted aliens very freely.Many Confed-|the steps in a wide plan in which the|ship's pharmac io doubled the beauty of your hair.é‘erate soldiers who were captured will /Pan-American Scientific Congress,in|On the following day the Wireless|delightful surprise.awaits those}:sremember that they.often found them-|session in Washington,is a part.for |erator at Hatter:as again rene whose hair has been.netleeted or is{=selves in the hands of men who could-|preservation of peace on the West-!oq from the shipboard and the news|scraggy,faded,dry,‘brittle,or thin.|g f.@’t speak English.The per centage cry hemisphere and a closer unionof |sf tho baby’s improved condition was{Besides beautifying the hair,Dande-!%of foreigners in the Federal army at{all the Americans lreenived.Uater came a report of its |rine dissolves every particle of dan-/5-‘the close of the ee wee very Jarge:|ce ietge ot the negotiations ¢entire convalescence,Mr.den®®eles :curifies ahd invigor-|2eei:the details of Secretary.Lans ber of a family that has}atac theses Ning ie LEA AEE ane kekeAréportcomesfromWashington|proposal are being held as confiden-}Ris ate te ihe Zo ;ee and fallin te hairy i Aagae |that #x-Senator Marion Butler.will |tial between the Sta-e Department |rk-on the North Ca “O-|le abe :a te walt a mee ud av wil |establish hirfiself,at his Sampsoniand the Latin -American chancellor-|;and.whs 1€one lof the prom:|case VOU.most wanes tera sewscountyhomesoontotakeahandin/ries.Myr.Lansing declined entirely tOlsnord 3 ents of Hatteras,is author eee >US when you see nee hair =|:‘the North Carolina caz-paign next |discuss it in any phase and the diplo-/ityFor tho statement.that Dr,Sat:fine and downy 2%»first—yes but|&S s‘summer.The ex-Senator denics tha |mete uniformly declared they could}46,has received handsome check |?@lly new hair growing all over the)a\.May the New Year come to you well Jadey“yhe is a candidate for any.office,eled ;;If you care for pretty,soft/g@jtive6 )the Lenoir scientists who have heen/|searching for the mysterious light in}Burke county have rigged up an air-||chip for the purpose. The.national committee of the na-|jtional Prohibition party has “numed}|Minneapolis 28 the plaee and July)i9-20 as probable dates far the meet-|ing of the national convention of that |party. GIRLS!DRAW A MOIST!CLOTH THROUGH HAIR,DOUBLE ITS BEAUTY! Try This!Hair Gets Thick,|Giessy,Wavy and Beautiful |at Once! Inmediate?—Yes!Certain —that’s the joy of it.Yowr hair be-comes light,wavy,fluffy,abundantandappearsas.soft,lustrous andbeautifulasayoungeirl’s -after |'Danderine hair:cleanse.Just try Gastonia |worth and more if youn buy one now: .|av-Washington that)-rati Ancona note not only|cial bu‘|3°¢lhanefitEu-|meets the cardinal points of the Amer-|benefit.of Coats are reduced,too. x The assortment is good Medicine By Wireless, and thetariffislight. Proposed Convention of States in Pan-American Union.Ramsey-Bowles-Morrison Co,> SUITS1-2 OFF BORERRETWETo2 gate ey|HESS sted |on as Coats :REDUCED.— The Store That Pays the |Postage on Mail Orders.-. 5th * THIS HOUSE OF GOOD SHOES EXTEND SON’S GREETINGS TO ITS HOST OFOF j 3 prot discuss a matter which was in iS |whieh runs into three figures and that sens lits Se a Be anitaranpointive.but says.he is es-|preliminary stage and under consid-|iha Hatieras wireless operator -was |r,and lits of it,surely get aerestedinnationalpoli-|eration by their home foreign offiesc:||:e is tu remembered eent bottle of Knowlton’s Danderine/#sure-—or professes to be]eration by their home foreign office,|from any drug store or toilet countertheDemocratieadministration|on“tha ieee eentmmetood ietpaat Rritei lide A Yarepela|and just try it.1aigies.Oi air “ds All Parcels ;;ewill be defeated;and tie vrozesses/Inevease in Price “of Gasoline}oe ‘i oe ;He Fs me =SOM ALT “pesequalassurancethatthe“incompe-|Not Warrated.By.Fart«4 jable to Seizvre,COMMISSIONER’S:Bis official information,!Under,by virtue oftentandextravagant”Democratic ad-|Official over i)Aoined wadetenistrationinNorthCarolinawillbe!ane Moyct ee ‘gures MAve/the British goyernment -takes.~the|ent.of thesentbymail,|nade in;; .“When one recalls the in.|DUblie disclose that in the face of TIS-)cand that ‘smy-par ne ncy and mismanagement of 78 |pricesof gasoline,production ofl 50 matter what class of postage isortheBacionadministrationinNorth|¢tede petroleum during the last year said on them,ave liable to seizure if |commi:Carolina an the:latter nineties,in|8S greater than in 1914,although |©“which Mr.Butler bore a conspicuous (Production was _purposely retarded |‘part,and the fact that he is on rec-/%8 fa 48 practicable;”that reservesfordaspronouncingoneofthefusion|Stocks of crude petrofeum now being |‘Legislatures a “damnable disrrace to he d in the country are the largest’.sondence,according to this:stand,ig {uuted in Iithe.State’+—when this is recalled.the |¢ve™recorded;and that ee pprts Of)Fviolable on vessels stopped on the|moreex-Senator’s brazenness—in talking /#250line.to which the Fis 20 PRICES Heft’sena“and-ia-Only.subject to Brit-|2.about incompeteney and mismanage.fTecvently has been attributed,Were igh ‘municipal law when.carried ‘on|‘Ment is colossal.Mr.Butler,howev-/|i2 the last 10 months of 1915 less than |ships which voluntarily call on Brit-‘ef admits that there is one obstucte+the.exports during the corresponding |54,"sorts:»Mail.on shins-calling vol-|to Republican success in North Caro.Period of the two previous years..juniarily at British ports,however,’‘lina.This he characterizes as the!aa ne Oe ce peace Mill be subject to municipal law!-3 :Foie :le Do Or "é “Rae ,88 ‘:reeont |_Pie-hunting Republicans”wiio do not}one preparing to investioate gaso-|Which m«ans that under the present ONwanttocarrvtheState,but who want ha hececk ¢|war conditions the government asserts!—Nee.to control a organianizon and the}PAE PEICSS:jthe right to extend the censorship to|airessoasossueails«7ye he Mele oh ee Searcity of Coal Threatened,.|ch ba{+.Great Britain‘a a Republican President is elect-| good things to be had—and disappointment be strangers to you. SALE.OF LAND | pnd in exec Superisr *ag okWewishtothankourmany.customers who erally patronized us during the year 1915,g resolved to do better things in attending to |According to ution of alse in,:quirements of our customers,thereby solies,JANUARY 10,1916,18 :aetbidforcashatpublic| r of Iredell coun-| they contain goods which under the|orders-in-council may not be ipped |sell to or from Germany cr her al Ane 4 Virst class,actual postal corre-)aha te: your liberal patronage for the yedr 1916, “3 thereon,sit-{3 enty-five acres “gSHERRILL-WHITE $FandsofS$!|sanymennnym NAT ER OE ASEapart,and all Ce re eeerdaKingtractofland| Martin at the time of her}JNO.A.SCOTT,Jxr.,-|ow,Atty.Commissioner.|5, se:J;.on the south by the Ii and on the west by thecashandbeing r,of the AmownedbyAliceC. ath.TH For the splendid trade given us this ye xe ri Gc Morre 1D,19% R.G.ROSSER,M.D. .GENERAL PRACTITIONER, HARMONY,N.C. ‘Phone Harmony.Dec.21—-8t* takes her —stand}The worst coal famine since 1906 sauarely on The Hague.Convention!i predicted for this year by,Johnson|of 1907,which,according to th¢Brit-}Pear tt .C.-MeKinley,coal operator at Wheel-|ish contention,gives no protection!to!»Usual Slaughter in Georgia.«ing,W.Va.Run-of-mine coal in car;parcels,no matier under what class.“Pour negrogs were shot and killed jload lots at-the mines of that State!of postage they may he carried.The}hree burned to death in a negro cab.18 worth today $2 a ton,a 20 per resolution passed during that conven-|nm,two white men seriously injured |Cent.incfease over recent prices.Af-Hon,ented m French,explicitly}ea several other whites slightly hurt |‘¢"the first of the year,Mr McKinley |staics that the only form of mail not!n- that you continue it in the next R.H.RICKERT & ::says ric yill--ailvance gs ily liable to seizure is “correspondenceseriesofpitchedbattlesnear°2¥S:the price will-ailvance steadily a p “ont of the assassination of Henrv| Heating &Plombiey,Ga.,last’Thursday..vrow.|UDul spring.Mr.McKinley,howev-)postale.”{ea ing umn ing igue,an overseer on the FE.Il.| ;'‘ntctinhinhaniniasitsiiinntieaisban-ier;does not believe coal:will reach f plantation. ,the prices that prevailed in 1903.!Be SE idtaly a jShortageofcars,seareity of labor |T00™completely .destroyer}i,|ar é i auseionGoolsbyandanunknown|*id the abnormal demand caused byereshotand i's posse,Grandison’s sons wereiedtodeathlaterinanegrocab-be they sought refuge afterngdrivenfromtheoneinwhich.father and the other negro were!led,and Early Hightower an’Jas.|on,the former a colsin to Gran-Goolsby.re killed earlywinoonbyaposse¢ killed by the} 0 posed of }Carolina |for the shortage,As ne Ro |‘Kinley:All railroads are storing coal th HRCA OF she ak a iy amie of thejandthereispracticallynofreecoal/!@®™ost of the students were cinthe.market, awakening industry are according to responsible Me- eens Judge Tourgee’s Widow Dead. Mrs.Emma K.Tourgee,widow of used over the death!Ville,near Buffalo,The murderedman |with the Goolsby ne-|the story goes,8 when’the latter were|or the assassin, ;Says two more ne-d and fourburnedasaresult of | i and ind pie épeinvennaveeverused for|Because of its tonic»une raes years, and magazinetheyfired|COllaborated with Judge Tourgesomeofhisbooks.was a member of the Superior Court|of North Carolina earey after the,War ;takenegro|Between'the States,and at différent)'%.%°&times Was congul at Bordeaux,Franee,jand viee consul at Halifax, ‘in Fran }and|The Quinine That Does ‘i ng in head. for the sighatare of writer in iJudge Albion W.Tourgee of North,died a few days ago at May- Mrs,patel ak ated 16 HAVE WOU BEEN SICK?She e in of noté, Judge Tourgee | He diedveralyears:ago. es Not RememberK, Affect The Head’IVE BROMOQUINENTia better hen onlyGulnfaeandieeenotcauseGervodepenser |}the In}mame andW.GROVE,2X2,| Wire which originated in the boiler|Sullins||Coliege,a Methedist female *&chool|Jat Bristol,Tenn.,early Friday morn-}iny.Loss estimated betwéen $150,-| ff on|vacation.{Canada,which has already raisedabout250,000 soldiers to help Great!Britain in the Nuropean war,will in-|crease the number’to,a half million.! I do both,For quick and good work call meeeare JEWELERS. ———’PHONE 209,—— W.D.HARRIS,At-—lt-w.118 Court St, Then you realize the utter weakness|that robs ambition,destroys appetite,|and makes work a burden, Torestorethat strength and staminathatessential,nothing has ever equaled| or coinpared with Scott’s Fmulsion,be-cuse ity atrength-sustaining’nourish- tient iivigorates the blood to distributecnergythroughoutthebodywhileitstonic value sharpens the appetite and restoreshealthinanatural,permanent-way,df-yow are run down,tired,nervous,overworked or lack strength,get Scott'sHimtilsionto-day,Itis free from alcohol, 2 Scott &Bowiie,ld,N.J, || “DANGER’’ CROUP an Come like n thief in the night and seize“upon thé infant child.Be prepared to savethelifeofyourlittleonebyhavingabot-tle of ;Brame's Vapo-Mentha Salve gm ROR ,Croup and Pneumonia, Price 25c.,60¢.and ,$1.00,‘Vor.sale by all’dealers of sent post-naidonreceiptofprice,fe aeBRAMEMEDICINECO.N,Wilkesboro,N..C, and PNEUMONIA| i -mayercea 300-acre Alexander County Farm,near‘school Sgbot! est railroad station six’miles,frontiroad,soil and location well adaptedMeryfarming.Over two shundred fruit +dwelling,two tenant houses,barn and 4 pedby‘branches and’springs.E :«cultiv:level.and productive,balance:in woodland which ¥hundred thousand feet.of.timber.Bargain.at $ i Seventy-eight acres one and one-half miles from‘joining the State Experiment Farm,Forty.acreslevelandproductive,five of which is branch”bowoodland.Three-room cottage,small ‘barn,tw_Jocated for dairy-and truck farming,.»4We,For further information call on or write, 1d sf BewintakeraRewith’sick headache,‘and ack-Draught on hand all theandwhenmychildrenfeelayaskmeforadose,andil1aygoodanymedicine er have a long spell of sick-family,since we commencedDearford’s Black-Draught is purelyfable,and has been found to regu:ak stomachs,aid digestion,re-indigestion,colic,wind,nausea,Sick stomach,and similai ¢ | ms. been in constant use for moren70years,and.benefited morei2millionpeople.jPYourdruggistsellsandrecommends-Black-Draught.Price only 25c.Geta.Rackage to-day. &~ANEW YEAR’S +“Greeting!” e wish to thank our _}Rood customers ‘for their ’Tiberal patronage the past year and wish for you a and Prosperous |Milholland. Ee [Basle ony ‘Subscriptions Pub- Club Taken to all lications. Rates: R.P.ALLISON'S Book STORE.| x ca a o .re ae 2 Ze|Paine View Dairy _Has just had its cowstested ahd they were found in good condition —another reason why the ,Dairyjwith“the Dacro System should "4 be patronized.. :se 847 BLACK.— N,C.1289 riers ‘second with 83 miles and Washing- rr 3 due 1.16 p.due 6:66 p.due 10.60 » ;3 ttwiy 1 22,east-bound,Train No.127inNo.16, Train No.16 ar.9,80,"Train No.24 ar.8:14,leaves 8.14 p.‘From Taylorsville,meNo,23 ar.10:00,leaves 10:40 a;No,15 ar,6:40,veaves 7:05 p.Nos.28 and 24 are not operated on Sunday Fewer Miles of Railroad Built—Many in Receivers’Hands. Fewer miles ‘of railroad were built in the United States during 1915 than in any other year since 1864,and more miles of railroad were in re- ceivers’hands during:the year thaneverbefore,according to railway sta-tistics compiled from,official sources by the Railway Age Gazette andmadepublicretently.There have been only three other years since 1848inwhichtheincreaseinrailwaymile- age was less than 1,000 and thoseweretheCivilWaryearsof1861, 1862 and 1864,Risk The.total new mileage last year was 933,compared.with 1,532 miles in 1914-and 3,071 in 1913.Pennsylva- nia‘eonstructed 98 miles.Oregoh was SE R E R R E E #8 §8 ton third with 71 miles. States built no new road at all. According to the:statistics receiv- ers now hold and operate 38,661 milesofrailroadornearly&sixth of the total-mileage and capitalization of the railroads of the United States.On October=t“there..were 41,000 miles.of railroads in the hands~ef receivers, the“greatest ever recorded.RELIEVES THE WORSTCASESOFCATARRUL |Think “Hyomei the Most Wonderful Treatment For Catarrh Ever Dis- covered. |Do not try to cure catarrh by us- [ing sprays or lotions;it cannot be cur-ed in that manner.The only.way in which this too common disease can be ifully relieved is through a direct ap- |Plication to the affected parts that will kill the bacilli of catarrh andtpreventtheirgrowth. Breathing the air of Hyomei is the®nly known method of treatment that ean really aceomplisn this.It is the simplest,most pleasant and probablythemostreliabletreatmentfor’ca- tarrh that has,ever been discovered.The complete Hyomei outfit i8 in- expensive and consists of an inhaler, dropper and sufficient Hyomei to last several weeks.his’will effect in- stant relief in ordinary cases,but for chronic and deep-seated cases of ca- tarrh,longer use may -be necessary, and then an extra bottle of Hyomei can be obtained for a trifling sum.It is not alone the best (it might be called the only).method of.treating catarrh,but it is also the most eco- Eleven Jnomical,.._Phe—Statesvilla Drug -—Co.-have muck confidence-in the power of Hyo-+ mei to relieve catarrh,that they willl lfor a limited time,sell this medicine junder their personal guarantee to re- fund the money if the purchaser can ‘say that it did not benefit. hee renee ‘Doors,Windows,Blinds, iMantels,Columns,Newels and Stair- iways,bought from the samemanufac- turer for 34 years.Buy “Everything to Build With”where you can.buy cheapest is all I ask,Mr.Builder. -C.WATKINS,Statesville,N.C. RAIN YOUR FARM. tb iny quantity 4-inch and +6-inch Drain TILE on 4 hand. }Common Bricks,Face‘Bricks,always ready for ]delivery. {Statesville Brick Co. C.WATKINS for“Everything to Build With.’ PU LLSTOCK.-LOWEST_PRICES ngles,Doors,Windows,Ceiling,Flooring,Siding,Boxing,;Mould-aths,Lime,Cement,etc., Planters’Wh.Statesville. L.Sherrill,M.D., Vill answer ’phone calls left.Long’s Sanatorium:or.M.Foard’s residence. San putter Wrappers! »have the very best ‘chment Butter Paper, ed ‘can print your namedbrandonsame.Let us asian lalate abn |ICE TO CREDITORS. qualified as administrator of the es-ames C.Martin,deceased,late ofty,North cacon this isto notifyavingclaimsasainsttheestateofadto%xhibit’;them to the tinder- .M.Strond’s,eater ties Ne.Gfheforethe29thdayNovember,this notice will be plead in bar ofasierseng.idebted «to heleaseeangmeratateneéttle.|GRIFFITH, Buckwheat Cakes! That sluggish appetite which fol- lows the heavy holiday eating re- sponds quickly at the.mention of the following: ’Hecker’s Buckwheat,a mixture 6f buckwheat and wheat flour,al- ways ready,reliable and healthy. Mountain Buckwheat. To go with it,Log Cabin Mapie Syrup,made from pure cane su- gar and maple sugar: Sherrill &Reece, ‘Phone 123,108 West Broad St DITABLE DIET! The effects of overeating during the holidays,may best be offset by White Beans, Pink Beans, ‘Butter Beans, Canned Peas, Canned Tomatoes. Miller-McLain Supply Co, w -WANTED! SCRAP BRASS —Heavy Brass 7ic.per pound,Light.Brass 5c.perpoutid FOR SALE: New and second hand boiler.room supplies :COU,TURNER. nistrator.Bene a ae Iredell "Phone ‘No,74,Bell No,7. ,7 _Rte + 5 i 85 cane SM 50; ‘hegin to plan to make that product:a Iredell county won most of the pre- ve Stock Show at SalisburImportanttoIredellFarmers—Mr.Dull’s Suggestions, orrespondence of ‘The Landmark.Most of you no doubt remembertheAnnualStateLigeStockMeet- ing that was held ho@®last year and perhaps many of you remember it with a sense of satisfaction,because you or your neighbor brought,home one or more of the many premiums, that weie offered.Every one of us,though grown up,has enough of theboyorgirlinusyettofeelproudofthatwhichwesecuredbecausewewereabletodosomeonethingbet-ter than any of those about us.That chance to excel our fellows has pass- ed and some failed.but with their fail-“re came the knowledge that will helptoimproveontheeffortsofthefor-mor time and that knowledes i whatillarestrivingafterbecause¢f the} lacting satisfaction it Lrines. Many have expressed their regretthatour.town could not,or,did not, secure the meeting again for thisvear;but when we did not,the best thing we éan do is to make the bestofituntilsuchatimeaswewillbeabletohaveoneallourown.Thistimeourneighboringtownontheeastisdogitsbesttomakethemeeting and live stock display even better than we had and let us hope -she will sue-ceed,for if such is not the case it will reallv be a backward stev,for failuretoadvanceisthefirstsignofdecay.Its nearness makes it practically /athomewithus,so some of the respon-sibilitv.for its success still wests onus.Let--us every one then do,ourhesttomakeitagreat.deal,betterthanitwasbefore.3Whiletheentirevrorrammeof theStatéLiveStockMeetinxtobeheld at Salisbury January 25-28 has notbeenmadepublic,enough has come out-piece meal to assure us that _itwillbeworthattending.There will be interesting addresses “by--leading practical and scientifie men,instruc- tive lectures by those versed in teach-ing,lively rivalry among the boys and girls in the stetx judging con- tests and keen competition between the many exhibitors of dairy products,voultry and live stock.Surely there is something in that list for your.in- struction and interest. On the first night there will “be a good programme in which prominent poultrymen and State officials inchargeofthepoultryworkwilltakepart.An educational.exhibit and poultry show in which a_beautiful silver cup will be awarded for ~the best pen,four hens and a cockerel,of any breed excent the American,has been planned.For the American class a special trophy is-being offered.» On the second day a_beef cattle vrogramme will be carried out in the afternoon,part of which will be a sale of.pure-bred Aberdeen Angus cattle offered by breeders from sev- eral States in co-operation with “theAberdeenAngusBreeders’Associa-, tion and State and.Federal officials. They feel that the South will soon be the cattle range.ofour country and)are putting these cattle un for salé| with the risk of-securing less ~thaytheirworthtoaidinthisgreatmove- ment.In-addition”tothe display of dairycattleasalehasbeen.planned.that promises to be the largest consign- ment of dairy cattle ever brought.in- to the State.These will be of the two leading breeds already kept here,Jer- sey and Guernsey.In the males none hut pure-bred will be ‘offered,while in the females both pure-breds and erades of excellent individuality will be offered.Every animal must be in- spected and‘apnroved by.a competent official before it may be entered for sale.If you have such to dispose ofitwill‘be necessary to have themlistedatonce.\ The dairy products contest:is one that almost any one has @ good chance ts enter as there are several classes and the prizes offered are of useful| bred calves,ete.The total value —of the prizes offered in this contest on dairy products alone will exceed $500. A small display of two pounds of but-ter,a quart of cream or milk or a small earton-of cottage cheese may win you a pure-bred ¢alf that would be the means of getting you started with good stock capable of bringing ereater returns than some of the seyub stock that is far too common in our State.$ In the student stock judging con- test some valuable prizes have been offered.Mr.Edgar.B.Moore,presi- Jent of the State Dairy Association. has donated a registered Jersey bull salf to be offered as a prize to the} student winning first place.Anyschoolboymayenterintheindivid- nal contest and -should stand a good shance if he will begin soon to study up a little on the points of the dairy sow.An article in the December 4th issue of the Progressive Farmer.en- titled “How to Know a Good Dairy Cow,”should furnish any one a good working knowledge.of;how to judge an animal.If you want.to entercomearoundandIwillhelpyouto“catch on”to these points.or come along to the meeting and we ean learn some of these things -while we look the cattle over.Such things arebestlearnedbyexperienceandhere is a rood place to get it.We all have to start at the bottom and then some climb, When’a complete programme is sen,cured you will be made acquaintedwithmoreoftheconditionsbutfor the present the main thing is to de- cide that you are going to enter inoneormoreofthecontestsandwill itttle better than you ever did before, miums last year and can do it again if you are determined to win yourshare.The distance is small,the ex- nense light and the reward large,so let’s be there in foree.~G.BE.DULL, County Agent, To Drive Out Malaria —»And Build Up The System Take the Old Standard GROVE’S|TASTELESS chill TONIC.“You know what you are taking,as the formula is:printed on every label,showing it i§Quinine and Iron in a tasteless form. ury|Christmas Tree and Holiday Vis- and valuable dairv equipment.pure-|between the Mississippi and the At- (The commission declined to suspend idiate than to the terminal point.The IN THE Amity'COUNTRY. itors-—-Wedding—Mad Dog. Correspondence.of ‘The Landmark.— Troutman,R-2,Dee.30 —Christ-mas passed off quietly in’Amity com-munity.There was a Christmas.treeatBethesdaChristmasDayan old as.well as the young.The Sun-day school children sang some beau-tiful.songs,and recited appropriateselections.Everybody seemed to en-joy it,especially after Santa came in,|for he was amusing in his maneu- vers.;Mr.Frank Goodman and Miss Co- va Christy were married last Thurs-dav:evening.They drove to Moores-~ ville and the ceremony was perform- ed theres We wish for them much success inslife.} _Miss Annie Albright,who is teach-| ing at Glade Valley,in Allechany county.and her sister,Miss Linnie} Albright,are spending the holidayswiththeiruncléand’aunt,Mr..Thos.| Morrow'and Mrs.E.I.Owens.Mr.}John Qvercash and jwife of Macon,| Ga.,.are spending the holidays:with}Mr.Overcash’s mother.Mrs.N.L.! Overcash,Mr.John Ritchie of Ar-| kansas is visiting:his uncle,Mr.M.! A.Christy.His sister came two years ago and is making her home! with Mr.~Christy.Mrs.Fred. Conger and children of Statesville| came down to.visit.Mrs.-Conger’s fa-| ther and mother.Mr.and Mrs.J.H.}Brown._Mrs.Geo.Templeten of; Mooresville is visitine her son and} daughter,Mr.J.C.Templeton and Mrs.Chas.Goodman. Quite a little excitement.was cre- ated some time ago at Amity when amaddogcamethroughandbitadog or two;then,went to the home of Mr. Jas.Overcash and bit one of his pigs and then went on to the home of Mr. R.H.Brown and killed 18 of hischickensandburiedtheminafield} near by.It was then found at anoth- ar neighbor’s house and killed.; Movements of People—A Wed-| ding—Mrs.Hartness.Better. Yorrespondence of The Candmark. Statesville,R-2,Dee.-31 —Christ- mas passed very quietly in this com- munity. Rey.C.S.Cashwell filled his regu- lar appointment at South River last Saturday and:Sunday. Mr.and Mrs.W.G..Privette of Washington (N.C.),who spent the holidays visiting relatives and friends, returned home Mondey.‘disses Ber- tha Abernathy and Ada Weston will return Saturday to Gilead,Mecklen-bure county.to resume their school work.Myr,C.L.Weston,wno is at home from Harmony,will eo to Mooresville tomorrow to visit his un- cle.Rev.L.‘W.Weston. Miss Esther Cross of Southmont will return tomorrow’to continue herworkasteacherofTrinityschool. Mr.Columbus Watts visited relativesatHuntersvilleduringthe.holidays. Mrs.hi.-C.Moore of Ashevilie is vis- itine her father,Mr.F.F.Wooten. Mr.and Mrs..B.B Swann -spent Monday and Tuesday with Mr.and Mrs.J.EF.Davis and Mr.and Mrs.W.F.Privette,Mr.and Mrs..4%.V.MéLain visited relatives in States-’ ville Monday.Mrs.J.C Abernathy. is—visiting-relatives-in-this commiuni- Candidates are busy,too,“during the holidays.We hope for every one of them a pleasant and successful race.KMr.Jacoh.Menser.and Mrs.Am&n- Aa Millsaps celebrated the holidavs by getting married Thursday.We wish.for them a very yzeasant life. Mrs.C.C.Hartness,who underwent 4 serious operation “at.Billingsley hospital,is at home now.We hope for her an early recovery. Commerce Commission Puts New Rates Into Effect: General -readiustment of freight rates on railroads serving the South, 'lantic and the Gulf and the Potomac river.has been approved by the In- ter-State Commerce Commission. tariffs of Southern carriers proposing changes in rates on all classes of freight and the new tariffs will be- come effective Saturday.The new schedules were framed by 4 committee of Southern railroad men on-order of the commission to ~the Southern carriers to reduce and elim-| inate violations of the so-called long and short haul provision of the inter- State commerce act,which forbids a higher rate for a haul.to an interme- new schedules reduce hundreds of vio-; lations of this sort .and_eliminate! many others.The genéral effect of|the commission’s.order will be to in-} crease’rates to and trom the impor-| tant.centers.i | Railroad officials say ‘they do hot | expect the order to yiela any addition- al revenue but they could not deter- mine this voint.until tne readjust- ment had been-tried out.The reve- nue derived from the increases to the larger points,they said,probably ‘vould balance with the reductions to,smaller points.: The North Carolina corporation sommission was among those who pro- tested against the schedules and there were many protests from shippers.in this.State. Fireman Sikes Recovers From Unusual Injury. V.V.Sikes of Spencer,a Southern’ railway fireman,who was hurt in a veculiar manner while hunting in Alexander county some weeks ago,is out again’after having been.under treatment in a Richmond hospital.He attempted to step from-a small et- bankment to a sand bar two feet be low,and his foot hung under a root, while by his weight of.more than 250 tounds he sank into quicksand which was encountered unexpectedly,An Speration was ‘necessary to remove a number of broken veins.etiinsssiticchdadianainideipliodaisinata Whenever You Noed a General Tonic Take-Grove’s The Old Standard Grove’s Tasteless chill Tonic is equally valuable as.a General Tonic because it contains the | well known totic propertiesof QUININE ‘and IRON,It acts on the Liver,Drives ‘out.Malaria,Enriches the Blood and The Quinine drives out malaria,theIrowbuildsupthesystem,$0 cents Ald Bailds up the Whole System.89 cents,eer a5 Le a An yiytree 7 old|oySantaClaustreatedeveryone,the|” HE Po”r Le eTHTN 2 Carloads of Fords. Just received two,carloads of Ford Touring Cars.Start the ~~ New Year right by buying a Ford. -Carolina Motor Com’y, Statesville,Mooresville and Newton. In Many Instances |TheSeason’sMo:Prices Less Than Half portant Sale on |Johnston- Of all Women’s and Children’sCoa and Coat Suits.tN ee Price reductions are greater than- ever before.:ee Many reductions -are far lessth half,ek One of 12 Big Stores That Sel‘PHONE 212.— INSURANCE!2= As a great many pclicyholders do not seem to know#their insurance will be void under certain conditions namedcontractofthepolicywhichtheybuy.We deeb it advisalmentionsomeofthecausesunder’which the same will.bevalueless,viz:y ae 41—Vacant or idle.property for longer than 30 days—applyyouragentforpermit.oe :2—Mecheaics making.additions to,or extraordinary altera-tions in or‘cn property—always get permits from agents.tink8—Property,upon which there is a mortgageanibag,notice of.same is given—apply to,your agent.eea4—Any change in the title or ownership,or interest \in propetyinsuredotherthanbydeath.‘Powe5—Assignment or transfer of:property to anothi 46—By any increase in the hazard,notice must be given.7—The taking of other insurance withcut notice.8-—Keeping explosives on the premises withoutthankeroseneoil,i j 9---Property encumbered ..Belicyholders should read lines 7 to 30 of the printed ¢onoftheirpolicies.It is impossible for agents to know of theseficienciesunlessnotified.Call on us for any INSURANCE nd mation.;no“WE INSURE ANYTHING INSURABLE.”J.F.CARLTON,Mani ' *PHONE 54. by chattle mortgage.- I want to thank for their trade all whotheyearwhichbeginstomorrowwhen of jewelry,clock or watch repairing,examiningof ey =='cently the British government has #2.00 been seizing and detaining parcels Be post packages,which,to the lay mind "ground that he is a an innocent man may re-| hnicalities to gain time to e proof of innocence,but ne conscious of his innocence ng behind©congressional isn’t going to help Mr. in the opinion of the coun- t Sympathies:to Clarence ‘Because he happens to edit a aper,whenever he suggests a in public affgirs or something at,they charge that he is pre- make trouble for the Dem- or is going to run for Govern- sibly Mr.Poe has some rights ivate individual,a citizen.or ‘to make suggestions and mind about matters and Congress doesn’t look good.| shipments of American goods to neu-trals as well as to belligerent coun- { 1 ‘and invites them to come /ent international law is a mere code But whenever he does thar m to.think he is trying “to! ing.” tion is invited to the state- President Grier with refer- the sale of iredell Telephone y stock.Stockholders who le ‘to preserve the company as an indépéndent organization and who a ate the saving in tolls the ex- stence of the company means to this community,should have a. .ir stock does not fall into the nds of hostile interests—which wilt lestroy the very purpose for which home company was founded;and ose who may sell_in any event juld be sure they get the worth ‘their stock. ustria’s answer has saved the sit- on for.the time at least,but the peessions made are grudgingly giv- It is admitted that the cOmmand- the submarine ‘was _technically ity and it is stated that he has h punished.While his punish- Was probably not enough to %the admission of course relieves tension.Responsibility for in- fity is also denied,tat:Austria guble,:and this further dliaves :fendion,It was not to be ex- coursé that the Vienna gov- _ernment would confess guilt and ask for parton,but the concessions ‘wrung ftom it admit the principle for which the United States contend- dou't get one.submarine inci- settled until another is on.If Persia was sunk by a submarine, is probable,the disaster comes é to us with more force because ‘ore American victim was a North olinian and an officer of the Unit- States government.The Austrian re”ut Washington,who is 80 npt to give assurance that full tion will be made if it should a that the Persia was sunk by to cause “a-doubt whether the mic powers are ps earnest in ‘efforts to keep peace with us as ‘profess to,be,_Proba ly if our as strong ‘enough,a coult ut dn end(to-it by(a show of But whate\er the oitcome,the ‘The newspapersshould hold.: rateful remembrance the judge Se go s@ld a quantity of wool th regulations and plead-| ‘the particular reg=) s nop placarded in the vil- has been customary and ap- only in |the newspapers,which did not yead.The cour:ruled at rsons.who.now read no news- eulpiably and cannot plead 'war-time regulations ‘tion,”and the defendants at to jail.That may have little hard on.the _defendants particular case,but on the position the decision was a gense one.In these days newspapers are sources of information,|when,anybody 2)posted by reading the “who fail to do so and @ as a result,have onlyblameanddeservelit- WilsoniturdayeveninginotelatHoteyhave.pare aiebase care that} \ |sibility by | } | jof etiquette;and that for the future only real hope of world peace, seems to be a sound observation; |violate the rights of neutrals whines er it suits their convenience,‘either the great kidney,liver erless or that they can escape respon- dustrially, That will give a new meaning to the:Lone the beneficial results of the war. Incidents Gathered From a young man seriously injured, praey,while coasting at Caldwell, n|ties. ;AN APPARENT NEED; *Great Britain's practice of stopping tries is trying on the patience.Re- appeared to be going:beyond the lim- ‘lit,but it falls out that under the reg- ulations of The Hague conventions pareels,no matter if sent by post, are classed as freight and in _this particular case Great Britain.seems to be clearly within her rights,Wr. Elihu Root,who is one of the ablest men in the country,thinks our prés- we must have real restraint of na- tions by powerful international tri.i bunals operating under a definite code}}, of laws.In that,he says,lies the// That and it might be added that some interna-| tional tribunal with a definite code of| ms Sareery:indlghlin vote of the pedple is the main cause of offence,says Mr.Haymore,—‘holds thatwouldbegood enough if repairedthematterigsuchanoutrageasMr.Haymore represents,the commission-ers could refuse to obey the Orne and}take ee:4 ; Sev en “States at midnight Friday, "9 more, lL.Haymore,Republican.politidanofSurrycounty,ro bs.constituents as .very indignant cause’compelling thé.county commissioners:6 build a new court house and. for which $80,000 of bonds «must be ‘of the order of Judge— issued.Issuing the bonds withouta whothepresent—buildings Liguor Traffic. State-wide prohibition of the sale/ and manufacture of intoxicating liq- vors became effective in seven tesputtingout»of yusiness more than 3,000 saloons,aargenumberofbreweries,wholesale iquor houses and distilleries’The Comonwealths added to the avid ‘di trict are South Carolina,Iowa,Cola: jrado,Oregon,Washington,Hehe jand.Arkansas. laws and powerful enough to enforee SWAMP-ROOT SAVES them,is necessary to insure the r ights| of neutrals.The present war has| demonstrated that belitgeren:s Wwili | because they feel the neutral is.pow:ir evasion and apology. Whether.the —powerfui tribunal Root has in mind-can be |tyandsuccessfullyoperatedistobede-|‘Root. monstrated,but its need must be mitted.|pounded from vegetable herbs. ad- The Landmark has much hope of|spoonful doses. the results of the Pan-American Con- gress in Washington.The Latin-American ‘countries and the} United States,commercially and in- offensive and defensive,|s Monroe doctrine and may be one of NEWS OF CURRENT EV ENTS.ine be§ iknow that Dr. established |Dr. \fied testimony it is results|ihelper in relieving and hoped for are a closer union of the |k idney,liver-and bladder troubles. Dr: KIDNEY SUFFERERS. You naturally‘teal secure when you Kilmer’s Swamp-Root,and bladder emedy,is absolutely,pure and con-‘tains no harmful.or.habit producing idrugs.The same standard of purity,Mr.istrength and excellence,prescribed by Kilmer miany years bottle ago,is main- ained in every of scientifically com- Tt ‘is rot a stimulant and is-taken in tea- Swamp-Root —is ed for everything.nature’s great don’t delay another nearest druggistIfvousuffer, idey.Go to-your now and get a bottle. dollar. However, ,for a sample bottle. ville Semi-Weekly Landmark.All Parts of,the Country.| Congress reassembles today. “wo young women were killed and| Sat-| N,|j Near Laporte,Ind.,Satur Say.three | persons were killed and many injured| as the result of a head-on collision on| an interurban railway.'i Objecting)to the marriage of his’! 18-year-old son,Jacob Schwaim,a bar-| ber of Cleveland,O.,killed the boy |and then committed suicide. Al.Ringling,66 years old,and one} of the Ringling Bros,,circus_owners,| died Saturday at”Baraboo,Wis.,the? winter quarters of the show. Snow fell in Sen Bernadino,Cal., last week for the first time in ten| years.The*fal!was general in the| citrus fruit belt of southern Califor-|nia but nod damage resulted, A woman and two children are miss-|ing and two other persons are ex-| pected to die,following a fire whichdestroyedanapartmenthousein| Philadelphia. injured..” A farmer named Mayfield,his wife| and their son,L.L.Mayfield,werekilledattheirhomenearNewBos-) ton,Texas,the murderer using an} axe.A younger son,W.J.May-| field,was arrested as a suspect. An attempt to dynamite the State capitol building of Massachusetts,at. Boston,was discovered Saturday.A bomb had been placed and the fuse fired but the fire had gone out:before_|it recahed the bomb. ‘J.B.Spier,38,of Atlanta,was shotandkilledonthestreetin’that city Sunday after what police said was.an altercation between Spier,his divore- ed wife,her father and brother,over possession of Spier’s 9-year-old daughter,Dorothy.Spier’s father-in- law and brother-in-law were arrested. William.Lorimer,former United States.Senator.from Illinois-and_pres- ident of the defunct LaSalle Street qi peony and Savings Bank of Chicago, was formally placed on trial Friday,| on a charge of looting the institution| of $2,000,000,in.money and~securi-| The case yas continued to Jan-| uary 17,when the selection of jurors| is to begin.Lorimer was expelled,from.the United States Senate on the} ground that.his election was secur ed | by fraud. |Mr.Ford Back—Views Changed. Henry Ford,who led the peace ex-i\pedition which left New York Decem: ber 4 on the steamer Oscar II for Co-.|penhagen,in the hope of bringing) about a conference of neutral nations that would end the war,arrived in New York Sunday.He confirmed ¢a-| ble reports that his return had been hastened by illness,but said itymade a difference of only a few days,as he integded when he left to come back|thi onth.|Ford declared is views:re-| garding the cause of the war have| undergone a marked change.When | he left he said he was of the opinion that bankers,manufacturers of am-munitions.and armament were.re- sponsible,but.he returns with the belief.that it is the people them- selves,those now being slaughtered,|who are résponsible: the fighting have i content to || Twenty persons were| | | | let those who rule m do their thinking,and they have not takenadvantageoftheirdivinerighttosayforthemselveswhattheyshalldoandthink,|oseneenneineemeeneeeneliameineteal Women of Sedentary Habits. Women who get but little exercise are likelytobetroubledwithconstipationandindiges-tién and will find Chamberlain's Tablets high-ly beneficial.Not so good as a three or fourYimilewalkevery,day,but yery much betterthantoallowthehewelstoremainina¥con-stipated jcondition.©They cre easy and pleas-ant to:take and mdst agreeable in effect,Ob-tainable ‘everywhere,: hy x The men doing} USTAN For Sprains,lameness, Sores,Cuts,Rheumatism Penetrates and Heals. Stops Pain At Once For Man and Beast252,50.$1.At All Dealers. sure and mention the States-| Ai THE(Crescent eater Thursday,Jan.6th, |The Beloved Idol of the} SereenMARYFULLERoNceo “Under Southern Skies” Lottie Blair Parker’s fa- mous Broadway success.Over two million peoplehaveseenthisplay.It isabeautifuldramaofloveandromanceduringtheAnteBellumdays,filled with the charming’atmos-phere of the Sunny South.A play for everybody— sweet,wholesome and re-freshing.The CharlotteObservergaveit-one of thebestnoticesofanypicture shown there.Read_its criticism. Prices 10c.and 15e. ae:Ea =eieTODAY Anse,We havea splendid three- reel airy Story: “Sach ‘a Princess.” Also three other splendidreels—another big six-reel show for 5c,and 10c.HEN Cohufo ON FRIDAY We have another.splendidthree-reel picture with Ma-ry Fuller— “Lil Nor’wester.” 'A strong emotional drama _of the East Coast Fisher- ies.Miss.Fuller never acted better than in thisicture.Pretty little Bil-ie Rhodes furnishes thecomedyfortheday—|‘Looney Love Affair.if Cline | Drop Legalized Swamp-!§ It is not recommend-|¥ According to veri-?¥ overcoming|¥ All drug stores}§sell it in two sizes—fifty cents and)& if you wish.first to try this great preparation,send ten cents)§ Kilmer &°Co;Binghamton,N.igWhen.writ-/ time. FOR I with sa 50 and pay You pay every one an opportunity to join. The peoplein the ruraldistrictsforthemaswellasourfriendsin town.| _It matters not where you live you can join the club,and_will.not fir it inconvenient to meet the payments,as they aresmall You aay pa as many weeksin advance as you wish. You May Join One or More of the Following Classes: or Others are joining every aay,Thisinsmore than the total ‘number joined last year.We are counting on not less that 1, ‘The club will be held open several weeks yet in one to have begun to realize it is a good:thin FIVE CENTS PROGRESSIVE CLASS. will receive Pay 5 cents first week,10 cents second week,15 cents third week,and so on for 50 weeks,and we will, issue you check or pass book with credit therein two weeks,before Christmas for TWO CENTS PROGRESSIVE CLASS. Pay 2 cents first week,4 cents second week,6 cents:third week,and so on for 50 weeks,and we will issue ,you cheek or pass book with credit therein two weeks before Christmas for ee ee ee ¥ IN THE $1.00 CLASS. You pay $1.00 each week for 50 weeks,and vou re- ceive check or pass book with credit therein FO.6 Ks YOU MAY REVERSE THE ORDER OF PAYMENT IF YOU WISH TO DO SO. NSTANCKR,in the 5 cents class you may start cents less each week for fifty weeks,and two weeks before Christmas vou will re- ceive a check or pass book with credit therein for 5 Or,in the 2 cents class,you may start with $1.00 and pay 2 cents-less each week for 50 weeks,and you $95 50 ¥e IN-THE FIFTY CENTS CLASS 50 cents each week for 50 weeks,and you will reecive check or pass book with credit therein for-a Parties in the country who want to join,and do notfind it convenient to gometotown,maysend in their payments by mail.MERCHANTS &FAR: Of Statesville. eee ee eee wwe ewes wins ceeetes Pee ee ee eee we ee ee ee ee ERS’BANK. “THE BANK FOR YOUR SAVINGS.” 000 members $63.75 $25.50 $50.00 . sn ee ee a $63.75 2 -$25.00 C.S. 180NIGHTS INCHICAGO and a Car Load of Novelties. YOU WILL BE SORRY IF YOU MISS THIS ONE A”Real Musical J amboree: SEATS ON:SALE AT STATESVILLE DRUG CO. !ee PRIMROSE OFFERS | 1 The Newest Jumble of Music andGirls © “Don’t Lieto Your Wife” TONIGHT AT THE OPERA HOUSE... The Most Talked of Show of the Age. Filled Full ot Pretty Girles,Catchy Songs,Novel Dances 315NIGHTS IN"NEW YORK B BS ee TO U S 7A REN Oa CU O : FE Y OO S WU E EY : All Ready-to-wear Coats and Coat Suits must be sold, Now is the time to secure a Suit or Cost. time to wear them ‘yet. The ——-Yoursfl= Reductions Without Thought ofCosi See us for real values. A long womwat -.WANT ED!Everybody to call at Sharpe &Jo-.sey’s restaurant to see demonstra- SS ee “WELL— We havein stock Well Buckets made up i‘used about bucket.Any size orweight.Stove Pipe”anne_iron S,STOVE TIPE tion of the wonderful Simplex Gas Also full line in stock,‘Plant for Cooking and Heatin ea ae,‘Soucenis for ladies whilea a ESS Le TIN co.,H.,Mohler,Manager::OP,LYON,Act.date "PHON 114 dee pa ters os A wo pre sie ).a,et ON.pet 1A.;; >4 ‘a 8 \;He B%.‘Te BBS =.f:Pong1Sih9 Mentionof Folks Who Come and ¢ourse inn business cotiege, “Dr.Harry Harrison,in Noffolk,\ }to the State Normal at Greensboro.«Miss Nell Marshall returned yes--terdey to Ramseur, -Oollege at “and Mr.Ras.Stimson,who were hol- Stimson,have returned to Asheville. ef i ,|géing from here to-Salisbury,where she will spend a few days before going | Salisbury. .'spent the holidays with relatives Mrs,J.-W:Fowler,went to_Mocksville| ee i F.&A.M.meets foros,+e ae,cordially intvit-Regulrr meetin a ENTLY PERSONAL. hig oe 2 Go.4 ..Miss Florence Alexander,who washomefortheholidays,returned torlotteyesterdaytoresumeher ‘Miss Agnes Gwyn of Hinton,W.Va.,who visited her sister,Miss Nel-lie Gwyn,left yesterday for ber home.Mrs.N.Harrison left yesterday foravisittoherdaughter,Mrs.8.Weilman,in Richmond,and her son, Pp be _Miss Winnie ‘Leach.of Hiddenitewas.in Statesville yesterday.en route where she is ille,Tenn....Messrs.Herman andSethLippardreturnedtoLenoirCol- e at Hickory yesterday and Myr.rl Lippard will return to A.&M. Raleigh today.Mrs.J.H.Richardson and children iday guests at the home of Mr..S.W. .A.Reavis,who was visiting ome of his brother,Mr.R.P.Reavis.has returned to his-home.at Davy,W.Va. -lotte last week.Miss Elizabeth Guy Davis of Balti-™o%" ‘ymore,who had been visiting in Char- dJotte and:Mooresville,spent Friday in Statesville with Mrs.B.A.Cowan, ib on.to\Baltimore.,» Mrs.W.A.Hamlet and children ‘event from Friday to yesterday in \¢ Misses Beulah and Ruth.Arey, Statesvilleand the Elmwood commu-|! nity,feft Friday.night for Durham to} resume.their.school work.| seers:and Mrs. Mr.‘and;-of Mr.Fowler’s parents, Saturday.to visit Mr.Fowler’s sister,| Mrs.Grant SDaniels,They will.re-! turn to Statesville this week and ‘will |: Jeave Friday for their home :n Phila-| delphia.pts | Mr.John Arey,government dairy| agent,has-returned from —Madison,!taincd at a’most:delightful and.elab- ceremony was "performed by.thebride’s pastor,in the presence of a large number offriendsandrelatives. ants werebrotherof ‘the bride,and Miss EssieStine.,The bride’s sister,Miss Lola ithe bridal party was invited into thediningroom,where an claborate menu was served.and later the party cametoStatesvilleinautomobilesandMr, mercantile business onJj.{street and is widely known in that capacity. neonle attended the marriage:Misses Mollie and Sarah Sprzater,Mr. Kplace tomorrow evening ay 7 o'clock land the following will compose bridal party:Misses Ida and Corinne Clarke of Kaufman~o~etephany¢ \H.Geodman of Richmond,and Dr.S. iw, Clarenee Kaufman of Danville will be iwill be given at the Hoffmann home ‘from 8 until 9 end from 9 until iv who!guests are expected for the wedding:in|Mr.and-Mrs.J.Kaufman.MissbetteKaufman.Mr.Clarence.Kauf-|Hixhest cash » Everett:Fowler .of Mi Philadelohia.who were holiday guests i.odmMMr.Benizxmin and Mrs,Harry Hirsh of Lynehburey'say coun bury. Sumter Mar-,»Events.— ae A ev,Parks Gwaltney. The attend-|)" Blankenship.Mr,Fuller Blanoiship,played Lohengrn’s|iR®Mey”,cag tuii |g icetgweddingmarchas-the bridal party|;\°“a r%pe Deen:Stalee EMAL:|Coton seed <806 \per.bushelentered,‘and “Melody of Love”waa ter.After these had been thoroughly y Bee Der bushel, ee :a ..a vlaved during the ceremony.The ee dy she dors ee a)aris eleanor m sae aeinsen 10 cents :;;**0 :4 per line,o ad.takeli for less th 25brideworeadarkbluetravelingsuit.|)iqqon to enter.Come:|Cage iat socaraeeny Fs nae Immediately following the ceremony ie ,#.i :ern conveniences.J.A.DAVIDSON. and Mrs Sumter left on the evening|ackaces.When the sumptuous feast|eee ree train for a brief wedding trip.Thev|xe ms ‘i J;6f several courses had en greatly|-are now at hone at the residence of .WN oe ng |FOR SALE—Engine and saw mill,Apply to :Te :©!|enjoyed,Mrs.William Morrison Was!”airs x mies :ae the groom in west Statesville.Mr.|2 .j,,denne shiek ;MES,M WESTMORELAND, Moores- Sumter has for.years,conducted -s asked by the hostess to cistributethe|ville,N,R-b.Dec,31-—3t*. :VF ane &]sresents.and with the opening “of - west’Front, in sty. te His bride is also favorably nown to a number of Statesville peo- le,‘Their friends wish them contin- od happiness. The following named OyStatesville Wm. hing.Her sister,Miss Mary Mar-|Sumter.Misses Marv Yieien and Ber-|s<«aged indebte fi foto]! :thal accompanied her as far "as tha Delta,Messrs.P.P.Purnell,W.“4 indesd ncelved.£0Mrs.Bristol ;a liams Furniture Store...WALLACE BROS, Seesttah:S/W.Miller and Galea Patters ,a most délightful.afternoon,jand)¢o.,Dee.31--4t. AeMiss:Bride Lippard of Barium left te a atenee rt at barsatier will make J corveniale ie WANTED—White girla°to wait ontable.MRS.| RE a r >..3 +.|see ‘2 ati NTED—White girls*to wait on table.5 3. ie ;Tho wedding of Miss Fannie Amelia see that her meeting comes at the :iwe ples§porate ct en Maryville:Cees Me:Hamann ye Mr ‘Tavle *Tavaille Christmas|time.mf ee SEN ee ae ie ore. :ville.Va.;THE DAVIS MILLS will pay $1.35 for wheat. faufman of Danville,Va.,will take plinthewestparloroftheHoffmann ,"one dreaded disease that science has ree RB 4 an raed home,262 West End avenue.Dr.Ed-|been able to’cure in all its sieges,and that ar eles Sees see res ate ward N.Calish of Richmond,Va..will]‘s Catarrh,Hall's Catarrh Cure ty the 5 one Mie nas dete Malem een ae ee cease Only positive eure ‘iow known togtme |lores to trade for Fee ee| nerform the ceremony.The weddine|medical fraternity,Catarrh being a Cash or time.GE.DANIELS.—Dee.24.°} march will be played by Miss Rae Gill|stitudonal disease,|requires a conStl-|-On peny—My entire second floor,over store the Richmond.Miss Babette Danville.Misses Leah 1 Blise Wallace as brides-|at «Mrs.M.KE.Whitener and little son,Maids.Miss Carrie Hoffmann will be|{ AKenneth,of High Point,who visited|her Sister's maid of honor and tittle |9 ‘Mrs.‘Whitener’s mother.Mrs.A.W,|Miss Mildred Wallace will be the flow-|0 “Harris,left Sunday for tneir home.pee.-Tpsgroomamen~will he Mya,C.Watkins visited in Char-|Messrs.Herbert Hoffmann.Isidore)to |Wallac 3enjamin-Hessberg of Rich- seenuanm’fox of Danyille,and ai”nieht,-About 35 couples.Statesville Produce Market. {participated in a dance TVrogt's a caleene prices were paid yesterday Anderson hall Thursday “hitler ObistanatbeverTsnumber.of viresent,inclu issesolmesSniderandFrancesJuliaSalisbury,.bigzie and Ruth,Lee Raleigh oud Sarah Coker 0 most delightful affair it was,The reg- ular programme was abandoned,only being of no ae interest and proft. Then followed’tions.on the Victrola from a yew of with its tempting menu,presented a Christmas aspect of rare beauty.“Jn the center stood a Christmas tree gay with bright colors these gifts the merriment ran and clever indeed had the hostess b four guests present,5werepresentedaChristmassouvemr appropriate to the occasion,The chub tutional treatment.is taken internally,acting dtrectly uponthebloodandmuccussurfacesofsystem,thereby destroying the founda-tlon of the disease,and ‘tient strength by building up the eon- 8 work,faith in its testimanials. a wcrc_MARKET REPORTS. .Turkeys,Ibe.per th.Hens,9c.per Ib,|.Begs,..27¢.per dozen,Roosters,be.per tb,Hutter,16e.per Ib.Beeswax,25¢.per Ib.JGreenHides,tie.per Ib,4 ras anig’isiting young Jadier,We Ans.ie f Athens, z The following prices were paid yesterdaya=themen pent ° a's heat,$1.30 1.rrent events being discussed,th Maat.(nated,(Poe gar.echele-Qata,bo¢.”per bushel. some beautiful selec-”Statesville Cotton Market.On the loeal “market..yesterday 12c¢per ‘4 Here indeed Bs e utiful scéne.The long table :a e long FOR BALE—One 31-82 Holstein bull calf twomonthsold,$20.R.LEE DAVIS,Hidden-ite.Dec.31-2. and mystenions (FOE RENT --Kight-roont-house -with—all mod- |REWARD—$10 will be paid\for sny informe.| |tion leading to”vhe*recovery of the black and|high doed.These wére found to b@ka)white “female ‘setter advertised in’The ake off?on some foible or.chargc-|Landmark a few weeks ago.She was last uetn eet ‘}seen @€n route to Monbo,where 1 had secured ristic of eacit member of the club,|cher from Mr.Rome Saunders.WADE H,n|COFFEY,Charles,N.C.Dee.81- There were only and:to these at. her selections.YOR,RENT—Seven-room,house Race street,one viock from the coflege.Modern con-veniences.MRS.D.A.MILLER.Oct.29 | FOR RENT—Brick wareroom at rear of Wii- $100 REWAR®,$100,4. The readers of this paper will’be eaned to learn that there is at least DAVIS MILLS,Hiddenite.Dee,31--2t: HORSES,MARES AND MULES—I°AM AT Hall's Catarrh Cure || room of Smithey &Fraley,formerly occupied | by the Commercial club.Immediate pos-| session can be given.L.B.PATTERSON. Dec.21.A the giving the. pa- OLD NEWSPAPERS —All you want at 10c.a hundred:Worth this to start fires with.Also good to put under carpets and paper the walls.Come to THE LAND- MARK for them. itution and essisting nature in doingTheproprictorshavesomuchcurativepowersthattheyferOneHundredDollarsfor,any caseiatitfailstocure,Send for list of Address F..O.Sold by all,Drurgtste,Tc.Take Halle Family Pile for eonstioatiqn se ;P.WATT.Nov,30. '4x20 Dressed Bucket Cedar Shingles| V.Wallace of Salisbury.Mr.fT.FOR SALE--Two tots on Park Street.C.°S.}Are the best and:cheapest. It is the| TOMLIN,Jan.4k water bucket isi.adsameCedaryour Mr.Hoffmann will be ushers.FOR SALE—Straw.fodder and tops.Apply |made of.How long does a galvan-|, to R.L.MORRISON:Loray,Jan.4—--1t®.|jged dipper last in a Cedar bueket ? rest man.’‘ Just after the ceremony a reception STRAYED—Sunday, Yad -7 fF weoacta ©oe ytDecember(26,red I nA Cedar.roof costs half as much as citer,dow.female.Reward if réeturnedMto|a galvanized roof.Put the other half B.B.WEBE,405 Center street,Statesville.in a bank at 4 per cent.compound.in-|*Phone 216 }j io ::2 |bi Phone 218.Ere Jat lterest and in 16 years it will double! yYelock..The following out-of-town| a=) mon,and Mr.William Fox of.Dan-}fee ville;Mr.and Mrs,Henry Clarke,the }—be ases Clarke,Mr.Leon Clarke.Mr.|?H.Geodman,Mr.M.‘I.“Hessherg,|Hessberg and Miss)Merlo Hessherg of Richmond,Va.:Mr. Mrs.M.Levy of Faneaster,Pa.Mr.|T.V.iWallace,Mr.Victor Wallace and Mr.and Mrs.D.Oestreicher of Salis-! GINNING NOTICE—For remainder of season |itself,and before the shingles give! _JENNINGS,Jan,4-<3t THE aMThe mar isaClyde Blank-Ga.”:Nad Green Hams,18¢.to 6c.per Ib, “flenship and ,P.Sumter was sol-|Reported dor The Landmark.¢:La Old’Hains 18 to 206,per Ib, Rene re et:emnized Thursday afternoon at 3.30)pe Christmas meeting of the een aS ioe)i tb. ae 5 Ci at o’elock at the home of the bride's pa-Vhursda Atareoon Book Tah was Red Stang)Se,rae pound.' _STATHSVILLE ee ru ane aly F.i,Blanken-theld on Whe atternponiet Eacemmar|“orroolaner Comb,16 to Lke-per TT"¢ Lodge No.487 Ac,era he acinity of Hiddenite,The goth,with Mra,L,B,Bristol,and!al”‘brie. PREPAREDNESS. If any pitparation for war is »needed it’is the business of Un- cle Sam’s managers to provide it and it-is of no-especial concern yet ae to us.But when it comes to PHA helping individuals to prepare finances for carrying on —their — business,campaigns,that is part of our busjness. If you have any money to de- posit,bring it to us.Ikyou need money come in,talk over your ‘plans and we will aid you all we can. iFIRSTNATIONALBA Statesville,N.C.—nok »Capital $100,600.Four Per CentPaidon Time Deposits. U.S.Depository,os ! J.CRENEY &CO,,Tole-|FOR SALE—Farmof 58 acres,near town,N.|e \ 20 dozen cans No.3 Tomatoes,’ While they last I will sell them 3 cans for 25c. additional7centdiscour I wish to take this oppgrtunity to thank the goo ple of Statesville for their liberal support during: and trust you will continue through the year 191 be even more determined to followthepayas you plan.Possibly you might be interested to know the growth in the business has been very gratt tions year. Mr.and Mrs.DavidJ.Craig enter-| {Wis.,-where he.took a snecial course!grote Barty Thursday evening compli-| jn butter-making at the University of |mentory.to Miss Amelia :iwhose marriageT€-\Kaufman takes place tomorrow.eve-|Wisconsin.Mr.-and Mrs.John W.Ayers Hoffmann,| to.Mr.-Louis.Li}* _turned Friday afternoon from avisit’ping,and Mr.William Herbert Hoff). fives at Morganton during the holi-| .days,‘Prof.and Mrs.A.S.Webb and son ‘of Concord,who were guests of Mis.' \Webb’s parents,Mr.and Mrs,Logan Stimson,have’returned to their home “in Concord.Miss Rebecca Stimson, “who spent the holidays at home,has | returned to her school work in Gas-! ‘tonia.~Miss_gone to»My,an ‘haby,who spent a Jolda Shoemaker or Olin has. ome,Ga.,to enter school.| week with Mr.Pat-| terson’s mother,Mrs.J.M.Patter:| ‘gon,at Troutman,and his brother, Mr.L.B:Patterson,in Statesville, Wave returned to their home in Dur-| ime m.| Mr.and Mrs.Noah Summers and | “Fittle daughter Frances,who visited x relatives in Statesville,have returned to their home in Winston-Salem. Dr.Robert Hill is at home “from :Baltimore. Mr.A.G.Moore ‘nas returned to Morganton after svending the.“holi- davs with home folks in Statesviiie. "Miss Mae Paine and.Mr.scar -Paine are visiting rtatives at Se- vierville,Tenn.ae:i Dr.CG.W.Paine.who visited his brother,Mr.I.N.Paine,“has return- ed to-his home in St.Louis,Mo. Mrs,W._H.Warner and children, whoyisited Mr.and Mrs.C.T.Hicks, have returned to their home =n Hick- |yo Lawrence Lee of Raieigh visit- ‘ed in Statesville last week. Mr.Wm.C.Green of Cripple Creek, “Gol,is the guest of his uncle,Mr.H. YW.Clifford.»Mr,Green came to Statesille from Davie county,where he visited his father,Mr P.P.Green. Owners of Building Indicted. Edward L.Diamond,his wife,Ce- Diamond;Samuel Parkin and nubl Simon have been indicted on os of first and second degree laughter growing out of the hi of 12 persons in a fire which ed the five-story Diamond ‘actory in New-York on No-6 Pag ¥ > 4s,Diamond,as_owner,and.her ind;as agent.of the building, rd.accused of failure to provide ad- fe fire protection.They pleaded ilty and were held in The Gist of It. Q é of Chamberlain's Anletel restored to baa ae writes.O i tily decorated for the occasion. ‘handed hearts was played at 12 tables.in *.r .er.\Mrs.William Wallace won the ladies’|pee. land Mr.Herbert Mrs.Van Patterson and), $10,000 herI had a very severe cold and down sick in bed.T bought.two Cough Remedy and ;:il I was ris / ‘only a ‘very,few day amt aa ‘Your druggist will refund money if PAZO yon would know Te aa ey ant ee Pitt Reece who will:wed ~Miss Babette |F ‘ga 2 Ul Oe ,16):(Kaufman on the 12th of |January.| .Mr.H.G.Hallyburton.visited rela-|phe handsome Craig home was pret-| Six-nee o ALENDARS—I want to place in the home of’ev friend a ealendar.Call ‘and get one.4 They aré free so long eas they last.E.G.GAITHER,; PEN AGAIN—Having’been closed a few days "onirs,.1 want me friendseustomerIambackagaA.ro Jan,4,1916 OR SALE—Two mules,two colis,three milch eow 14,some beef ‘cattle.Cash exe time.TOLLAND,Coo!Spring.4 Dee.-<ae >know ractically new leos¢e leaf Ledg-DR.F.A.CARPENTER.OR SALE—PBargain. SL. prize and the gentlemen’s prize went| to Mr.R.O.Self.Miss Hoffmann | was presented with a silver rose vase| Hoffmann with refreshnients were served,The par-|4 ty was a thoroughly enjoyable one|and Mr.and Mrs.Craig ideal host}— and hostess.| ™honor of Miss Amelia Hoffmann,|hride-elect:of the week,Miss | Stephany:charminely entertained a heart party Friday afternoon.eame was played at'five tables and| Mrs.Mac.R.Long .won the prize. The honor guest was siven-a pair of lovelv:slipper trees.Following game| at | jan elaborate menu was served.The|Pine,Cedar,Cypress and Tin Shin-! acore cards and favors were thoronh-/gles,12 grades,at $2 per 1,000 and ly characteristi¢of a wedding.Tiny|yp.| gold slippers filied with confetti were }| given the guests and,they,showered|the hride-to-be with the confetti good wishes.| Mrs.B.M.Etheridge entertained| at her home on east Broad —street! Fridav evening in honor of.her sis-! ter,Miss Mary Newland of.Lenoir.| |Game playing was the principal, jsouree of entertainment.Auction) ibridge was played at three tables and)dominos.at a similar number,The’bridge prize.a deck of cards,was won| by Dr.T.D..Webb,and the domino! a jeatate of &.D.Moore,dedensed,T hereby no- 1)ee *tify all persons having claims affainet his es- silk muffler.Two courses of delicious |jate to eent Sitio to:wa ot S é Leah |tate of ¥ notify «© 1%+eTheAth day of J and!dell County,Statesville,N.C. NOTICE TO CREDITORS. Waving qualified as.administrator of the or before theyvy,1917.W.5.REID,‘th day of Janu alin,Att'y.Administrator,RB.Melaudan.4, 1916.} “e paid for cotton and seed.|Jennings,N.C.ae fs ‘ ORSHS AND MULES—L.P.end C.V.Hen-| RY GENTLEMEN will tell you how to win all prizes at the Poultry Show. The Popular Star of “The Merry Widow,” old:McGrath’s Book. kel are’in “Tentessee buying >horses"ard |4 %*"EHE i ea {| MASTER GEO.McNEILL will be at People’s s (I td C Donald Brian,in |{ 3 :|"Tomorrow ~~| | “The Voice in “The Red Circle” NOTICE TO CREDITORS.| Hfied as administrator of the @s— 3 ».Moore,deceased,1 herebyshaving¢laims \against said same to:me on or before thenuary,1917.W.S.REID, R.B.MeLeuchlin,Att'y.Administrator, Jan.4,1916, Having state to pr “Shingles,Shingles! and this alone is a demonstration that my voods,my service‘is right.Try the cash plan fmonthandseeforyourselfthatthisstorecansave yotmoneywithoutsacrificingthequalityofmerchandis my gin wil be running only*Fridays afd}out,: Saturday.Even exchenge of meal for seed.|C.WATKINS,Statesville,N.C. head will arrive in Starcsville and 100 in Salisbury Thursday.Jan. $1 a dan,4.OFFERS 9 |the Fog.”| A Picturization of Har-| Also Pathe Newsgoodcomedy. and Nails,Ridge Roll,Painted Val-' ey Tin,and Shingle Stain..;C.WATKINS,Shingle King of Ire- BLACKSMIMHING! SEE LINEBERGER for anything in-Blacksmith line.Horse shoeing (No.3 and smaller)60c.;No.470c. Shop rear of McElwee’s Planters’ Warehouse. Thursday The Event of the Week, Clara Kimbail Young ‘and Wilton Lackaye, eee Wie prize.a box of stationery,went.to! Mr.R.0.Self Miss Newland was civen a silk work bag as guest of} honor.A sweet course was served. The special social meeting of the} ReleaticsBook club held with Mrs.M.| R,Adams Thursday evening was ajdelightfuloccasion.The husbands of the club members were invited along)with the ladies,and in addition to) these Mrg.Adanis had a number,of|outside guests.Dominos was played| at eight tebles and Mr.L.B.Bristol) won.the gentlemen’s prize,&pocket!knife,ts.R.E.Clapp,Mrs.B.M. Etheridge and Mrs.J.Y.Foard tied HARDWOOD FLOORS Are porfectly sanitary,clean and easy to care for.Plans for a new house are not complete without: provision’being made for them. In old houses the work is readilylaidoveroriginalfloors,takingthe place of carpets See meor write. “Lrilby.”| Direct from its sensa- tional run at the Forty- fourth Street Theatre, ‘New York.This is awonderfulproduction U.A.OSTWALT,and you will miss a treat. STATESVILLE,N.C...|i).if you fail to see it.The- Jan.4..Box 143.11)prices for this picture for the ladies’prize,a fancy workbag,and in the cutting Mrs.Clappwassuccessful.After the game elab-orate refreshments wére served.ThehousewasdecoratedwithChristmas decorations.;The Iredell Blues entertained theirfriendsatanoystersupperintheir armory last night.*Young ladies of the town entertain-eda score or more young men at a& Piles Cured In 6to 14 Days, INTMENT fails to cure any case Of Itching, omens |}Will be 10c.and 1c.THE REASON I SELL :-Lyric Theatre,Long-Lealf;Kiln-dried Flooring,Ceil- “The Little Theatre ing,Weatherboarding,Boxing andCasingcheapest:is:because the Wat- With Broadway Pictures.” kins’chain of Building Material es-tablishments buy in quantities—anthefreighttoStatesvillefromtheLong-Leaf Pine forest is less than itcoststogettheroughLumberfrom four miles’out to Statesville.C.WATKINS,Next to McElwee’sPlanters’Warehouse,Statesville;N.C, BUILDING?CG.WATKINS. a Lisi i -CANNED MILK.Libby’s Vienna Sausage,—Bagle Mibeo es ecu euexes Lie,|fOF siete sence ee eg es Libby’s Condensed ..........9c.|Libby’s Potted Meats \...y94 Libby’s-Evaporated......+.++’gc.|Libby’s Genuine’Deviled Ham, Libby’s Evaporated ..........4c,Names ie a aed Gera vee ;1 eT “egian Smo iCANNEDVEGETABLES.Ament Sardines a. Blue Ridge Corn ......veeee+9.|Van Camp’s Tuna Fish,1 Sweet Meadow Corn ..j..-++.8c.Cons Gee es ae eee NGIVCEN Ci cj Lumensabdss ...18¢.|Van Camp's Tuna Figh,10c. Pocahontas Peas .....+-.++.ATe.Poe ee ee eee ‘Stokely Bros Peas’.......-..12c¢. ‘Libby’s Green Asparagus-Tips;22¢,Libby’s White Asparagus Tips.27c..No.3 Tomatoes..........4+eh OG. No.8 String Beans .......--5 Ile. Mo.3 Hominy...-l.es eens eee Ge.|OLIVES,PICK No.3 Sour Kraut .........vee BGs : >CANNED FRUITS.Libby’s -Que Libby’s Rosedale Peaches,25c.for... size,for .....Vuue RN bah kee 2c.ioe bs 3 ¢.e Be.size,:Pe ee eyeeeeecryneasige,|Libby's Staffed Oliv Pie Peaches,10c,srze,for...+9G Pnet jt*ta teenLibby’s Sliced Pine ‘Apple,20c,|Libby’s Queen Olives, size,for.6.ieee eee ee ase ek (Ce for 0 A Libby’s Grated Pine Apple,20c,Libby’s large jars:gite)fOr occas RoeermeylonersSAATNCET;OR iy i {CANNED FISH AND MEATS.les,30.size for ss..s<2620Gs Libby’s extra fine Red Salmon,|Libby’s sour mix Piektes,10c.siz Qe.size,for vs...eeeweenee 22c.Or).calls oad wee mare eee Alaska Pink Saymon,15c.size,|Libby’s Sweet Midgets,10¢. OL Bria feaoatwntOA i oLZCE LOR oe as Sig:w a's cache Heron Pink Salmon,10c..size,|Libby’s prepared mustard,’ PON Uv cesigteyohernesey ..8e.size,fOr vrsnsageyanraete Libby’s Genuine Pork Sausage,35c.|Eddy’s mustard dressing,1c. size,LOY secwan ys baa opp tee LOY ka ey eeetNaan ; Libby's Sliced Beef,15c.size,|Eddy’s mustard dressing,10¢, Atoeae ee eon Peeee ec dBe fOR!oj espe errr Libby’s Sliced Beef,10c,size,‘|Durkees’salad dressing,30¢. BGR aS Cac eRe Re TRE OES 5 3 MCs POR ou ecs ee ces eee : “The House of Better Values.” ’Phone No.229.4 The Robert Bunch Cash Grocery Candies for Holidays make -every one happy,They areliciousandwholesome. DI scriminate when you your Candy---select Hu sat our store.=a» W.F..HALL,-~ ENish cif,”Weatherby,Mo.ue ane eterghA ny ene who lind,BleedingorProtruding Piles in 6to 14d|The first application giver Haye and Rest,is Teadigtivad cd eave ocwtvntiane canesalbu i425 peices,. f kant1SaniaaotpkMaliniehningsa, eo ehbaenabinnente neBUILDING?).C,WATKINS.BUILDING?C....WATKINS.PHONE 20.Statesville, Steete ea w.J.James,in Onslow ow explains that it.was anuthisstoryofthekillingy.See ay ie business section of Gordons-+»an important junction pointmainlineoftheChesapeake‘©railway,was destroyed bylySundaymorning. Hicks,4-year-old daughterJuliaHicksofDunn,HarnettdiedafewdaysagofromHer/clothes were fired~-fromgrassintheyardofher n containing a lot of feedstuff,.M.Kerns place near Spen-burned Sunday-—the second‘be burned,on the same spot a year.Incendiarism is sus- *and Mrs.J.C.Kelly of Wins-palem were struck by an auto-le driven by Marvin Weatherman ngerously hurt.Weatherman }exonerated.Both victims.weretoahospital. ral hundred persons were in from their homes and consider-roperty damage was done by-throughout Ohie Sunday.Noliféwasreportedbutthesitu- Was serious.The worst danger to be at Tiffin,Fremont and ice Smith,in Harnettt.shooting in a house and 2 a woman,and John UL.n the samejail\for attempt-lease Smith and offering atoajailguard,and three other 3.escaped from jail*at Lil-last week. pee been Sentinel.willenlargeitsbuildingandputinanewandmodernpress.The Sentinel is a “paper and the mechanical workitisfirstclass.It has now the L press work of any paper thatestoThe.Landmark with the pos-exception of the Asheville Cit-’The Sentinel’’is fortunate in ng a pressman who knows his county yc E.Johnson,for 16 years post-r-at Ivor,Va.,anda Confederateveteran,cut his wife’s throat,brainedBFwithanaxeandthenblewhisheadoffwithashotgunattheirme,early Sunday.The deed wasntnessedbyacoloredgirlemployedneighbor.”The crime is attrib-‘to insanity.Johnson was 70 8 old and his wife 15 years,young- wo mén.two women and_threeren,all starving,who had beennitfoodother-than a few smallfor15.days,and the body of an,a victim of starvation,were at Triangle lighthouse,near theitancoastintheGulf-of Mexico,ember 28,by officers of the hip Mexieo.They were givenstarsé.Their condition was ‘due ¢of supply ship to arrive. New Advertisements. 'P,Jennitigs will gin only on Fri-anfi Saturdays hereafter.Horses sind”mules,next.ThursdayHenkel-Craig Live Stock Co.“Two'ldtson Park street for-sale—‘;Tomlin,°aw,fodder.and tops—R,I.Mor-Loray.id for return of red Trish set-“By Webb.hd.Craig,trustee,will sell-lots |S.Reid has qualified as admin-trator of S.D.Moore and Mrs.S.re.’Calendars for’all ‘friends—E.G. ps «from Iredell Hardware olive specials”tomorrow.‘Statesville Drug Co.>Allen’s*?Princess:.ranges.—Craw- |FurnituresGo.-ért Bunch Cash 4 te §at.the op-house Friday night.wiAttheLyrictoday,-tomorrow and y-+ hing to build with—C.°Wat- Blacksmithing—Lineberger.Mary Puller in “Under SouthernSkies”at’Crescent Thursday.;~Simplex gas plant for ‘cooking andnge—O,P.Lyon,agent.fe uiarity of ChristmasiantsandFarniers’~Bank.ring stock now YFeady—Wallace Oe SeaDon’t Lie to Your Wife”at operaétonight. ster Geo.McNeill,at People’s nd Savines Bank,will take sub-criptions for Country Gentleman. M and Bride Go to Okla-oma-——Eufola Visitors, Correspondence of The Landmark. Enfola,Jan.3 —Rev.J.L.BrowndthepulpitatShilohSundayfor-L,Moore.’Miss.Mary Abernathy is very ill athomenearhere. Club at a oe batidey visitors are all leavingeirworkagain.Mr.Ross Fox-ride,née Matite =,Steele,left |the 28th of December for their|he at Banner,Okla,They will‘friends at:Indianapolis and St.they go back.Mr.Fox wasiedbyhisfather,Mr.N. hur Steele and Miss.Nan-n of Statesville came outattendthe‘marriage of :Mr.B.L,andieandLenaYavisalso teele started to Kinston ‘pending _the ‘holidays lon of Shiloh willlehem:school*invited _to!the day, Won't CoreonDr. ~{Charlotte Observer. be ee the...Southern. “*Comginning January Ist,and this factory +the Canadian.side and ivitherefore not |the Nitrolee plant the only one of the ao i mates ||BY VIRTUE of the powers”ontiined in al|i nd mother,Mr.and. ivoire eeeie ean aT-Nitric-Acid Plant, Four tons of nitric acid daily willtheoutputoftheNitroleeplantElectroChemicalpanyatGreatFalls,S.C.,be- will be the only one of the kind inthecountrythatisproducingnitricacidincommercialquantities.It wasstatedintheObserverseveraldaysagothatthereweretwosuchplants in the country,the other being at Ni- agara.Falls,but this.factory is on in this country at all.Yt is operat- ed by the American CyanamidCom- pany but has always been more of anexperimentalproposition.Thisleaves| kind in the United States.The fact that America’is absolute- ly dependent on Chili for its supply of |joss of-an eye when a companion firednitricacidandthatineaseofapro-| tracted wary the United States would) be seriously hampered by attention of the government experts| and they are now casting about for a) new source of supply.This’is to be) had by means of the extraction of ni-!trogen from the atmosphere and the only plant of this type is to be found in piedmont Carolina,just 50 miles south..of,Charlotte. interests that control the Southern Power Comapny.—The Landmark.) Personal Mention. “orrespondence of The Landmark. New Stirling,January 8 ==.Miss! Bertha.Stevenson left Friday morn-| Ling for Florence,S.C.,where she ax- nects’to:take training for a nurse.| Mr.W.R.Stevenson.accompanied| her .to.Chester,where’we spent:the week-end with relatives. The following teachers have re-! turned to their schools:Misses Mag- fie and Alice Stevenson to Davidson,| Miss Mabel Stévenson to Leonard’s and Miss Janie Gray to Lingle.Mr.} Harry Moore has returned to schoolinStatesville.| Mrs.._Janie Knox and children of| Poplar Tent and Mrs.Mamie Sifford of Charlotte spent Christmas with! their mother,Mrs.J..F.Moore.\Rev.| G.E,Kidd is visiting his mother at} Fayetteville,Tenn.Mr.and Mrs.L.| A.Pope and Miss Eulalia Pope visited| relatives at Woodleaf.Messrs.Orren! and Ralph Summers of City Point,|Va.,spent ‘Christmas at home.| Mr.J.S.Moore,Mesdames W.Ev and Martha Morrison,who have been! on the sick list,are improving...Mr.W.E.Morrison is laid up with.ajstrainedleg.| Sale of Telephone Stock—Presi-|dent Grier’s Statement.| Correspondence of The Landmark. IT am advised that outside interestsarebuyingstockintheIredellTele-phone Company.The purpose of the vurchase is not disclosed,but I think it proper to put stockholders on guard and to say to them that the company hasan offer of par for all its stock,which offer is to be passedonbythestockholdersattheiyannu-al meeting this month.Until themattercanbethoroughlyinvestigated,stockholders are advised not to sell.;H.-P.-GRIER,President,eneOSLER Twelve deaths from accidents andsuicidesmarkedthefirstSunday‘of|1916 in New.York and its vicinity.|“CASCARETS”FORACOLD, BAD BREATH OR SICK HEADACHE! Best For Liver and Bowels,For_Biliousness,Sour Stomach |and Constipation! Get.a 10-cent box now.|Furred Tongue,Bad Colds,Indiges-tion,-.Sallow Skin —and Miserable!Headaches come from a torpid liver| and clogged bowels,which”causeyour’stomach to become filled with!undigested food,which sours and fer-ments like garbage in a swill barrel.|That’s the first step to untold misery |—indigestion,foul gases,bad breath,|yellow skin,mental fears,everything |that is horrible and nauseating,AjCascarettonightwillgiveyourcon-|slipated bowels a thorough cleansing |and straighten you out by morning.They work while’you sleep—a 10-cent|box from your druggist will keep you}feeling good for months.Millions of }men and women take a Casearet now!and then to keep their stomach,liver)and-bowels.regulated,and never|know a miserable moment.Don’t for-get the children—their little insidés|need a..good,gentle cleansing,too. TRUSTEER’S SALE OF LAND.ides {BY VIRTUE of the powers contained in atdeedoftrustexecutedbyM.L.Cowan andwife,Alice Cowan,to David J.Craig and theHenkel-Craiz Live Stock Co.to secure the in-|debtedness’therein mentioned,said deed oftrustbeingrecordedinBook35,paige 566,-of| |the records of deeds in the office of the Reg |sister of Deeds of Iredell county,N.Cy de-jfault having been made in the payments of thetrenttherebysecured,the undersignedtrusteewill,on |SATURDAY,FEBRUARY 5, jat 12 o'clock,m..sell at public auction,to thehighestbidder,at the court house door inStatesville,North Garolina,for eash,the fol-lowing deseribed lots,towit:|Two lots,Nos..7 and 14,Block C,of the}Cowles property in southeast Statesville,50fectonReynoldsstreet,and 50 feet on Harri-|son‘street.For better description of the aboveseemapoftheCowlesproperty,registered intheRegisterofDeeds’office of Iredell county,|Book 27,page 165,DAVID J.CRAIG|Jan.4,1916.Trustee,'|TRUSTER’S SALE OF LAND. 1916, |deed of trust executed by J.A,Young and|wife,M.d.Young,to David J.Craig,trustee,|jantl Henkel-Craig Live Stock Co.,to secure the}jindebtedness therein mentioned,snid deed of|trust being recorded in Book 35,pare 443,ofthereeordsofdeedsintheofficeoftheRegr-|jister of Deeds of Iredell county,N.C.,defaalt |having been made in the payments of the in-!idebtedness ‘thereby “secured,the undersigned |}trustee will,on .‘SATURDAY,FERRUARY 5,1916,|WeI2Weloek,m.,sell at publie auction,to the!ihighest.bidder,at the court house door in|‘Statesville,N.C.for eash,the following de«!\seribed traet of land:ete|Beginning at a stake inthe center of Brook.|jlyn street,Bruce Fleming's corner thence(south 22 demrees east 265 feet to a stake,saidjFloming’s corner,thenee north 22 desrees west |}266 fect to a stake in center.of BrooklynjStreet,Mrs.Mills:cornet,thence with.center,Of anid streét N.)oo degrees cast 186 feet to!the beginning,containing one here,more or!DAVID J.CRAIG,} Trustee, isJan.4,1916, |Democrat in polities. reason of Invigorating to the Pale and Sicklytheglackofthisessentialingredient)rhe Oj Standard general.strengthening tonie,used in the manufacture of high ex,|GROVE’S TASTELESS chill TONIC drives out plosives,has commanded the serfous,M (This plant was promoted by the!| q Fi 4 ~Justice Lamar Dead... Joseph Rucker Lamar,Associate}’ Justice of the Supreme Court of theUnitedStates,died at his homey in|@ Washington Sunday nightafter an.ill-|_ness’of several months.”He was 58yearsoldandhadbeenontheSu.’preme bench five years,Wife andtwosonssurvive,;Justice Lamar was a native ofGeorgiaandhisfirst“~publie service was in the Georgia Legislature.In1903he’became an Associate JusticeoftheSupremeCourtofGeorgiaandcontinuedamemberofthat.tribunal until 1911,when he was appointed an Associate Justice of the Supreme Court of the United States by.Pres-| ident Taft.Justice Lamar was a) dentek Gaxn ie Macey tac eeees’but:3 one {antee like this.Why don't you “eo ™&BehnBENOMNT Saat ¥:co #EXECUTOR’SADurhamsmallboy‘suffered the NOTICE. Having qualified as-executor of Miss Sara M *Smith,deceased,this ie to notify all.personsablankcartridgepistolinhisface.who have claims against said dstate to pre-nearanenmatamanrine enema .sent them to the undersigned on or before All persons indebtedtosuidestatewillpleasesettloment.; J.B.PARKS,Stateaville R-T,Jan.4p-1916-—*Executor of Sarah Smith. in bar of their recovery: make immediate lariayenriches the blood,builds up the system,true Tonic.For adults and children.60e, = COPPER.BEARING INCESS LO zy We r e ie a t e y We a ee ed ee x PE K TO R U BN W ) . Ni v a u n EE E ih in t rx EE E Aa A a r s PY OT VE D TA T re THE FOUNDATION OF A HAPPYHOMEISLAIDIN-THE KITCHEN. Go behind the scenes of any happy contented familyandinmostcasesyou'll find the secret in the kitchen.A dependable range lifts mother’s household worriesandendsfather’s late-meal troubles.Equipped with eity water connection—15 gallon.copper reservoir.See them at : Crawford-Bunch Furniture Company. ———conan.PYLON E400.tema. wo bl Wa n e ! TO T ) DO B U a D Ta i Ta Ta TA R T O X A Y S rx EO E Tu c mA TI aa n ES O E K Ye bay tee tae yite | January 4,1917,or ‘this notice will be plead | Ee e ee e Cm a m A n a n i a ac e Aa Ce e ee 3 ~Prid January epis:”ne.ae i ee a The thrilling,brilliantly tuneful comic ot.#6 we ‘om i“The Chocolate Soldier Just as presented in New York with a chorus:of50.Beautiful scenery,wonderful music and beautiful”chorus.This company carries their own ‘orchestraofpickedmusicians.‘i .f Seats on sale Wednesday morning at StatesvilleDrugCompany. Reserved Seats $1.50;General Admission $1. P.8.This attraction was secured by giving them abigguarantee.It is positively the biggest attrac-tion ever brought to Statesville.If you want thiskindpatronizethisattraction. R.V.BARKLEY,Manager. tittttresessysraehsecsseceessaze sees teistsesieetsrasesterstaseteeseesstsgeeetageeetteteeteateeetetas fetta ih pierpeemrsersicmmnenns | fs 1916. We wish forour friends —-]- and patrons the happiest — and.most prosperous year of their lives. Complimentsof the Season The year which closes today has. been the best we have hag.Evéry ,department of our business shows a god increase.For this we are deegiv grateful to all who have help-. ed to make it so. In our dealings with the public we have tried to be fair and square. Those who ate already.-our,geustom- ers we want‘to keep and we want their good-will in drawing onew customers to us. To all our customers aud friends we wish the complimentsof the season and may the year which begins to- morrow be your happiest and most prosperous. Carolina Motor Comp’y, Statesville,Mooresville and Newton.7 = SSSooseeeeeee ee eee Tee Palm Olive Special Three Cakes Palm Olive Soap I'REE with each eash purchasepeeeae A 50c.Jar Palm Olive Vanishing Cream =SCV eds of Palm Olive Shampoo.| ville Drug Comp’y,|Quality Prescriptionists. A 50c.Bottle States 'A Year of - i HaeRes eatr a|Statesville Housefurnishing Go. PEACE AND PLENTY ¥**® ¥To Our Friends and Customers: a4 rye hoePWC ROTH PROP C RS ORS January,4c 16 ‘tems of Interest About Various: HE UNITED PAN-AMERICA)ES4David.wialias Jobe Hubbara,*»years olf,claiming to be a physi-John Barrett 8‘s Suggestion as 40)os,an and giving Asheville as his home,-sthe Possibilities. )Was arrested in”Washington.Friday|Jeweler.Washington Dispatch.Ree aha nae of obtaining goods under \The‘place of a united Pan-Ameri-80 RV CUNnUTE aee-in ihe syouualies wae)om Mid m.Waldorf ‘Astor,who 16 years| #f On’r 1 t ld hee ==front the world at tne-end of the Bu-}2%renounced his lerican citizen-)3%Ww p vopean war,was pictured to the Pan-||thip té:become a British subject,has e CO,cA reLeeAmerican.Seientific congress by Bi-|¥een made a baron by King George.|dk Valin ead lesiacmer gabere ae aiseate aM cert cel ue bole Gee BE arpa gc tnelPiro Friday destroyed the South!i Be |Monroe doctrine into a Pen-American |(tienago plant of the American Lin-,iq Heater will bring glowing —|MOU Oe he dere ‘id “Tinea ‘Oi braneh,caused ie warmth and cheer to every Btypemotor delivers:more power by 10 to,16 percent,||thetthe Latin-Ameriean.republies,|0°}sl Wheatsxotosien or bummed BH rOOM Of the house.With the t .°Vpes z ,é [ia the vent.that the United Statos the *result S fares nen,ween i 1 feectsGoronyetnauaachthokotthenednd}sere aitaeked by a foreign foe would. °vroperts loss of $2,000,000.Perfection Heater near,you greater economy:ue an either of these types pr ith all their ‘physical and moral.Fifteen |persons were instantly kill-|pam fi 1 because itelintinates waste.io A iforee,stand for the.protection and)cd.a score of others injured,some yt can dress in com ort,cican in com-}sovereionty-of the United States just erobably fatally,-many-raihoad ears one nd hie: The impact of each explosion.within the.cylinders is ap-iis quickly as the Untied States un-}were destroved and.other proverty Han fort,set the table:in comfort,1 i plied’airectly against the piston heads,consequently the der corresponding circumstances|-ffected in Monterey,Mexico,Thurs-ma live itt comfort generally.aor | 1I. xr eS tand for their integrity.andjjayv,when bex cars containing:dyna-mn Aya rata fs ‘}|By.)«elie f Dente eThaknore sa nae nate \rarelghty.”A rutte and hand grenades for the Car 3 The Perfection Lives 10 hours OE Tee oe :e ae ;"Wherever the Pan-Amertcan deld)ranza arniy were destroyed.by an ex-| A He 'eates @athered the director general's plosion.|glowing warmth on one gallon of AS a reminder:?Why.not make this an Automotbile ideclaration was disenased with the eft McCarn,former United St:ites |Se oil Clean—quick—convenient. Christmas.”ere interest,and if was rewarded!district attorney fer the Territory of |Be ; i ener 2c See of the paced 4 ae a oral in ver abies o last)Use Aladdin Security Oil or Diamond ;$9.HEALS.ne Congress.pointing tHe |week and exnlained that he gave up :;¥- States V ille Motor Com V wav to Pan-Americon unity,'nis position “hecause he conld not he;”eae oe to on H best results in Oil ©“Roth victor and vanouished in|both honest and happy”in it.We will at toves,Lamps an eaters. ‘“QUALITY FIRST..European war will a pone it torctura to his home at Nashville,"Tenn.!|:NY \micrica cnt the close of hostilities,”i MeCarn was appointed by Presid ,a J OMPAASK.US.pa "PHO YE 140.jhe said.“The formes will say it°won)Wilson two years ago and.resig |a STPAND:ane OT,iG P ::in spite of the attitude of the United |some weeks ago.oe yALICINALaaa LasasaiaaaaaGs ‘States and the other American repub-!°«(32 gacoh S.-Goxey,a wealthy Kt yt sek Maven stale Fe ns StowRAbaocEORIONANGORA:ocramorereone |les,and the laiter will say,it lost be-|manufacturer of Massillon,O.who)(al Note vin Chethnen Wee Aa eTh 5 oof tha,attitude of the United)rafted notoriety in 1894 by leading an)Richmond,Va.Charente Bos Cte 1 Ae if e ~Ss ’states and its sister republits.oymv of tramps to Washington,which rs 2 “Tn the minds and thoughts Of C¥hb des «yon!Vea tte »designated the ‘Common eal Ar-|;ivybodyinterestedin.FP an-Amerigana|x,”ih nurpose being to show that!>Bay Look for the Tri- jiem is the>que!sO “What is going|bia ska ¢k,has ia |al 3byeeei#@ men were out of work,has come anole ‘Trademark 7 maopen 2 Pan-America when ‘this|(j,the front,again with the announce-|iii ¥.war da over?’Tmtmediatoly there i8}want ay »fc J ae ‘e reply:‘The American.republics.oe ibaa Senater gona pee ets ;In many styles and te rothey mt |*4 he ao pee ie teat ok The probationary system of disscin-|$izZes at har dware y "|ine adopted in the navy during the fe .etaran weltsNaa ‘oS oa deplore +year.is described in the annual pe and general stores ‘:nation or a group of Euros!"oor of Advocate General Mclean |everywhere. es nen nations.following this struggle,‘jas nroducing satisfactory results,Of-): Yours tor the‘Price,oesundertake any territorial ag ‘fenders under detention have been re-|BR \fF %21 *efrvsahdigerient’in {he |<aeaen AEaaRA luced from 1,885 to 740,waite the,na-|i Highest cotand DominePedi crn or in any way take ‘dction that |")y hag.tid .seelf.of,-'y278 more 4 meen 8.M.&H.HOE oe vould contravene the Monroe doctrine,|“ronic,offenders during oneration ofog”¢9 Bit -must.ta borne in:mind and cannoof|the svstem than in any of the three|ba.bo 1m t q The One Price Cash Shoe Store.he fora moment overlooked that |vreceding years.aieoe:lwhateyer way.th “results th At Los.Angeles,Ga Mathevw AY}Your Shoes repaired while youwait.ae he TRUER ho love for the ti sie ‘convieRee of-firssdostrec|KA States and the other nations which|murder as the accomplice of James B.| FRRERORCROROALPPRFEPORRNAD.OD OIE AIT OHPOHOOR ASO FORO |ay América.iMeNamara in the blowiag up of theLosAngelesTimesbuildingfivevears|‘go,The specific charge was of hav-| efforts to preserve.their neu-|ing murder ed Charles Hagerty,one) and tr-no way interfere on|%f the victims of the Times*e?<plosion.|°°aaa:6 :hee ofthis.soniiee the:wiany :jury fixed nunishment at life im-| ;K J B iasssiors ond the war power of the)crisonment.McNamara —conf ised| or arenes —moses cnapns tennant ohleestbipenetiigprenneaaiaaeee The new Gypsy Boot—the low heel,doth top,patent vamp—Button and Lace. Groyer’s Soft Shoes for tenderfeet. School Shoes for Children. ov g n e n s v e c s e n s o n s ™ “ENTSOROWRIAORCODAIRA|TT fore;how just andaietions\et America have been o and "ths government of the vie-|’fixed the bomb ‘wnat blew up|mes plant and was sentenced to} tifo~imprisonment,| TWALY OUTS eroup of natiéns may)force ara Pan-Americanissm,to- -yelationshin mntrics of the west a |which will demand absolute solidari-'A Renident of Statesville Shows the | ity of action on the part of the Amite Way.| os ‘to.prcserre thelr vere: »Issued by this bank bear interest from date at the rate of 4 per cent per an- num.Savings Deposits 4 per cent,There’one fective way 9 relieve]a Light a this.terrible though’“idney backache,|eee s i ga Pay.it credited quarterly.regrettable’p hility “one supreme;_Liniment ‘And.plasters m:ay relieve;W Gg Nae PR -PUR-PER"“ands ot A-that is:Tf alas |5;Boas pone tht stands out.otha a:Ht alte ;|f PERFECTION, ere foo ow to.succeed .in.des,ik Hines a An nenes io pavsea i f ;. i<travine the sovereigniy ef the Unit-)Bas Uy eee mmeh tao ee y se::|States it woitd only be a question|Bechache is cause,to suspect fet time when that tue would destroy,kidneys.‘~|:::g the sovereignty of every other Amertl®-Daan’s Kidney Pills are for.dis-! “’4 Ss can .|either large or small cordially invited.Lean repekiic,lordored kidneys.Y \In turn there is no -doubt whatev fxs vail |ny that if any foreten fee ever suc-|Statesville people back them up. ceaded in extending its dominion over Read a case of it. Hin-considerable part’of —Latin-Ameri-| na,ahd if the nations of Lai ~meri- thonld become epepdencies,itiCONdepegdencies,it apefromPeople’s Loan ae wenos Bark.bccn ua ans Ge tiny back,“and eness.a Ree | :44'ifrf rf74 17“3> ry P r WS T I E T L I P I S T I S T T SI N T }Checking Accounts pe e c o e s s e o s s s e s TS r i t r i s s s s r l s t s s We want your ‘business. i Keonuse no fobelen fob ceputa ‘achiev slecp well and seat q bss "bein :ir i iMy kidnevejsmaeharesultexceptbyavietoryover|aul tired out."My kidneys didn’t f na Phi +lthe TInited State cence:¢“yright and TI was nervous and di a nit eee i Pean’s —Kidaey Pills,procured f“All Pan-America wil!therefore re-:; GEO.HH.BROWN |:1 President,toice if this conference shall give the Pall s’Drug Store,made me well,” a hi Aention.thoueh tt misht nov.be (Statement given March J,1912.)aa —O.L,TURNER :Cashier.lable a nae a nent aie te te ott On March 6,1915,Mrs.Reavis :la political eathering,for the actual |jadded:“I back up oyery word of iy-yolation of the Monroe doetrine Ini gormer endorsement.Whenever my a Pan-Americon doctrine whicheigo)|Hdneys ‘cause me any trouble,2 few naan that the Latin-A.serican repub-||dosés of Dexn's Kidney Pillsgive me in the event the United States |relief. e attacked bya foreign foe,wotld.!Price 50e,“at all dealers.Don’t i |vith all their physical ‘Wd mora!)ree ask for a kidney I —pot |:ee Ks aforge,stand)for the protection “andl Hants Kidney’Pil—the same that In extending our greetings toysovereigntyoftheUnitedStates+just!::ert y OF STATESVILLE,N.@.lng quickly as the United States he Mrs.eavis ‘had,Foster-Milburn Co.,|=‘der corresponding —_circumstan oe Buffalo,N.Y.at this season,it is borne in upon would stand for they s sovercignty and)Goce :ee hinitegrity.” :: _our minds that the choice Citizens “Capital Stock Paid i in $100,000.00 mic.roots Only Hope For Rea a Pace:New Year =who have made prompt payments _,Surplusand Profits 31,500.00 “Be pawertat vitecna qauet telvaniec op -for good goods bought of us dur- ‘powerful international tribunals:op- erating under a definite code of laws ee 1 e25 :‘5 : alone,lies hope of world peace,Eli-|He ee ral j ei ing the year increase ‘our-“Prepar-Members of Federal Reserve System,fe Moot.tormer Socreiany'of Biate,owers land Senator from New,York,declar- ed in an address in Washington this.edness”?to serve ‘you better the iweek..He was speaking beforea joint 6 |::7.Si SetYourBankingbusinesssolicitedandisessionofasub-section of interna-_ae coming year.We thank you,and tional law frem ‘the Pan-American every accommodation extended to de-[Scientific Congress and the Americanpositorsconsistentgwithprudentbank-Sica we %,2 is a6 a‘'i a8, ing methods.|“The Christian Church |has been We have provided well |New Year.Buy from us and be t ‘d ti d =jurging peace and goog will,among .].2 i 1 °on time i rimen for 19 centuries,and still there!*7 ‘s ‘coat eh)1avUEY. Four Ber me pel =ee,iis war,”said Mr.Rooz.“Concerts of|with If lowers for all New ¢ad sh Deposits remainitte on deposit three Europe and alliances and ententes :* P P fond skillful balances of power all lead)Year functions,and for months or longer.\jultimately to war:-Conciliation,goed|=yi ;<5 jwill,love of peace,human sympathy,|New Year Gifts for the Pe Py hy Se lare,all ineffective without mstitutions ; OF i IC ERS:jthrough which they can act.Only||young ladies who aré-al- the”possibility of establishing real 'Say» W.D.TURNER.a ao President,irestraint by law seems to remain to]RI nejot)rB.MORRISON ~View President ine fect’to the ‘andopeted:will of |Mens appreciative of your;;.ithe vast majovity of <nanxind.” -D.M.AUSLEY,“mn =Cashier,|.“When-this war is.ended,the civ |thoughtfulness mn sending G.BE,HUGHEY,oa Assistant Cashier,lilizedworld will have to determine}Howers, wish you a Happy and Prosperous \whether what we’call international law is to be continutd as a-mere code of etiquette or is to be a real hody of laws imposing obligations much more||definite and inevitable than they haye:it.We don’t nent to know much about hee been heretofore,It miust be one thing|}=weather,but we do know how to tepair leaki os phi agence .:°|And how about giving your car a compl “We are in the market for several million feet of\Old Field |Bad Gold Quickly Broken Up.Van Lindley (o.,|We guarantee our work to be as “wood as Mrs.Martha Wilcox,Gowands,N.¥.,|eee ree at once or to:be contracted!for next guatie ee ae sr nerinlits.:.Coughs All purchases on a cash basis.Forkity ‘absot ehe SHANE aay.AN abet time!GREENSPORO,H.4%.ST AT ESVI LLE ] I And a hard cold and.coughed most of theCEHOMBREZRCO.,Geo)H.Myers,ine,i mpetias bose rie Enecct:tt|Dalle Gray Drug Co.)|ASK Us cough entigély ces ei have told iooektf:of my friends of the,good received through|using this medicine,and.all who.have used.it hecalAgents speak of it.in the highest terms,”Obtainghle 2everywhere.| The Wallace =Wh Dry: Now Ready For Inspection! O G30 -0O Preparednessis no longer an issue with US.Dyes or no dyes; high priced’cotton or no cotton does not concern us now. We own the merchandise and are fully prepared to supply your wants.Factory products from more thana hundred Southern fills are represented in our varied and extensive lines,and to the discriminating merchant “Made in the South”on cotton goodsis as “Sterling”on Silvet.A full dollar’s worth for a dollar.7 Throughout our entire stock we offer as good values as can be had on anymarket North or South.Remember,too,quick delivery and you save the freight.| To customers and friends who know how we can and do serve them,we deem it only necessary to return thanks for their loyal support. To merchants unacquainted with us we extend an invitation to call andbeshown,the latch string hangs on the outside. Let’s get busy and make it a bumper year.| \o .Mate in the See The.Wallace Brothers "i “Made in the South”| ISN’T ENOUGH.ISN’T ENOUGH.(|] lein the South,”}:—Statesville,|N.'“Trade in the South,”| eee J ANUARY V ‘THAT’S THE ‘STUFF!|| i a, _ ( — i m i m i w n ~ . o . . . . . . . . . . és 9 -fore the arrival of the firemen‘the‘whotel people located the fire under The4 “age on.belligerent vessels. 1 NAIM~~°STATESVILLE,N.©,FRIDAY,JANUARY 7,1916.NO 47. 10 FIRE HOTEL. ed Under St.Charles Building »—*ChurchhtFire.°.Hees Iding,better known)as the Yharles Hotel,was made early Wday morning.An employe 6f el was aroused about 2 o'clock e odor of smoke and immediate-tified Proprietor George Pappasdcalledthefiredepartment..Be- the rear of the portion of the build-ing occupied by the Statesville Print-ing’Co.and managed to.extinguishtheflames.When the firemen arrived athoroughsearchofthepremiseswasmadeanditwasWoundthatthefirewas.of undoubted incendiary origin. es found by the hotel peoplecame.from balls of twine placed~infsmallboxesandsaturatedwith e e~oil “A>eandle---had..._been, ‘\in one of the boxes and ar-d in such a manner that thetromthecandleignitedtheball when-the candle burned downinpoint.In addition to the ontaining twine,another ball@:which had also been satu- with oil;was found under.the 1 kitchen.+:eg yesterday no clue to theidentity*of the person or “persons‘guilty of the attempt to fire the building had been unearthed,but_theofficersaréatworkonthecase.Deputy‘Insurance CommissionerScottofRaleigharrivedyesterdayaf-_terndon to assist the tocar officers intheirinvestigationofthefire.The fire department was called tothecoloredBaptistchurchabout9.30o'clock Wednesday night.The church building had caught fire “trom thesheatingfurnace,but the.flames wereextinguishedbeforethe-fire truck-could’reach the scene.Little-or no damage was done. Senators Talk About Affairs. Bonds of restraint against public discussion of international relations of the United States incident to the Eu- ¥opéan war were broken in the Senate Foreign -Magpenday-and for more than aw hourPsessionwasehiivenedbydebateoverthegoyvernment’s.neutrality poli-“exports of —war—munitions andby"American citizens on bellig-“owned ships.ere was no division of the debat- ong party lines.Senator Jones of Washington,Republican,denounced asunpatriotic”American ‘citizens whoimperilledthe.nation by taking pass- Senator rks of”California,Republican,as-Serted|that the.government of theUnitedStateswas—“hypocritically”~elaiming to be neutral when it was infactparticipatingintifewarthrough the’sale of munitions.Senator Lodge,ranking Republican xember of theforeignrelationscommittee,declared that to place an embargo on arms now “.wotld be worth more to Germany than&million men;that it.would’be a“grossly unneutral act’and would,infact;make the United States the ally ‘of “Germany.Senators O’Gorman of New York and Hitchcock of Nebraska,‘bath Democrats,urged the advisabili- ty of an embargo on munitions.Sen-ator O’Gorman also informed the Sen-ate that American Consul |McNeely,who lost his life on the British linerPersia,had disregarded the advice ofiericanConsulGeneralSkinneratLondon.that he make the journey to Aden on a Dutch vessel. Mr.Dick Gill Dead —To Be Buried Here. .Mr,W.C.Gill,familiarly known.to Statesville acquaintances,as “Dick”Gill,.died yesterday afternoon in a hospital in Richmond,Va.,death re-sulting from asthma.Mr.Gill,whowasanelectrician,was at work at _City Point,Va.,when he was takenillandwasmovedtoRichmondbyhisbrother;Mr.Harry Gill,who lives.in Richmond.Mr.Gill was a son of the late Mr.7 —Mrs.T,A.Gill and was 38 years olds He is survived by one brother,Mr,Harry Gill of Richmond,and foursisters—Mrs.J.C.Somers of,Jack-sonville,Fla.;Mrs.W.C:Moore andMrs.J A Knox of Statesville,andMrsW.H.Coffey of Olin.©Mr.Gill’s remains will arrive thismorningandwillbetakentothehomeofMr.W.C.Moore,where the‘funeral will-be conducted this after-noon at 4 o'clock. ‘North Carolinians Suggested ‘.For Supreme Court. _“Ai movement was started in Wash- ington this week to secure’the ap- “pointment of Senator Overman—of North Carolina as suceessor to Justice Lamar op the Supreme Court bench, but the plan was blocked by Senator Overman,who refused to become acandidate.Senators.Overman and SimmonsweretocallonthePresidentyester-day to discuss the appointment.NorthCarolinianssuggestedfortheplacearéJusticeAllenofthe,State Su-xreme Court,Judge Conner of theederalDistrictCourt,C.W.‘TillettofCharlotteandJudgeLongof Stine Preside “nd iThe.President may not appoint aNorthGarolinign.ohn W.Davis ofWrestVirginia.is suggested and thereisasentimentamong‘Democrats for former,President.Taft., “Bight or more lives were lost by the.sinking ofa river boat near Par- akexsbu Va.,Wednesday {ih ie ‘attempt to burn the,New:York }- STOCKHOLDERS’MEETINGS. Annual Gatherings of the Own- ers of Banks,Mills and Other Industries —General ‘Good Showing. The stockholders of the StatesvilleFlour.Mill held their ‘annual meeting Tuésday afternoon.The old board of directors was re-elected as follows: L.C.Wagner,Geo.H.Brown,A.L. Coble,C.L.Poston.T.D.,Miller,F. Ay Sherrill,J.BE.Sherrill,the last hamed being of Mooresville.Mr.Wag- ner was re-elected president,Mr.Brown vice president,and Mrv FY Ay Sherrill secretary and treasurer.,The officers reported a satisfactory busi- ness the past year.In addition to paving the regular 3 per cent.quar- terly dividend each quarter during the year,an extra 4 per cent.divi- dend was also paid. At their meeting Tuesday,the stockholders of the People’s Loan & Savings Bank re-elected directors as follows:-Geo.H.Brown,W.L.Math- eson,J.A,Lackey,D.--F.Jenkins, Zeb.V.Long,L.B.Patterson,W.C. Wooten,L C.Wagner,A.L.Coble, J.A Conner,J W.Koon,J,R.*Me- Lain,W.,A.Thomas,A.S.Alley,and L.O.White.Mr.Brown was continued as president,Messrs.Matheson.and Lackey as vice presidents.and Mr.O. L.Turner.cashier. The report of President Brown showed that the gross earnings for the year were $9,683.86 and the ex- penses $5,407.18.The net earnings for the Year were $4,276.68,and this added to $953.67 brought»forward from last year made~atotal--of-.$5,- 230.35.Of this amount.$4,000 was added to the surplus fund,-leaving undivided profits of $1,230.85,.The statement of.business made by™the president showed a gratifying in- crease for the year—the net earnings amounting to 8 1-2 per cent.The re- port states that the bank has sustain- ed no.losses since its organization,is economically managed and with’the good financial,standing it has©its prospects for the future are bright. The annual report of the officers of the Merchants &Farmers’Bank, made-to the stockholders at their an- nual meeting this week,showed that in addition to paying the usual 8 per cent.dividend.the past year,the sur- plus and undivided profits ‘had been increased $1,477.45.The total re- sources increased from $233,914.57 to $277,066.84,-a gain of $53,152.27,and the deposits at the close of business December 81st .totaled —$204;899.87, compared with $141,972.01 the same day a year previous,showing a gain of $62,427.86.The stockholders <re- elected the following board of.direc- tors for another term:L.T.Stimp- son,CG.8.Tomlin,J.A.Knox,L.K. Lazenby,E.B.Watts,E.G Gaither, J L Stevenson,W S Page,J.R.Hill. The directors will meet tomodfrow to elect officers.+ The Long Island Cotton Mill share- holders:met in annual session at themillWednesdayafternoon.and re- viewed the year’s business,which was- very satisfactory.The mill)was not able to run continuously throughout the year on account of improvements which were being made,but the_an- nual report showed w net profit of 15percent.for the year,During the year $32.000 was spent in sxiiprove- ments,which included the construc- tion of 230 feet of concrete dam from the Catawba bank.of the river to the island,and a new concrete -water house and forebay.«The new dam’and water house is on the shoals about: 400 feet above the mill and provides for three new water wreels with a water head of eight and a half feet, which will develop 300 to 350 horse power.A new mill may be built later on to utilize this power.The pres- ent mill-is now filled with machinery, »lot of new machinery having been B statied during.the year,bringing the total number of spindles up to 7,- 000.A-new cotton gin was built dur- ig@ the year and a.-complete sewer system was installed in'the mill,as a result"of which the sewerage is no longer.emptied into the river. Mr.Geo.H.Brown continues as presidentof the mill and Mr.Osborne Rrown as Secretary,treasurer and su- perintendent.Mrs,J.S.Ramsey re-tired from the board of directors and her son,Mr.Sherman Ramsey,who_is now actively connected with the mill; was elected vice president.in her stead. Highest Court to Pass on Rights of Negroes as Jurors, The Supreme Court of the United States is to be asked to pass on the question of whether the failure in Southern States to select negroes for jury duty is denial to negroes .aceus- ed of erime of the equal protection of the law,‘ Counsel for Robert,Kitchin,a negrotobehangedinWashingtoncounty,Georgia,fér the murder.of Henry Brantley,a white man,hate filed a brief in court,urging that the Feder- al district court in Southern Georgia erred in refusing to release Kitchinafterconviction,on a writ of habeas corpus.He utged that the failure tohavenegroeson,the grand and petitjurieswhichpassedonKitchin’s casedeprivedthetrialcourtofjurisdiction.Counsel for the sheriff of Washing-ton county filed a brief in.support’ofthe.conviction..He urged that theGeorgialawinrequiringtheselectionforjuriesofthe“most.upright andintelligentmen”was absolutely im-partial and further,-on,the authorityoftheLeoM.{frank decision,thathabeascorpuswasnotKitehin’s prop-eee.inagmuch as no objection was,offered:eginningofthe A NEW COUNTY ATTORNEY Alexander Commissioners |Elect Successors to Mr.Burke-—Ju-rors Drawn-&A Marriage and Personal Mention.° Correspondence of The Landmark. Taylorsville,Jan.6—The board of county commissioners,at their regular meeting Monday,elected Attorney Loomis F.Klutz ¢ounty attorney for a year to sueceed Attorney J.H. Burke.No other business of impor- tance was transacted except the draw- ing of the jury. Mr.Carl Warren,son of Mr.La- fayette Warren of the county,and Miss Margaret Fincannon were.mar- ried at.the home of the bride’s.pa- rents,Mr.and Mrs.C,.M.Fincannon, near town,Wednesday éveningy Miss Sara Burke went to Charlotte Tuesday to spend.a few days.Miss Winnie Mae Rowland,who spent the holidays here With her father.Capt. W.T.Rowland,‘returned to Winston Tuesday morning.Mr.W.A.Ste- venson of Statesville spent Wednes- day here on business.Mr.Weaver Edward®who spért’a few days.here at the home of his father,Rev.J.J. Edwards,returned Monday to Can- ton to take -up-his--work.as express agent.Mr.H.P.Feimster has re- turned from a.business trip to Wins- ton.ak Messrs.Roscoe Watts and Pleas Teague have gone to City Point.Va., to accept positions in the Du Pont Powder works,The following is the jury list for the spring term of Alexander Superi- or Court,which convenes February 21st:©.H.Wilson,G.W.Warren, R.P.Thomas,M.W.Price,J CG. Thomas,D.V.Campbell,U.A;Teague, H.W.Kox,James J.Pennell,J.B. Mayberry,W.C.Payne,Adam War- ren,W.J.Bowman,8.©.Little,Hart- well Bentley,D.C.Ellis,J.B.Leach, M.Py Ieenhour,A.L.Honeycutt,“Q, S.Ieenhour,E.Hy Icenhour,B.S Bowman,W.B.Bumgarner,J.S. Carrigan,'C.H.Robinette,D.BE.L. icenhour,R.‘A.Echerd,D.W.Teague, H.A.Pressley,H.E.Alexander,D. S.White,H.B.Oxford,J S.Bebber, N.W.White,J.W.McBride,“P.E.Johnson.)ait Lack Information About Persia. Official details’upon which’Presi- dent Wilsen and Secretary Lansing will decide the course of the United States in the crisis brought about by the sinking of the szeamship Persia are yet lacking.The President and Secretary of State have carefully con- sidered such information as has been received.While no xnnouncement re- garding the conference is made,it isknownthatthePresidentwilladhere to his position of taking no action of any sort until the full facts are.be- fore him,The State Department has sent ad- ditional instructions to its répresenta- tives abroad urging haste-in the gath- ering of information.Secretary Lan- sing.made it.clear that the depart- ment had received nothing which would tend to establish two most es- sential points:—-whether a_torpedo sank the-Persia,and if so the nation- ality of the submarive which fired it.The American embassy in London has received a report saying that the Rev.Homer R.Salisbury,an American of Takoma Park,Md.,was a passenger on the Persia,having embarked _at Marseilles,and he is not accounted for among the survivors,Mr,Salisbury was superintendent for India of the Seventh Day Adventist missions.His mother lives at Battle Creek,Mich. Poultry Show On. “Go to the Poultry Show”is the slogan of the chicken cranks.The show opened to the public Wednesday afternoon and.the attendance so far has been very good.A lot-of_the feathered tribe is on display,and in addition to the chickens,ducks,tur- keys;ete.,there is a good display of pigeons and pet stock,the display of rabbits being the largest ever shown here,Taken as a whole,the show is much larger and’better.than —last year’s.Mr.R.L.Simons of,Char- lotte,who did the’judging,complet- ed His work yesterday,and the coops of the winners are now decorated with Stikeleather of Asheville are expect- ed to be here today as representatives of the Asheville Poultry and Stock Association. age. A horse drawing a vehicle in which a man,his wife and two children were pants,out. harness,;/ ing,when something about é ness broke and the vehicle ran,on him fromthe vehicle.Persons the people in it. der,who escaped from a convitt force was captured.inWedr nesday~-the day after his,ese)Te aT A Nes in ‘|gross Pet Runaway Without Serious Dam- riding,rah away on Kront street Wed- nesday morning and threw the occu- The only person hurt was the man and his imjuries—bruisés on his face-—-were not:serzous;and there was no other damage except.broken The horse started running on the}man,was acquitted of a charge grade near the Mulberry street cross- the har- He was headed east and"about the Meeting street crossing the’occupants of the vehicle were thrown out.A lit- tle further on “the horse broke loose who saw the runaway didn’t learn the names of “Tanne Cham lee,under ‘sentence of 20 years in the State prison for mur- Winston-Salem NEWS OF GURRENT EVENTS Incidents Gathered From All Parts of the Country. The reeall electidn in Atlanta to oust,Mayor Woodward and five —po-lice-commissioners,failed to recall. Congressman Webb of North Caro- lina has introduced in the House the joint resolution providing for nationa- al prohibition through a constitutional amendment.- Fight soldiers and one civilian werekilledand19soldiersandonegivil-jan injured by the accidental explos- fonof a shell in the artillery park at Lyons,France,‘ The Asheville city directory con- tains whiskey ads.and the Asheville Ministerial Association has passed ad resolution condemnmg this practice of advertising whiskey. Friends of Justice W.R.Allen of the State Supreme Court will present his name to the President for appoint- ment to the United States Supreme Court.to sueceed Justice Lamar,de- ceased. Representative Doughton has.had the foHewing-named...rural .carriersapndinted:Cary P.Lawrence,Moores- ville;John M,Downs,Lenoir;RobertS.Echerd,Taylorsville;Vance Choate, Sparta. The Gastonia Gazette is informed that Mayor Houser of Cherryville, Gaston county.and one Mr.Beam fell out and “fout”as the resylt of an ar- gument about the merits of a ’pos-sum dog.“aye tt is stated ‘that Robt.N.McNeely, the North Carolinian.who —perished when the Persia was wrecked,was to have been married next June.His fiancee was Miss Wilma Whitacre of West-Liberty,Ia. In the Federal court at.Raleighthisweekjudgmentof$1,000 each was taken apiitist five corporations for failure to make report of their incomes,_required by act’of Congress August 5,1909. The Chinese government has decid- ed to equip two cotton mills -with American machinery and has’placed orders.with American manufacturers and builders for machinery and plants yalued at more than $700,000, V.W.Pugh,charged with swind- lieg#the DuPont Powder.Co.at Hope- well,Vai,out of about $40,000 by pad- ding payrolls,was arrested at Ori- ental,Craven county,a few days ago and taken to Virginia~for trial. At Burlington the 18-months-6ldchildofRayMortonwagkilledbythe dischargeof a gun.The baby was alone.in a.room and is supposed to have attempted to drag.the gun, which was too heavy for it to lift. Fire Friday night caused -minor damage in the basement of the build- ing that houses the State.War and Navy Departments in Washington. The loss is practically confined.to odds and ends stored in the basement and as estimated at $2,000.; Congressman Frank Buchanan of Illinois,indicted on charges of con- sniring to,foment,strikes in munition plants,surrendered to the New York court ahd gave bond.The others in- dicted at the same time for the same offence,have-given.bond, The Augusta (Ga.)Chronicle,|es- tablished in-1785 and claiming to.be the oldest Democratic daily in the country,sent to President Wilson a 550-word telegram ‘urging the ap- pointment of former President Taft tothe Supreme Court bench to suc- coed Justice Lamar.Judge Alton”B. Parker-of New York,former presiden- tial candidate,also favors the ap- pointment of Taft.': Mrs.Malinda Ingyam_of .Kerners- ville,71 years old,and Mr,Zachariah Payne of Gana,-Va.,72 years old, ago.They were sweethearts in their early childhood,being in school to- gether,but.were separated by the war and had not seen each other for more than §0 years past until last autumn. In the meantime the man had been Dr.Rosser at Harmony. that Dr.R.G.Rosser,formerly their.ribbons..The show closes to-|Lee county,had located at Harmony|first ten games of the season.The night,5 for the,practice of his profession.|eleventh game was played in Char- Out-of-town’poultrymen here for|The Lee County Journal of:recent}lotte-last night,when the locals met the show include Mr.R,L.Gill _of|date has this’to say of’Dr.Rosser:|the Charlotte Y.M..C.A.team.The Spencer,Mr.W..J.Edwards,Mr.|“Dp,BR.G.Rosser moved his.fami-|result of this game has not ~been Valley and Prof.Ninniss of Char-||y to Harmony,near Statesville,last learned...Next week ‘Statesville oes iotte,Dr.H.J.Durham and Mr.F.|week,where they will--make their|to-Greensboro,Elon College,the Uni- home and where Dr. tice medicine. er ways than the professional duties.and are at a Joss’to leaving,for he had creditable and lucrative practice. “The Journal extends to him privilege of coming back to see his home.” Court Cases. Burwell Barkley, larceny,in Justice Lazenby’s this week.Barkley heing responsible for ance of a lap robeMr.We"A.Murdock of Cool the discharged. a hearing’before Justice to jail to await Superior Court,Van were married in Mt.Airy a few days iG married once and the woman.twice. The Landmark mentioned recently of Rosser will prac- Dr.Rosser was a real asset to his community in many oth-pursuance.of.his friends kvow his motive in established a the the ‘home folks’whenever he sees fit,and predicts for him a success in his new a young whiteof court was charged with disappear- from the buggy.ofSpring township,but)there was practically ho evidence against him and he was Jas.Vanderburg,colored,was given Lazenby Wednesday afternoon on a charge of laréeny and in default’of bond went »|derburg is shares with stealing a]chin watch from J.W.Falls, colored.}the hi watch:was recovered,newly pure! THE RANGE OF Interesting Comparison of Prices in Past Years. Food prices in the United States during 1914 were higher than at anv time during the last 87 years:with the exception of the years 1882,when they were 4 per cent,higher than1914prices,1883 wher’they were on the same level,and in 1912.when they were 1 per cent.higher.The Bureau of Labor Statistics in its annual bul- letin on wholesale prices of commodi- ties,reviewing the years from 1860 to 1914.discloses that in the 55 years food prices were highest in 1864,whentheywere76percent.more than 1914 prices,and lowest in 1896,when they were 40 per cent.below. In the years of the Civil War and during a dozen years or more after- ward,prices of all commodities were the highest since’.1860,when the first attempt.was.made at keeping a rec- ord of wholesale prices.In 1864 prices of most commodities reached their highest point.Lowest prices were recorded in the years from 1894 to 1898.s Farm products prices in 1914 were higher than they had beer in-the last 44 years.As with food prices,‘theirhighestpointwas.reached in 1864, when they were 85 per cent.more than in 1914,and lowest in.1896, when 56 per cent.below. Clothes and clothing were lower in 1914 than during ‘the previous year and were higher than at any timesince1884,when they,were on thesamelevel,except in 1907,1910 and 1918.Their highest.prices.were in 1864,when 254 per ‘cent.more than 1914,and lowest in 1896 and 1897, when 25 per cent.lower. Fuel and lighting prices were 5 per cent.lower in 1934 than in 1913 but were 32 per cent.higher than the lowest point reached in 1894,and 120 ‘per cent.-below the highest.point,reached in 1866..iLumberand~buildiag..materials were 4 per cent.lower than in 1913,eae cent.below their highest prices rdached in 1864 and 38 per cent,above their lowest point reached in 1897.Drugs and.chemicals were 6 percent.higher than in 1918 and higher bthan.they had been in 30 years.Theywere230percent,below their high-est-peint made in,186d4.ands33.;percent.higher than their lowest pricesin1895.pees ae arnHousefurnishinggoodswerehigh- er.than they had been in 30 years,be-ing 25 per cent.higher than their lowest prices made in 1897 and 184percent.below the highest prices pre- vailing in 1864.Prices of all commodities combin- ed were 1 per cent.below the prices of 1918 and on the same level asthoseof1912.They were lower by 137,per cent.than the high prices of 1864 and higher by 88 per cent.thanthelowestpricesprevailinginthe years of 1896 and 1897. Deaths.eens Miss May Abernathy died Wednes-day night at 9 o’clock at her home in Shiloh township,aged about 81 years.Death followed ten days’-illness of lagripne.Deceased was a daughter of. the late Lawson Abernathy and issurvivedbyfivebrothers—Messrs,M. A.,M.P.,Julius,John and A.N.Ab-ernathy—and one sister,Miss Sue Ab- ernathy.Funeral will be held todayatConcordchurch,Loray,conducted by.Rev,E.D..Brown,and the inter- ment will be in the cemetery there. Dr.Tom B.Person,former postmas- ter at Wilson,and long a noted citizen of that section of the State,died Sun- day at the home of his son,Mr.TomPerson,near Fremont,Wayne county.Dr.Person was an uncle of Mr.P,A. Bryant of Statesville.4 Home Team Wins Games. Local basket:ball fans-are promised another good game tomorrow night when the local team will meet.the Winston -Salem team on the home floor.Winston ~Salem sends out a strong team and it 1s expected ‘to prove a good match for Statesville. The home team,however,has.been playing some good ball and is well in the lead,having won eight out of the versity and Trinity,College. Gathering of Juniors. The members of the West States- ville Council of the Junior Order and quite a number ‘of outsidery enjoyed a pleasant “open”mecting at,their lodge quarters in west Satesville Tuesday evening.Addresses were delivered by State Councilor.Cooper of Raleigh,National Councilor Webb and District Deputy.Long of States- council.were re-elected and:installed during the evening Property. Mr.C.H.Turner has sideration was.$6,000.: cilities:‘will Titove © PRICES. Mr.Turier Purchases:Old Mill purchasedfromDr.J.J.Mott the old roller.mill property at the Mecting street cross-ing of the Southern railway.The con-Turner will for the presént use the mill build-ing for the storage of machinerya)for railway loading and unloading fa-Later his ma-|)2 BRIEF ITEMS LOCAL NEWS'a)ie Box supper at Rocky Branch to-morrow night for benefit.of school. —Changes and improvements arebeingmadeontheinterioroftheWil-liams Furniture Huse.a—The Landmark is.notified that .Mr.M.C.Johnson of Clio community ~~this week killed a pig,6 1-2 months *old,that’weighed 175 pounds. —Yesterday,6th,was the Feast ofEpiphany,,sometimes called Old Christmas,Which is observed in Cath-olic,Episcopal and other churches, —Mr.A:B.Johnson,of the John-son-Belk Company,was in CharlotteTuesdaytoattendtheannualconfer-ence of managers of the chain of? Belk stores.‘eae :Kove—Judge Long will go “to ConcordMondaytoholdCabarruscourt,hav-ing exchanged courts with Judge Fer-.guson,who will hold Cherokee coforJudgeLong.:i -—Mr,Jas.R.Hill has,sold his in- -terest in the Iredell ‘Produce €o.:ta’.his partner,Mr,Jas.E.Tharpe.Mr.Hill is undecided as to his future « business arrangements.if ~-~-'The First.Presbyterian church o!Mooresville made a second call for thepastoralservicesofRev.Carl Mat-.thews of Pulaski,Va,and Mr.Mat~-thews has again declined.Sie —-Mr.J.Rome Cline,a well known ©citizen of _Catawba;who had been @patientat.the State Hospital at Mor-ganton:for several months,died at.Morganton.Wednesday.and the re>mains were brought to Catawba forinterment.eS“Mr.Carl ‘Troutman,an émployeoftheImperialFurnitureCompauycameincontactwitharapidlyrevol-ving belt at the furniture plant Tiday.and suffered a broken limb,theboneofhisleftlegbeingbrokenjustabovetheankle.:FES Sg ie .—Mrs.J.H.Wyckoff has:rented.x!her home on Sharpe street to Mr.JeffE,Ingram.Mrs.Wyckoff will spend.the remainder of the winter with,herrs.T..S..Lazenby ‘and daughters.AN ,Mrs Floyd Lippard,and with friendsintheeasternpartoftheStateasbeenissuedfor‘the day's report.Archie Alexanders!Archie Alexander |;; _-Supt.Gray receive ‘anyesterdayfrom‘Dr,W.S.‘Bet-retary of the State Board of Health,stating that if Iredell decides in fa- vor of the medical inspection ‘ofschools,which,day by the ¢loners and boardofeducation,thé work canFebruary21st.ro —-For some time mild’‘cases.smallpox haveBloomfieldsection.county.physician,sa ’25 or more cases:0’\5thatitisonthedecline,as most ofthe:people have -had ‘it..Only:‘cases are reportedfrom;the countyandthéywereinfectedinBloomfie!community.Lily Cady an Na Influenza,Alias Grip,SpryOverCountry.© Washington Dispatch, Influenza is spreading overUnitedStatesfromcoasttocou the most serious epidemic of its kindeverknown,taking @ large toll in be begun lives and capsing economic loss by in-capeciating worker in allwalks ife.Rada ea Reports from public health serviceofficersmadepublicbySurgeonGeneralBlueshow’that alreadythe’diseasehascreatedagraveproblemfor many ‘of the larger cities.and is. spreading to the rural communities.New York,Chicago,Boston,San.Francisco,Seattle,Cleveland =andDetroitreportedthediseasewidely vrevalent.‘Cleveland and Detroit each have probably 100,000 cases.Of the... larger cities,Buffalo,Pittsburg, timore,San Diego,Dallas and Mobile reported no signs of an epidemic,— There is.practically nothing |the Federal government can do toward” aiding in suppression of the epidem=— ic.Tt must be dealt with by local au- thorities and they in turn,it is said) are almost helpless without co-opera-" tion from the public.ts fers a no Smallpox and Chickenpox.*: Correspondence of The Landmark.: Statesville,R-8,Jan.6 —The boxsupperatLeonard’s was well attend- ed and apparently enjoyed,although there was a slight intreruption,pre-sumably caused by strong drink.©Supt.R.M.Gray.called at the Leonard school Wednesday on his) way to the.Thomas school,where: smallpox had been reported..There has been a few’cases of chickenpox: reported in the Leonard’s school...© ville.Mr,J...Fesperman and Rey.)“my.¢in this section aretak- C,M.White also made talks,Al the],e:farmers,In Chis SeCuOt Ore old.officers-of the west Statesville ing advantage of the bright weather,and are making preparations for the spring crop.tatsaphenanecesAgedSredellMan.4 -Bride Cor¥espondence of The: Blackstock,8.G.,dans at,the éBla *f rte.< explanation ‘was given in theaethechangeinfreightthisterritory,whichiveJanuaryIstbyor-the Inter-State Commerceion,‘The public is indebted re i for an explanation ofastheyaffectourpeople.the tion.that the increase)8!eae.six months shows ne “roads to bein’eondition andSagiincreaseinyatesisunwar-Governor says:|.in this rate schedule pro-‘raulgated by the Inter-State Com-Commission there is an ineq-that in my opinion is indefensi-All freight originating in Northlinaandgoingsouth.except to‘it Necro which ~includesta,’is to bear the same tariffGasclassoffreightoriginat-in the Virginia cities,althoughtheseVirginiacitiesareonanaste.189 miles’farther from\tsouthernmarketsthantheNorthCarolinapoints.And on freight go-|5ingtoto‘this limited territory,’includ,|°ing Atlanta,we get a rate only)|cents lower on first-class freight thantheVirginiacities.To illustrate:The‘ate on furniture from Lynchburg,oo!and Roanoke to Atlanta’un-the new schedule is $1 per hun-dred pounds;from High Point to At-~Tanta it is 93 cents a hundred pounds.From High Point and other NorthCarolinatownstoallothersouthernpoints,the rate is $1 per|hundred‘pounds,the same as from|Virginiaties;This isd decided ‘increase uvertheratesheretoforeexisting.,“A little more than two years ago Wwe came to an agreement withthe._Yailroads as to rates from the ‘NorthandNorthwestonfreightbroughtintothisState.These rates agreeduponarehigherthantheratescharg-ed Virginia cities,although the freightis,h.uled through North CarolinatownstothesecitiesinVirginia.In|:tonsideration of all the circumstancesanddifficultiesthismatterwasad-justed.While North Carolina did notgetallto’which sHe was entitled,weacceptedthesituation.Now it seemswearetobechargedonfreightgo-ing pase a“same as the Virginiacities),‘I ’nt ees although thefreight"re :oe d from VirginiathroughNorthCarolinatotheseSouthernpoints.“On =such_tariffsNorthCarolinawould‘get it in theneck’both going and coming.'“This schedyle that goes into effect| it today is not a final adjudication,and!©it should never be.The commodityrates‘on freight:going South it seems ve not yet been changed,and will!«not be for 90 days.“One of the most desirable consid-of the settlement of ‘the freight rate question two years agowas’the ‘establishment of good feel-ing between the railroads and thepeopleoftheState.I would deeply regret thatthis good feeling and mu-tual desire;for each other’s welfare,and willingness to co-operate witheachothershouldbedisturbed.I can-notbelieve that the men who are now‘Managing the carriers that operate in _this te,who heretofore manifested»an earnest desire for an equitable ad-justment of all differences,will con-tend that freight originating in.North,Carolina ‘going south shall ‘bear _the.same tariff as similar freight origi-nating in Vitginia—nearly two hun-dred miles further from destination.”The freight ‘rate proposition is a_most intricate problem and is yet un-solved.Two or three years ago inequestionwasagitatedinthe.State, organizations.formed,much time andmoneyspentinaneffortioadjustthe rates and legislation resorted to forthepurpose.The railroads,as.Gov. gz says,offered an,adjustmentwhichdidnotgiveusallweconsid-pd oursdue,but the compromise wasaccepted.Freight shipped throughaeNorthCarolinatoVirginiacost’morefreightstoppedin’North Caro-[This discrimination b “aka of irginia points was so glar ng andindefensiblethat.a reduction wasmade‘in our favor.While the rateis.still in favor of Virginia we ac-pted it as the best we could-do.low the changed rate charges the same for freight shipped.south fromourState,except to a-limited territo-zy.as'is charged Virginia~points.lile the ‘distance is much less,thepointsaregiventhesamemigaeNorthCarolinapoints,justitginiaisgivenamorefavora-ble for freight hauled throughNorthCarolina.to Virginia.The railroad people car explain un-til they drop dead,but they'll never5theplainpeoplethattheporntareanythingbutagrossdis-crimination;and it 1s useless to ex-etthepeople -to feel satisfied or tofeikindlytowardtherailroadswhile‘fr eerupination exists. ee *Congress, ‘the:aiaitnistration rural creditswasintroducedintheHouse-of'Tuesday and in ‘the Senate Y:ent control of the systemaFederalfarmloanakfiveappointedbythePresi-0°Loans wouldtofarmersby12ormoredbanks,each operatingratedistrictwithcapitalofthan$500,000;which wouldtheereroreesifnot r local ‘associations oflednationalfarmloanEveryborrowerwould‘take stock in the asso-amount of five per.A limit of 36 }IS LESS THAN ANY STATE.| q crease in the total value of their real jtion_in return for’|would straighten the southern bounda- Our Taxes Lessss Per Capita Than port State Tax Commission. The report of the State Tax Com-\ shistba discusses the increase of real estate assessments made bythe com- mission last year.There has been for a number of years,says the report,a “substantial demand in the State fortheexerciseofthepowersof‘theStateTaxCommissionasa‘StateBoardofEqualization,based upon awidespreadconceptionthattherewasgreatvarianceinthebasisofvalua-|*tion of real estate as between the several counties of the State,and to some extent in appreciation of |the need for larger revenues to meet theincreasingneedsofa_developing State..A careful analysis of jreturns from the assessment and listing.of property for the year 1915—left noroomfordoubtthatthetimehad come when the exercise of this pow- er was a necessity.” There .was,says the commission, an actual decrease in the value of per- sonal property listed in 1915 compar-“with 1914.The returns from real state assessments.as made by local authorities,showed a slight increase as a wholp,some counties showing a substantial increase,others.no in- tease,and!still others an actual de-| estate as compared with the last quad-| ~ennial assessment,and m the ‘atter classification)was included some counh- ties that had come to be generally Known as>under rassessed counties compared with assessed values in oth-| er counties,The total net result was |‘ 4n)increas@ in the assessed value of| real and /pérsonal property of 6.6 per | gent.It was decided to undertake a veneral équalization as between coun- ties,and,.as nearly as ‘conditions could be ascertained,to require those coun-| ties that were under-assessed to bear| their equal part of the burden,and thus serve the double purpose of equalizing the tax burden while mak- ‘ng,provision for a moderate increase of public revenue. The commission gave two months of “investigation and careful thought to the work and all requests for hear- ‘ngs were granted.As a result of the hearings modification cf the order was made as to eight counties. “The net increase in assessed value of real estate as a result of the equal- ization order is $32,118,990.The to- tal increase in assessed value of all SPORE EY»real,personal and corporate, for the year 1914,is $85,227,974.Theincreaseatthelastquadrennialas- sessment period.1911,was 20 per cent..and in 1908,24.9 per cent.It will thus be seen that the net increase|in assessed values is barely more} |than half the per centage of increase made in each quadrennial assessment| since 1899--and we are ‘confident the} increase is more equitably -aistribut-| ad.It is extremely doubtful if the, inerease of 10.5 per cent.will cover| the actual aggregate increase by ac-|‘ auisition,improvement.and.con:struc:| tion for a period of four years.’ake The commission calls attention -to) the fact that,“after all the criticismthathasorcanbemadeofourtax- ing system,the net fact remains that ander a State government administer- ad with economy we have State insti- tutions maintained in keeping with the progressive,sentiment of the} times;we have approached a_six-| months’school term in modern school buildings,and are constructing im- proved roads as rapicty as any State of comparable wealth and —deyelon- ment,upon a payment of taxes in dol- lars and cents,for all purposes,lessvercapitathanthatofanyother State in the Union,as conclusively shewn by the United States Census Department.” Catholics and Sunday Meeting. It was recently published in the papersthatCardinalGibbons,the Cath- aA prelate of Baltimore,had given!A quasi -.endorsement to the Billy} Sunday meetings sovn to begin in that citv.The cardinal says the “pur- vort of his conversation with Rev.Dr. George C.Peck,pastor of the First Methodist Episcopal church,regard-| ing the Billy Sunday campaign ‘was misunderstood,”and declared that he had not Wauthorized”“the sending of | letters to Catholic)pastors asking prayer for the success of the coming sampaign in Baltimoze.”The cardinal |said he did not.know Dr.Peck.was, an accredited representative of the! vrayer meeting committee of the Sun- day campaign management “ind _re- ceived him only asa minister calling as would any other individual. Asked if.he objected to the prayers of the Catholic clergy being sought for the success of the Sunday.cam- vaign,the cardinal replied that he had no.objection.It was the infer- ence drawn from Dr,/’Peck’s public! statement that permission had been! given to send letters to Catholic cler- by to which the cardinal objected.The Catholic Church,he -said,couldnotinanywayrecognizeMr.Sun- day asadivinely’commissioned teach-| er of revelation.| “Mr.Sunday is always kind to the|Catholic Church in his references,” the cardinal added,“and we mean.no discourtesy to him by keeping away | from himand his meeting and his in- fluence,”After this.statement’Dr.Peck abandoned his efforts to interest the Catholic clergy in the Sunday cam-|paign.- 1|{ Plan to Buy Mexican Térritory.. A movement launched bv various commercial organizations of Arizona| to secure the annexation,virtually bypurchase,of sufficient land from Mex-ico to extend the boundary of Arizona|and-.California to the Gulf of Galifor- nia,has been»furthered by.GovernorHuntofArizona)who has writtenGovernorJohnsonofCaliforniaask- va co-operation,.~\. An offer on the ‘part of the Unit-ed States to cancel all —indemnityclaimsforlossoflifeanddamagetopropertyduringtheMexican’revolu- this land,which ry line ofArizona and give Califor-nia a strip.of Lower California,‘istheaeofleadersof.the move- ~WATKINS. Any State in the Union—Re-) |that Mt.Mitchell is the highest peak |Peak and Dr. juge THEBOILERER EXPLODED,~of Survivor’‘Describes the SinkingofthePersia,© Charles Grant of Boston,one‘ofthe two Americans.known to have:been on board the Persia when thevessel was sunk in the Mediterranean De-|- cember 80,gave-to~the.Associated. Press representative at at the aieEaypt,the following story of the di aster:oy was in the dining saloon of thePersiaat1,05 p.m.,”he said.“Tf hadjustfinishedmysoupandthestew- ard was asking what I would takeformysecondcoursewhenaterrific explosion occurred. “The saloon became filled with smoke,broken glass and steam from |:the boiler,which appeared to”have burst.(There was no,panic on board.We went on deck as though we were at drinl and reported at the life boats’on the starboard side.As the vessel had listed to|port I clung to the rail- ing.The last thing done was to tie on Captain Sprickly’s life belt. “As the vessel was then listing so bady that,it was impossible te launch the starboard boats,I slid) down the starboard rail into the wa- ger:I got icatght in a rope which vulled off a Shoe,but I broke looseindclimbedonSomefloatingwreck- age,to which I clung.The fastI saw of the Persia she had her bow in the air,five minutes after the ex- ylosion.‘ “After floating about on the wreck- age yntil 4 o’clock in the morning,I gaw five boats.JT was pulled into‘one of them.We rowed about,looking for other stragglers. “The boats became ‘over-loaded and the /oceupants.were redistributed. Four boats Were tied together”by their painters and the fifth,followed some distance away. “My boat left the others in order |to /search the more-frefuented steam- ship)channels for help.We rowed for three hours.Then we saw a cruis- ey and,called out:‘We are English,’ We explained that we were survivors of the-Persia and gave directions to the cftiser as to where the other boats were.They were eeun found ind-the-occupants were taken off im- mediately by the English Sailors. “Robert.McNeely,American consul it Aden,sat at the same table with me on the voyage.He was not seen, »~robably because his capin was on the vort side. “Tt was ‘a horrible scene.The wa-| ter was black as in\.,Some passen- zers were screaming,others weré cal-| ing out goodbye.Those in one boat} sang hymns.” Monument to Dr..Mitchell Mt.Mitchell. Paving the way for a later appeat for funds for the erection of a_suit- thle monument,to Dr.Elisha Mitch- ell,the man whio definitely discovered on east of issued a the Rockies.Gov.Craig has} booklet entitled “Mitchell’s'| Mitchell,”setting forth| facts concerning the peak,written by| Sov,Craig,and an account of the dis-! soverw of Dr.Mitcheli’s body and its burial,written by Gov.Vance.xt is +very interesting collaboration of, facts thatthe Governor~has compiled’ with reference to Dr.Miteneil and the mountain peak which bears his name.Writing his impréssions after a visit to Mt,Mitchell.Gov.Craig 3aVs:: “When on the top of Mount Mitch- ell you are in ailofty altitude,amid] the mighty upheavals of the prime-| val ages of the planet.Geotogists teil| 1s that this is the oldest land of the} sarth.Jn the beginning the spirit of God moved upon the face of.chaos, ind God said let the waters under the heavens be gathered together in one olace.and let the dry tand appear. md-it-was so.At:this command of the Almifhty,the tide of the pound- ‘ess ocean receded;the dome of the Appalachians appeared above the waste of waters.Before Abraham was,this mountain was.It was old -when —Sinai was built.It was:dry land--when Noah’s del- swept over.Asia,for the waters did not rise s~ove this sum- mit.On this mountain,covered with dark forests and sombre,you near in the ancient winds ‘the vetce of days ofoldanddaystobe.’.For ages it has stood in primeval solitude.and~sol- emn grandeur,while above and around ind.beneath the clouds have swept ind the storms have raged.It will stand in silent and.august majesty when austral seas shall,bury our ciy- ilization under ocean waters.”’ Asked to Combat.Pella- gra. Sécretary McAdoo has asked Con- gréss for a tush appropriation of $10,000 for studies and demonstra: jtion work in rural sanitation with a particular view to checking pellagra and typhoid fever.He submitted a report from the public health service which said: “Increased demonstrations are ur- |gently required to prevent pellagra from becoming a weritable™scourge in many rural communities.In Missis- sippi alone there were 10,954 cases and 1,024 deaths from pellagra last year,and in certain other States it has exceeded:tuberculosis as a cause of death.It is estimated that there have been approximately 75,000,cases of pellagra throughou:the country this.past year,with more than 7,500 |deaths.”\ Money on Josties Lamar of the United Stites Supreme Court;who died in Washing- ton Sunday,was buried in Augusta, Ga.,Tuesday. MRS,CLAYTON'S LETTER To Run-Down Nervous ‘Women ‘Louisville,Ky.—‘‘I was nervouswreck,and in a weak,run-down con-dition when a friend asked me to tryVinol.I did so,and as a result I haveainedinhealtlrandstrength,I thinkinolisthebestmedicineintheworld for a nervous,weak,run-down systemandforelderleople.”’—Mrs,+O-CLAYTON,Lou aville,Ky.Vinol is a delicious cod liver saatirontonicwithoutoil,guaranteed to’over-come all.run-down,‘weak,devitalizedconditionsandforchronic¢coughs,coldsandbronchitis, Ww i,Hi HLDruigistyStatesville,N §« OPERA HOUSE TONIGHT—Reserved seats 0onn sale at Statesville Drug Co. sanesaeertereevsocmetenecpeerereneeerTatoocoo Returned to School. Vorrespondence of The Landmark Concord mn Grose of this township,and Miss Ra- the!MeLelland of Sharpesburg town- ship,who spent the holidays at home, nave returned to school at States- ville college. Mrs,Woodrow Wilson was instatled Tuesday as.mistress of the -White House.: \ lg \ A Few Hours Real Pleasure in theEvening HE brightlightoftheRayolampmakesreadingandsewingrealpleas-ures these evenings. AYO Lamps ~The Rayo gives asteadylightthatcan’t hurt the eyes.It requires almost no attention.Its‘simplicity of design makes it easy tokeepclean.Youdon’t have to re-move the shade tolightit—just lift the “gallery and touch amatch.Most con- venient —mosteficient—mosteconomical.Use Aladdin SecurityOilor.Diamond WhiteOiltoobtainbestresults in Oil Stoves,Lamps and Heaters.-The Rayo is only one.of our many products especially suitable for use on the farm. Standard Houschold —Lubricant Standard Hand Senareiar ’ Oil ParowaxMicaAxle GreaseEurekaHarnessOil Matchless Liquid Gloss‘If your dealer does not‘carry them,write to our nearest station. Township.—Miss Ethel |- Donse BrRovuers— WINTER,CAR These winter cars will give you many a day of motoring which would not bepleasantin an open car. The demountable tops are fitted , individually to the cars.at ‘the factory.They are weather- proof,The finish inside and out is in keeping avith Dodge Broth- ers|practice, &Thé motor is 20-35 horse power price of the Winter Touring Car or Roadster com- plete,including regular mobair ‘top,is $950 (f.o.b.Detroit) Canadian-price,$1885 (add freight,from.Detroit) The ~ STATESVILLE MOTOR CO. q STANDARD OIL COMPANY(New Jersey)’SA aEWashington,D.arlotte,aNortollaVe,Chérleston,W.Va,Richmond,Va.Charleston,8,C, “DANGER”CROUP and PNEUMONIA Come like a thief in the night and seizeupontheinfantchild,Be-prepared to saveiant‘of your little one by having a bot-tle oBrame's VapoMertha.Salve)=~—~+FOR—— Croup and Pheumonia, Price 25¢,,Be.and $1.00. For sale.by all dealers or sent port-paidbnreceiptofprice.BRAME MEDICINE O,,N.Wilkesboro,N, GREETINGS: a ls HOW’S THIS? one &Because'we bought before the big ADVANCE is the reason we are going to sell you this car of WIRE . FENCE,which has just arrived, —oe The:Old Price. THANKFUL FOR TRADE! I want to thank for their trade all who traded with me this year.‘Intheyearwhichbeginstomorrowwhenyouneedanythingintheofjewelry,clock or watch repairing,oe of eyes and piting ofglasses,I want you to come to me.,: R.F.HENRY..— in any peeWehasntvesWellibesondisths aae :ag fe}pevma 1°e .-oused about bucket,Ar.siz wel hAlsofulllineinstock,oa.‘STATESVIL Pnily y doctor told my husband hedomeesiyandhehadeedWeoeanotherSore, oieee! a ‘my ciespt OOFme ©fakeesiteatfedeeeeyiow:‘Buteevenbott!ies,andred‘all of my work and my own gaye the medicine inweighteased,Tooktheeeehealth ae from any of the ailmentsifelyisgetabottleofCardui;lay is dangerous.We knowBeithouolePoranrbessootherweakwomeninoya:Atall anata. - +Write to:Ghattanooga Medicine Go.,Ladies?visory sepmnyourcase ant84 Tenn.fot tradcase4-page jomeforWomen,”inplain wrapper.N.C 138 ——a—-uence ace eenirereri terme Pianowoon FLOORS. Are porfectly sanitary,clean andéasytocarefor.Plans‘for a newhotisearenotcompletewithoutalinbeingmadeforthem.old houses the work is readily-#laid over.original floors,taking theplaceofcarpetsSeemeorwrite. x .U.A.OSTWALT,STATESVILLE,N.C. 1 ain able: east-bound,ot 6:55 p.t-bound,due 10.50 p.DE E P E R . :From .Train +18 ar,8.60,leaves 10.85 «,Train No,24 ar,8:14,leaves 8.14 p,‘Taylorsville.Train No.23.ar,10:00,leaves 10:40 « Train No.16 ar.§:40,leaves 7:06 |p.Nos.23 and 24 wre not operated ou Sunday “, m, m, ™m. Visitors at Stony Point—Social, Correspondence of The Landmark.Stony Point,Jan..5.—-Mr.and Mrs: C.P,Peeler of Shelby visited Mrs. Peeler’s aunt.Mrs.J.H.Weber,lastweek,Mr.Harry Miller left Tuesday for Chapel Hill..Miss Grace White,who spent the holidays with home people,has returned to Charlotte.Misses Pearl and Dessie Miller en-tertained a few friends in honor.of their*niece,Miss Lotse Goode of Greensboro.The evening ‘was spent in playing rook and other interestinggames,after which refreshments wereserved——hot.chocolate and cake.{TT Fire in West.Durham Tuesday morning destroyed w large two-story brick building which contained ten stores,Loss estimated.at $12,500. ||SWAMP-ROOT SAVESKIDNEYSUFFERERS. You naturally feel secure when you know that Dr.Kilmer’s Swamp-Root, the great kidney,liver remedy,is absolutely pure and con- idrugs.The ofsame,standard and bladder |tains no harmful or-habit ‘producing purity, strength and excellence,prescribed by vn snenernehentse SCR(MR.HQNEYCUTT’S DAMAGE Must Be Paid $100 For Reloca- tion of Road—Bills bi By County, The county commissioners,at theimectingMonday,decided.ghatoa,M.Honeyeuté is entitled to fordamages.to.his.land bythe reloca-tion of a public road and this amountwillbedemandedforhixbythe’com-missioners from peisons who obligat- ed themselves to pay any ‘damagesresultingfromtherelocationofthe road,Claims ‘against the céunty wereorderedpaidbythecommissionersas follows: County Home-—-W.C.Perry,salaryassup¢rintendent.$40;R.L,Freeze, farm manager,$85:Lewis Lucky and wife,servants,..$20:.Lazenby-Mont- vomerv Hardware Co.)$6.65,States-ville Housefurnishine ¢o.%7.50,CityFlourMillingCo,$84.25,Stoteaville Grocery Co.$89.98.W.B.Par’4 $3.-78.N.P.Watt $15.60.7.S.Waugh &Co.$11.78,Sloan Clothing.“>:$18.-80,all for Mpovlies:Barium Orphans’ Home,lights for six months.$123.51;eat Troutman,blacksmith ~-work, Jail—C.L.Gilbert,jailer,$180.90; sity light department.lights,$7.30; Statesville Drug Co..drugs.$1.25. Miscellaneous —-Worrell Manufac- turing Co.$10,Statesville Drug Co. $15.20,for supplies;W.I Baity,ser- vices and expenses in conveying pris-oner from Yadkinville to Statesville,$12.40;city light denartment.lightsfoycourthouse,$19.14;Observer Printing House,record book and in-dex for clerk’s offi¢e,$21;Conklin Chemical Co..disinfectant.$20;Dep- uty Sheriff C.E.Jones,for destroy- ing’iNicit distillery $20,for convey- ing.prisoner from Wilkes county $4.- 50;Mary C.Thompson,burial.ex- nenses of Mary C.Hudson,widow of Confederate soldier.$20;R:L.Brad- ford,coffin for pauper,$8:J,E. Sharpe.burial.expenses of |Confeder- ate soldier,$20;Geo.D.Barnard & Co,,supplies for register’s office,$2.- 07:G.E.Dull.ecounty’s portion of ngreyrs iDr.Kilmer many years 2go,is main-salary as county demonstrator,$41.- 7 Jan.4 Box 14?.ltained in every)bottle of _Swamp-|67;R.F:Rives,surveving at county Sener=wane Root.home,$8ycity:water department.wa- a |Swamp-Root is petentincally oan Re nage Dp.SNe ee ee tiie eer |pounded.from vegetablp herbs.It is|cour ouse chairs,$4;Statesville .BLACKSMITHING!inet a stimulant and tetaken in 8 ee es see eo er 7 spoonful doges.It is not recommend-}ville Enterprise.pub ishing sheriff’s SEE LINEBERGER for anything ed for everything.According to veri-|tax notice.$3;H.C.Cook,court Z in Blacksmith line.Horse shoeing}|jeg testimony it is nature’s great house janitor,$45;Deputy Sheriff (No.3 and smaller)60c.;No.4 70c.(helper in relieving and overcoming White.conveying patient to State ;Shop rear of McElwee’s Planters’ikidney,liver and bladder troubles.Hosvital at Morganton,$8.40;Dr.E. i Warehouse.|Wt you suffer,don’t delay another|N.Lawrence,extracting tonth for lda Go to your nearest druggist|vrisoner,$1;Brady Printing Co..sun-jay. a j imow and get a bottle.~All drug stores|plies for court house,$10.25:R._P. ¢!WANT |y!\sell it in two sizes—fifty cents and]Allison,supplies for clerk’s office,$3.- ione dollar.30.; i Everybody to gall at Sharpe &Jo-However,if you wish first to try|Ten dollars was appropriated to the ‘géy’s restaurant to-see demonstra-|this great preparation,send ten cents|sunnort of Mrs.J.U.Sherrill and tion of the wonderful Simplex Gas |\to Dr.Kilmer &Co.,Binghamton,N.|children,Policeman Pulp to see that -1 Plant for Cooking and Heating.||¥..for a sample bottle,When writ-|it is properly exnended.Ja A.Sal- i Souvenirs forladies while theylast.ing be sure and mention the States-|mons received $2 for temporary relief O.P.LYON,Act.Jan,42"{ville a Weekly peers:and J.A.Rimmer’s monthlv allowance “t,:a es |Wa Increased from $1 to $2. ;—THE BEST CO AL!Belated Report of Christnias Ex-| Subscript ions * ercise—Personals. :It is time you are ordering your Correspondence of The Tandmark. fuel for‘winter.The best coal for SES eee .O.Lip-| ”ig ral use is our celebrated pard and R.T.Troutman.theological Taken to all Pub he e Jeli ‘é meen at Columbia,S.C.,spent the lications Club enuine Jelico 1 olidays with friends and relatives in S.*this ‘section.Messrs:Hovt Lippard, Rates |Powhatan Blue Gem oo Troutman.‘Fred.Lippard, ‘Ks ‘Se ‘ae ‘se a :venn Frye and Miss Marguerite Por- .#;Pitts :Pennsylvania ee one on in school at Lenoir Col- pnd ,a 5 eve,Hickory,spent their vacation} fy R.P.ALLISON §Run of Mine Steam Coa with their home folks.: Book STORE.:We also handle Oak and Pine};The schools in this community all) Wood;and do all kinds of hauling.Renee are ne erate.i as exercise was|:Movieg household goodsa special-held nt St.Martin N ghivek on Chiist-| —mas Dav.It consisted of songs by|the Sunday school and short address-| ;Y ——THE-——D Holland Bros,es by the ‘pastor and Messrs.R.T.| =:epot one 0.7 Troutman and C.0.Lippard.The | Paine View Dairy Residence ’Phone No.310Black.members of the Sunday school then’ i received_a nice “treat™in the form| ay ,of fruits,candies,etc.The pastor,| ||Has just had itscows tested’ant I!tant he ncuet agatha ie elewe\‘,ini or :and they ick ape in Stop!Loo ;Listen!=from She congregation and Sun-| good condition:—another -day school as a token of their appre-, reason why the Dairy with WE buyincarlots.‘eeeen.eo puucee a are worthy ne the Dacro System should WE sellin any quantity,rendering.the See ne certws\be patronized.WE ti ie ceed Gold munity@ ‘papeee y Medal Flour.°—’PHONE 347 BLACK.—WEsell Sweet.feedforHorses Baby Found Dead in Bx‘cod Mules ;aby Found Dead in Bed—Per- —WE sell Sweet Daisy Feed for sonal Items. ag Be Cows.“orrespondence of The Landmark. WE sell Hay,Corn,Oats.and Statesville,.R-6,Jan.3 —Misses DRAIN YOUR.FARM.Cotton Seed Products.lizzie.and Lillian Massey.delight-| WE SELL FOR LESS,ue entertains Bron 60 of their| ;.ek *na ASH’for countr ifriends at a pound party’‘Monday|Any quantity 4-inch and Eeeee cake,4 ‘night,at their home near New Stir- a -je6-inch DRAIN TILE on WE deliverin the city.Miss Bertha Stevenson left Pridav hand.IREDELL ae CcoO.,roe aoe S.G@.,where she will) C D MOOR ,Prop.begin werk as nurse in a hospital.Her ‘Shree &brother.Mr.Ross Stevengon,accom- common Bricks,Face Phone No.88.114 E.Broad St.panied her to Chester,3,C.,where he} ia ng bricks,alwa ready for visited relatives,returning home té- “delivery. “Statesville Brick Co. Mh ph hain a te C.WATKINS for “Everything to Build With.” FULLSTOCK--LOWEST PRICESShingles,Doors,Windows,Ceiling,Flooring,Siding,Boxing,;Mould- ‘ing,Laths,Lime,Cement,etc.,Next lanters’Wh.Statesville. mi loan y answer ’*phone calls left.Long's Sanatoriuny orM.Foard’s residence. :Jo have the very ‘en?~Parchment.Butter Paper,7 and canprint your nameandbrandofame,Let ushaveyourorderforany—quailty vel a Pers Coite L.Sherrill,M.LM.D, ;*yneoneee ‘WEDDING+AT.DUE WEST, Miss’Nance thehe Bride of Mr. Troutman, Correspondence of The Landmark., A marriage of /intereat to some of) The.Landp.ark’s readers took,place} December 29 at the home of the)‘bride.Mt.Chickasaw.Due West,S.}©,when Miss Lelia Nancy Nance be- came the bride of Mr.James Strong} Moffatt,Jr.Mr.Moffatt taught at) Troutman for two years and oe many friends there.The home was beautifully decorat-|ed and at the appointed hour thehousewasfilledwithguests.Mr.D. S.Edwards sang “You,”preceding| the ceremony,accompanied by Miss|Sadie LaCompte Des Portes,a cousin| of the bride.-The wedding march| was played by Miss Des Portes.The| ushers were Messrs.L.N.Brown of|Troutman and W.W.Parkinson of|Brunswick,Tenn.Bridesinaids-Misses Julia and Martha Moffatt,sis-'|ters‘of the groom;Susie Nance,sis-|ter of the bride:Anna Stribling...of|Walhalla,Lily"Watson of Greenwood, Mary Boyce.Julia Kennedy and Ruth|Todd,Due.West..Miss Sarah Nance,| sister of the bride,was.maid of hon-| or and.Mrs.BE.W.Neal of King’s| Mountain dame of honor,The groom| entered with his best man,Prof.J. L.Grier,and the bride entered with| her father,Mr.Joseph Norton Nance.| The flower girls were little Mary Mof-| fatt and Hallie Nance.The ceremony| was performed by Rev.Dr.J:5.Mof- fatt,father of:the rroom.assisted by the bride’s pastor,Rey.J.-P.Pressly. After the ceremony a salad course was served in the beautifully decor- ated dining room and as the guests left the room wedding bells were pre- gented as souvenirs.The wedding gifts were numerous and.beautiful. Among them was a chest of silver pre- sented by parents of the groom:a silver cake basket,which was a bri- dal present_to the bride’s.grandmoth-er in 1856;an embroidered quilt made by slaves‘on her great-freat grand- mother’s plantation.On the.dining room table was a silver candelabra which was used at the wedding of the hride’s great grandvarents,Miss Myrtle Bradshaw of Barium was a guest at the wedding ‘and assisted:in serving.The bride is a talented and accom- plished.young.woman,Wino jas pre- sided with grace and dignity in her father’s home since te death of her mother.She is prominent in society and president of the local chapter of the U.D.C.’s..Mr..Moffatt is a tal- ented young man and has been verysuccessfulinhischosenwork-—teach- ing.Mr.and Mrs.Moffatt have gone to pone Ga.,which is to be their home.Mr.Moffatt is a member of the faculty of the Darlington school at that place. WILL BE WHAT WE MAKE IT ieee New-YearWith us—A Mar- riage.: Correspondence of The Landmark. Jennings,Jan.8 —We bade fare- well to the Old Year with all of.its blessings and sorrows,and welcome the bright New Year with all of its beautiful and hopeful prospects.It depends very much on us whether this is a prosperous and happy year or not.We can go to work with a wf SUITABLE DIET! The effects of overeating during the holidays may best be offset ‘by White Beans, Pink\Beans, Butter Beans, Canned Peas, Janned Tomatoes. |—Supply Co. day Misses ,Margaret and Alice Steven-son,who spent the holidays with their parents,Mr.and Mrs.A.W.Steven-|son,halve xeturned to their,school atHunterbville.Rev.t3:FE,Kidd,pas- tor of ‘New Stirling,will return this’ week from Tennessee,where he spent, the holidays with his parents. Mrs.Boyce Elliott was found dead ‘in|bed Christmas morning.Interment was at New Stirling the same day. Mrs.Caroline MeCoy is right sick at this writing. iC onsidering a New School House+—Visitors.9 Correspondence of The Tandmark. Taylorsville,R-4,Jan,3 ~~Health| of community good except Mrs.Jo. Eicherd,who is ‘in:feeblé -health »:at) present.“Miss”Mazi6”Motitgomery,who iSteachinginTredellthisyear,visited fe atcha eal feminine athletemnt home folks during the holidays.Mr. “WANTED! SCRAP BRASS Heavy Brass The.per pound,Light Brass 5c.perpound* FOR SA LE: New and sécond hand"boiler room;S$A ve ;ft ree Wade Bell and sister.of Iredell came|home with Miss Mazie*and spent the) weck visiting relatives in this section. The saw mill continues to cut lam ber for repairs and new buildings aAllHealingSprings..©Several of the patrons of —Ellen- dale Academy,district No,3,dale township,met Thursday night,December 30,to consider the building|of a new school ‘house,the old one t¢t00 80 all te-aeeommonatesaid The five-months-old child of Mr.and} We are glad to have them visit us.\] +| ee more happy birthdays, Ellen-| ithe}Rad! i song in our ‘hearts and a sniile on lour faces,with a determination to do jsomething and be something;or we can go at it mad and all undone,with \aa frown on our faces and hatred and revenge in .our hearts._Which’are you going to do,my friend?—This year will mean to you just what you imake it.Listen to this little poem? \Do*you covet learning’s prize? Climb her heights and take it; (Tn ourselves our fortunes lie, Life is-what.we make it. There is one other-Christmas--wed- ;ding that we-wish to mention.briefty,|and that is the ‘one that took place in the pretty home of Mr.L.C,Hen- iderson,upon the ridge,facing the Blue Ridge on the north and looking laeross the quict,picturesque valley to the Brushy mountains,on the west, where his pretty daughter,Miss Ef.| fie,was given in marriagé to Mr. Charlie Coleman.This happened a few days prior to the holidays.Rev.\J.G..Weatherman ‘spoke the words that made them man and wife.Sev- eral_of.their relatives,with a few friends,were present,A most excel-| ‘lent dinner,befitting to the occasion| and the kind that draws out the most and best that is in your appetite,was| 4| Moffatt,Former Teacher at| |t SURE. Don’t fail tomorrow tovisitoneofthesbelowandgetone of those dainty and uuique trial bottles ofRieger's wonderful new Flower Per-.fume,They are going With @ rush y- body wantsone. MON AMOUR-—"“The Sweetheart of Perfames. 25¢Trial I Qs Bottle Sees at wr choice of odors:Garden»Violet,Rose,Lily ofthe weues Everybodyin town is talking about.this new perfume that has displaced every other in the favor of ladies of fashion,Not like anything you have everscenbefore,You shnply must ‘try it t6 know how differentitis—-how perfectly it preserves the full,true,delicate fra-Sranceof the real dowers from which it is NradeMarkRegistered PERFUME : $1.00 per oanceany quantity dedired Gasden Queen is the latest sensatian and mostfashionableodor,Be sure and try this wonderful new and fascinating odor. Remember,this special Trial Bottle distributionislimited.,Get one tomerrow——at one-halt theregularprice—at any of shea €styress Statesville Drug Company: ALLEN EE E rx 2 rnwy EE S er , TE S T O R TE S YB U D O Y U I N CE U a U a U ! THE FOUNDATION OF A HAPPYHOMEISLAIDINTHEKITCHEN, Go.behind the scenes of any happy contented familyandinmostcasesyou'll find the secretin the kitchen.§1 A dependable range lifts mother’s household worries|and ends father’s late-meal troubles.Equipped with city water connection—15 gallonKjcopperreservoir.See them at ie Crawford-Bunch Furniture company , >nee.P LON E400),Aetnanne‘The Store 3Thatbnriilaihc Welcomes You.— The Statesville Realty &favesemeat Co.INSURANCE!== As a great many.policyholders do not seem to new that their insurance will be void under certain conditions named in thecontractofthepolicywhichtheybuy.We deem it advisable tomentionsomeofthecausesunderwhichthesamewill.be rendered valueless,viz:1-—-Vacant or idle property for longe®than’30 days—apply to 7agent for permit.—~Mechanics making additions to,or extratrdindry altera- tions.in or‘on.property-—always getpermits from agents.Property,upon which.there.is.a mortgage unless notice of asthe:is given—apply to.your agent. ca s e iserved immediately after the-cere- [MORysThese are north TIredell’s —bright land promising young folks.May they find much that is pleasant and happy | in life._Turning .from this pretty picture,| ve have -to_paint-a darker_one,in a! |sense—-one that contains the shadow; of death.Mrs.York,the widow of | iMr,Alfred York,died December 22d 4-Any change in the title or ownership,or interest in proper-ty ee other than by death,Assignment or transfer of property to another. -By any imcrease in the hazard,notice must be.given. —The taking of other insurance without notice.3 Keeping ‘explosives on the premises without permit /other than kerogene oil.9-—-Property encumbered by chattle mortgage, 6q of dropsy.She was hur =at Wjn- \throp church.Rev.J.Weathér-| man conducted the inane services. She was around 70 years of age,a consistent member of the.Friends church and a good woman.There are; surviving her five sons and”two}daughters.\ |Mrs.J.W.Vanhoy of Concord—is |visiting at her fathér’s,Mr.W.A.Ga- sey.Prof.Vanhoy has gone to Wash- |ington to accept a position.as secre- ltary of the agricultural committce,of which Hon.R.L.Doughton is chair- /man.We are glad to see our Mr. Vanhoy climbing.May te yee reach the topmost round ’er@ he quits. |A Birthday Dinner. |‘orrespondence of.The Landmark. )There was a surprise birthday’din-‘ner at Mr.J.H.Friesland’s Sunday, |January 2d.in honor of his’55th birthday.Forty-seven relatives and friends were present and’enjoyed the occasion,“A sumptuous dinner was served.Mr.Friesland ig a good citi- en of notth Iredell and we wish him ONE PRESENT. LASSOTO, \Women of Sedentary Habita, |\Womentwho get but little exercise are likely‘to \be troubled with constipation ahd Indiges-tio and will find Chamberlain's Tablets hightuiveeeygoodosathreeorfour Sreealk.eve:see tha toad to remat ‘day,but,very)much better}aninacon=|) Policyholders should read lines 7 to 30 of the printed contract of their polici ies.It-is impossible for agents to know of these de-ficiencies unless notified.Call’on us for any INSURANCE infor- mation.*?WF“WE INSURE ANYTHING INSURABL E.”i J.F.CARLTON,Manager, ‘PHONE,54,STATESVILLE,C.} |#|FOR SALE!Jal Sc0-nere Alexander County Warm,near school and churches,near:, estrailroad:station six miles,fronting on both sides of public.— road,soil and location well adapted for fruit,grain and:stock, farming.Over two hundred fruit trees.Two-story,6ix-room dwelling,two tenant houses;barn ‘and out-buildings.Well water- éd by branches and springs.150 acres in cultivation,generally level and productive,balance in woodland which will cut over one-~ hundred thousand feet of timber,Bargain at $17.00 per.acre: Seventy-eight acres one and one-half miles from Sta joining the State Experiment Farm,WMorty:acres i jevel.and productive,five of which is branch bottom, woodland.Three-room cottage,small barn,two Rens ‘located for dairy and truck farming,4 For.further information call on or write,ERNEST ¢GAITHER,GENERAL INSUansANDPHONE23,1, January 7,1916. A SHINING EXAMPLE. Declaring on his return from abroad that it is not “the interests” that are-responsible for the war but the people themselves —the people ~~who are being slaughtered—becausethey“have been too content to let those who rule them do their think- *ing,and they have not taken advan- tage of their divine right to say for themselves what they shall do and think,”Mr.Henry Ford,promoter of wu.the.peace expedition,said:soe :‘*“Republics are @o better than mon-archies in-this respect.Even in theUnitedStatesweallowthosewhomwehaveelectedtoofficetobeswerv- ed from their duty.We do not assertourselves.Personally,I have voted -only six times and then because mywifemademe.”xWhiletheassertionthatpeoplein republics are as indifferent to their -rights ‘and privileges,as the people of monarchies,may be questioned,it will not be denied that the citizens of republics—-and of this republic of the United States of America—too often manifest-an amazing indifference to the public welfare;and too often neg- lect not only their rights but their duties as citizens.And Mr.Ford is a shining example of_this indiffer- ,ence.Here is a man who,according to his.own confession,has voted but six times in 30 years and then his wife,he says,made him vote;which shows that’Mrs,Ford is the better _citizen of the two and better fitted _to exercise the rights of the citizen. And yet Mr.Ford,who neglected the duties of citizenship at home,where every man is a-sovereign,thought himself called to go abroad and settle 'the mightiest conflict since the dawn of time.Is it any wonder that the Ford peace expedition was a laughing stock,with a man_like that at the shead of it?7 NOT A GOOD RECORD. The difference in the number of Passengers and the number of ‘the ‘erew saved from the wreck of the British steamer Persia,in ‘which Consul McNeely of _North Carolina Jost his life,is very noticeable.The “*otal number of passengers reported was 241.Of these 87 were’.women and 30 children.The number of pas- sengers saved is reported to bé 59,17 of them women (no children reported saved),The total number of _the crew was 159 and of these 94 are re- ported’saved.The total passenger loss,according to the reports,is 182, _of these 70 being women and 30 chil-dren;While the numberof the crew -‘lost was,according to the same re- sport,only 65.That is to say more “women were lost among the passen-gers than the total Joss of crew. Jt is an unwritten law of the sea ‘that women and children shall have first consideration in case of disaster and all passengers shall be given precedence over the crew.©On boats “where discipline is maintained this rule is observed.If members of the crew choose to save themselves and let the ‘passengers take chances,the crew of course has every advantage. ~They man the boats and know better ‘how to protect themselves. “In the face of death it requires manhood to consider others>tg give others the opportunity to live while “you take chances on going to death. That test is the greatest test that somes to mortals and many there be who fail when it is applied.The con- trast in the numbér of the crew and ‘passengers saved from the Persia is not creditable to the crew of that ship. ARNENORTETTCIT OTN | Avcitizen of the third congressional| «district has written Congressman Geo. Hood suggesting that the govern-| ment could tax a luxury and secure much revenue:by imposing a tax on ‘soft.drinks—say a half cent on each bottle manufactured and a_like’ hount.of syrups.Argu:ng for the | drink tax,the writer says: It is time to make this luxurywhichsweepsinalmosteveryone, om infants-to~old age,which nottakesthesparechangeofthosebettercircumstances,but impov-ishes the poor,pay a revenue.” Calling attentionto the fact that bills of lading,deeds,’phone sages and other.forms of busi- ‘are taxed,this North Caroliniannéiststhatattentionshouldbegiven}the luxuries.Soft drinks are a y;pure and ‘simple,and The holds the view that a tax 8 should be limited only by revenue-producing capacity.| wil *little tax.be-tle to cur-, es should on someextracts from ‘the report of the reticent errata Met Saeedee TAX COMMISSION REPORT.The Landmark is printing "today State Tax Commission.Explaining real-estate in the (majority of ‘the counties of the State,the commission shows that the increase,which aver- ages about 10 per cent.,Is just about half the increase made by local as- sessors,without any intetference by the State commission,in the four-year assessment periods during the past 15 years. up those counties where there duce more revenue. in the Union. ing the assessments. some cases the assessment was it was too low.But the fully assessed gwent the inequality as it was!The qualities often exist. Durham Herald. world, Nothing in Mr.Poe has.a right to run he is so amind and members of Farmers’Unton have a rigiit to vote for whom they.please, the polticians seem to think the end of the world would be in sight if that should happén. Judge Long of Statesville has been mentioned in connection with the va- eancy on the United States Supreme Court bench.Whether the judge is a man for this important post.In.legal ability he measures pew any whose hames are mentioyed:or will be,and for pains-taking industry.it-would be difficult to find -his equal. The statement copied in the Char- lotte Observer from the Cape Fear News,that the editor of The Land- mark had told the Observer that “the life of the country editor is~full of woes,”is as complete a misrepresen- tation of the facts as could be contain- ed in one short paragraph, Strength of the Militia. Washington Dispatch. The strength of the organized mi-litia_-of North Carolina increased from2,576 in 1914 to 3,020 in 1915,or 422enlistedmenand2officers,accordingtothereportmadetoCingressbythechiefofthedivisiongfmilitiaaffairsoftheWarDepartment.The enlist-ed strength in-1915 was 211 officersand2,809 men. The greatest increase was shown by Michigan,which added 295 enlisted men to its:enrollment in 1915 over 1914.The greatest falling off ‘wasshownbyTexas,which had 610 lessenlistedstrengthin1915than.in thepreviousyear. The ’total.enlisted strength of the militia for the whole United States gained 1,422 in 1916 over the pre- vious year.The total strength in 1915 was 120,693 enlisted men and 8,- 605 officers. There were in North Carolina in 1915 392,192 males of military age (18 to 44 inclusive),and of these 3,- 020 were in the militia or .77.per cent, placing the State 19th in rank,based onthe per cent of the number of males of military age in the organiz- ed militia.The District of Columbiarankedfirstinthisréspect,New Hampshire second,Hawaii third,Ari- zona fourth,New Mexico fifth and Idaho sixth. Of the total of 20, military age in the United States in 1915,.63 per cent were in the organ-ized militia.° Wrights Made ‘First Successfu! Flight in This State. Twelve years ago—December 17,1903-—the first successful flight of a human being in an aeropiane ariven by.mechanical power was accomplish-ed by Orville Wright.Over the bleak sand dunes of Kitty Hawk,N.C., Wright sailed for 36 sewoncs.It was not a long flight,but it served to con-firm the Wrights of their success and to prove that navigation of the air in heavier-than-air macnines was a-re-ality.,:That first flight marked the begin-ning of a new epoch in history.Dur-ing the’dozen years that have inter- VYened much has been done in the de-velopment of .the aeroplane,in thefaceofitspitifultolloflite.‘here ismuchyettobedone,forthe naviga-tion of the air is yet in its infancy.The Wrights,Wilbur and.Orville,had been studying the problem offlightforseyeralyearsbefore.theyhadcompletedtheirpreparationsforatrialtripawayfromterra.firma: Men of greater scientific knowledidattainmentsweretryingtoreachtryingtoreach the increased ‘assessment placed on. ? Washington Dispatch. in\this country,andthewarbeganthere had | |xteady increase of about,15 per cent.wnually for a number of years.Oneofthemostnoticeableresultsofthe increased home production was the “anid 4 on ry in ae ye Hosie decrease in «mports..From a The increase was to equal- ize as nearly as possible the values in the different counties and to bring was under-assessment,as well as to pro- The commission also points out that’taxes are lower in North Carolina than in any State The Landmark thinks the commis- sion Was Tight in the maw imercase It has been the fairly be made of the commission.is| that in making a general increase in counties some individuals suffered.In ad high as it should have been;in others increase made’on a county as a whole:applied | to all alike,and while individuals un-| der-assessed were brought up,those; higher,leaving only just method is first to foree equaliza- tion in’neighborhoods and townships in a county,where most glaring ine- “And'suppose Clarence Poe wanted to.run for Governor “and the Farmers’ Unidn wanted to support him?What would be/wrong about-that?”asks the! the; for anything from President down if the But some of candidate The Iandmark is not advis-| ed,but the President would make no| mistake in.selecting the Statesville 538,347 males of| 1909 to 1915.imports of cotton ho-siery fell off from $6,400,000 to *$3,- 400.000,or over 50 per cent.Recentstatisticsofproductioninthehosieryindustryarenotavailable,but someideaoftheimportanceoftheindus-try may be had from the fact that*n 1909 the output was valued at near-ly $69,000,000. One of the.most important reasons assigned for the satisfactery state.ofaffairsistheexcellenceofAmerican seamless hosiery:“This style-of foét- wear is distinctively American,—It American manufactur-confined yerfection by 1 ers and;the manufacture is eneral policy of counties to hold!:e ee ‘argely to this country.Low cost ofdown.assessments to escape State|manufacture is the main reason fortaxes.The..only criticism that can/ts position in the market. The study of the industry included 78 establishments in 16 States..Of these mills 55 earned manufacturing »rofits and 18 had losses,The aver- ige.manufacturing profit on net saleswas6.66 per cent and the average manufacturine profit’on,capital em- More Lynchings Last Year. Monroe N.Work,head of the ‘de- vartment of records and research’of Tuskegee Institute,Ala..in his annual report shows that during the year 1915 there were 6%)lynchings.Of those lynched 55 were negroes and 14 whites. und three whites.Included in.thereeord-are three women.In at least four instances it later developed thatthepersonsputtodeath’Were inno- cent of the offenses charged.Eight- gen..or_more than one-fourth of the \total lynchings,occurred in the State of Georgia.Only 11,ten negroes and one white,or 15 per cent.of the total, were charged with criminal assault.Lynchings by States are reported as follows:Alabania 9,Arkansas and Florida 5 each,Georgia 18,Ilinois 1, Kentucky 5,Louisiana 2,Mississippi 9,Missouri 2,Ohio 1,Oklahoma.8, South Carolina 1,Tennessee 2,Texas 5,Virginia 1. ties,however,deny tnat a lynching occurred in that State.The report grew out of the renort of a lynching at Hopewell,Va.,ducing the big’fire there,sipashipiuaninatcigo societies Bill For “Compulsory...Military Service.we| |.Under the terms of the compulso- ivy military service bill introduced in ‘the British House.of Contmons©all|males:between the ages of 18 and 41 jout children dependent on them,are |iable for military service;Ireland is axcluded from the terms of the meas-ure. Mr.Asquith said no case had been made out for general compulsion andthatthebillhewasintroducingcould be supported by those opposed to 'con- scription., MARKET REPORTS. Statesville Produce Market.The following prices were paid yesterdayforproduceonthelocalmarket. Spring Chickens 10c.per Ib.Turkeys,lc.‘per 1b, Hens,10c,per Ib.~ Eggs;25 per dozen.Roosters,6c.per Ib.Butter,16e.per Ib,Beeswax,25c.per Ib.Grech Hides,lle.per Ib.Green Hams,18c.to l5c.per Ib. Old Hams 18 to 20c.per Ib.Sides,12¢.per Ib.Shoulders,12c.per lb.# Red Honey,8c.per pound,Sourwood Honey Comb,16 to.18¢,per lb. Grain.The following prices were paid yesterdayorgrainonthelocalmarket:Wheat,$1.30 per bushel.Corn,(new),60e..per bushel.Oats,55c.per bushel. Statesville Cotton Market. On_the local market _yesterday 12c perpoundwaspaidforbestgradecotton,Seed cotton,5:20. Cotton seed 55c.per bushel, CARRY STOMACH JOYINYOURVESTPOCKET The Statesville Drug Co.Have SuchFaithinThis’Dyspepsia Remedy That ‘They Guarantee It. One ofthe greatest —successes ‘inthesaleofmedicine«has been achieved by Mi-o-na,the standard dyspepsia remedy,and its sale is in-creasing so rapidly that the States- |ville Drug Co.,the popular druggists,jhas hard work to keep a stock on ‘hand.It is very popular with bank- ers,ministers,lawyers and _others whose business or profession.keeps them closely confined,while those whohavebroughtonindigestionthrough irregular eating,worry,or,other causes,have found relief in this re- liable remedy.LMi-o-na comes in tablet form and is.sold.in a metal box especially de~ signed for conwenience in carryingthemedicineinthepocketorpurse,It is pleasant to take,gives quick re-lief and should help any case,no mat-ter of how lonf#a standing.Thisremedyhasbeensouniformly.‘suc-cessful that the Statesville Drug Co.will.in future sell Mi-o-na under a positive guarantee to refund the mon-ey if it should not prove entirely sat-isfactory.~, ‘CEILING,FLOORING, WEATHERBOARDING. ©.WATKINS. R.G.ROSSER,M.D..GENERAL PRACTITIONER, Vas brought tov its present state’of! oloyed in business.was 11.56 per cent. In 1914 the record was 49 ne oes| The Virginia authori-|) |who are bachelors or widowers with-} + | }||| | |{i = a sia e *‘;5 };:5. The object-of the-GCHRISTMAS-~SAVINGS €Elub is*td offertheeasiest. method for making this-beginning,with the belief that yaur:own inclination to save will accomplish the desired result. ‘¥ Our plan encourages systematic Saving and provides an easy way.to.save for Christmas or set aside a certain sum out of your earnings during the year. Over 800 have already joined,and others joining every day,and:we expect to pass the 1,000 mark most any day.i‘ If.you have not already joined,we would be glad to have you do so at once. You may join one or more of the following classes: —‘ \ \ Members starting with le.and increas->y elege Le LO Members starting with 0c,and de- for Afiyweeks,getDLO10$12.50 $25.00$50.00 ing 5c.each week for 50 weeks,get see eee eee . creasing 5e.each week for 50 weeks,get ..... Members paying 25c.‘a week fixed,50 weeks,get ing 2c.each week for 50 weeks;get veMemberspaying50c.a week,fixed,50 weeks,get creasing 2c.each -week for 50 weeks,get ....0/ Members paying $1 a week,fixed,50 weeks,get An Established Truthin Regardto Saving is That Many\ People Who Desirefto SaveSeem.Unableto Makea Start }\ oust Members starting with Be.and incréas-.$63.75 Members’starting,with $2.50 and dee :OE$63.75 | Members starting with 2c,and inet Tt$25.50 |. Members starting with |$1.00 and.de-| x ae ee / Everybody welecome—-no‘charge to join.You may pay weekly or in advance. Parties in the country may ‘pay when they come to town,or.send by mail. MERCHANTS &FARME Of Statesville. RS’BANK | “THE BANK FOR YOUR SAVINGS.” We are now in the midst of taking our ANNUAL INVENTORY. Many good values from throughout our Sale at Bargain prices.Yours truly, stock are being placed in our January — SS Peanut Butter.” (OUR OWN MAKE) Made fresh every day and sold in half-pound package at 10 cents—just twice as much for 10 cents as you generally get. Sherrill &Reece,Olive ’ =Phone 123._108 West Broad St |HARMONY,-++.N.»py The farmer who uses.Genuine Oliver ’Don’t Forget _Toincludea can of our.- Gold Medal Coffee in your next order.You will like it.~A fresh ‘shipment just in.We have a complete lineheavygroceries,suchasPotatoes,driedBeans,Peas,etc. —’PHONE 89— Eagle & Milholland.Sanna esate ts.a Mother Earth with Oliver Plows has brought big bankaccounts to hundreds of Iredell county farmers,Are you one ofthem?If not,now is the time--to get on the band wagon,.Buy from us and be'happy.Yours truly; A Chilled Plows is one who notonly believes — in Preparedness”but backs up his faith — by his work.The continued tickling of. ae ee ihe j be try f | Ms ho ce i ¢ $25 50 |etFN ‘:ee j tf ‘* Meds 5 he ‘eee: ; , | MS ING ‘eee ?Ke RS *+ '{ ye 4.r ‘ES > .~ ;j @ ‘ 3 oy .e o namite;M yey E: O14.Ro Taare F016, ‘TINENTLY PER DNAL. tion of Folks Who Come and| Calomel:Go. feft’join Mr.Bowman and his er and sister. j Statesville.»Miss «Frye,has returned to her home inNewton. eigh to enter the A.&M.College. A.&M.but had to give;up his stud-me on account of ill health. ¥.Miss Lena Swann is at home fromWadesboro.Mr.and.Mrs,J.D.Ross and little daughter,Sarah,of :Lawton,‘are visiting Mrs,Ross’sister,Mrs, R.P.Allison.|.Mrs.W.E.Deitz left Tuesday for.\Kansas City,Mo.,to join Mr.elwhoMissElizabethGunningham,was at home for the holidays,retuyn-ed Wednesday to Blackstone College,Blackstone.Va.«Mrs.S,B,Miller and children havereturnedfromavisittoElkin.Mrs.R.L.Poston and son,LewisPoston,and Mrs.Bell Carlton return- ed Tuesday night from a visit to Mrs. Poston's sister,Mrs.Zack Taylor,inCharlotte,‘‘Mr.W.A.Cooper of Raleizh owasthequestofMr.and Mrs.B.F.Rus- sell’Tuesday and Wednesday... .Mr FYorAsheville,where he will spend a few days.\Mesdames Ralph Corpening and J. M.Wagner and their children,who _were “guests of Mrs.Chas.H.Turner, have returned to their homes in New- ton.“Mr.Tyree.-.Glenn of Greensboro, who is a government income tax in- gpector,spent Wednesday and yes- terday in ‘Statesville.; Rev.D.A.Goodman,who visited his sister,Mrs.W.H.Lippard,at Barium, .has returned-to his home at Connelly Springs.: “Miss Marguerite Porter of Barium has returned to Lenoir College,Hick-ory,to take up her studies.” Notice ofNew Advertisements. You will like gold medal coffee.— Bagie &Milholland. “Fresh peanut.butter.—Sheiritt“"& Reece. At the Lyric today and Monday.| Everything to build with—C.Wat- ins.: “Saving is easy.—Merchants & Farmers’Bank. *>Specials —The Robert Bunch Cash Grocery Co.y.E ee The Chocolate Soldier at the opera house tonight.pete fF Big auction land sale next Wed- nesday.—R.V.Brawley.: Rieger’s flower drops.—Statesville Drug Co.“Graetings from-tredell Hardware “Oliver chilled plow.—-Lazenby- Montgomery Co.Men’s and.women’sSherrill-White Shoe Co.@ Many good values for—Mills &Poston. “Seven-room house for sale.or rent. —R.A,Cooper.;, ‘Bireproof safe wanted..—R..L, Weatherman,Hamptonville. ‘Cottage for rent—Dr.M.‘R.Ad- hosiery.—- January gale. ams..j Pigs for sale-—M.P.Alexander & Bro.Stock for sale—Carolina Motor CoPosition as bookkeeper.—¢.R., *care The Landmark.oe Farm for rent.—E.G.Gaither. i»Shirt waists.—Ramsey-Bowles- ;Morrison Co.:‘ A Marriage —News of New ~~Stirling Neighborhood. *4 “Correspondence of The Landmark. “Statesville,R-6,Jan.5 —Mr.“E. 0,Harr and Mrs.Rose,who spent a ‘month or more at Mry Jake Lackev's, Se lett Tuesday for Jecksonville,Fla., where they will spend the winter. Mrs.Rose is from New Jersey and a relative of Mr.Harr.: Mrs:Caroline’McKay,who will be Beyears old next Saturday,is quite aiek,a coe “Mr.W.BE.Morrison is ridding his fields of stumps by a pulling machine. The breaking.of a chain caused:his accident.He is out on crutches. *"Miss:Lena Gray returned home from Rocky Mount Monday.Mrs.Jy Watt Gray accompanied her.: Mr.George Deal and Miss Eulalia Alexander,daughter of Mr.and Mrs, J.A.Alexander,were married Tues- ‘day,Rev.W.D.Haltiwanger officiat- ing. _.*Folk Lore Material Wanted. ,ie:Correspondence of ‘The Landmark. *.lege has requested that the members '_©of the Iredell Betterment Association ee sin.this.county’colleot all “/the ‘material possible for a book of forth Carolina folk lore,which he will publish shortly.To this end will ch teacher,or any one in the coun- gather:from the school children, “friends and residents of the neighbor- od,the most interesting folk lore be found,with the name and vad~ ss of the person furnishing the aterial and the lengthof time it has 8 ieie stating if ‘the person nisadell or not?The teachers are asked tothe,meetings of the teach-{ation any.material secured,“it to any officer of the Better- me ‘4 ~%.E.Bowman and childrenfewdaysagoforSlidell,La,, sister,ev were accompanied by Miss Lau-‘el Bowman,who will visit her broth- nie Debora Tharpe,of Winston-Salem is visiting her homé people in Eva Caldwell,who visitedMrs.Jas.E.Tharpe and.Miss Charlye ao Hie Mie,Bt.&Grose of Consoed:teen:dine Ship.left.Tuesday afternoons for:Ral- Mr,Grosé was formerly a student,at W.W.Tharpe is in Baltimore.4 Okla., ing the material is a native of ‘HE TWAIN MADE ONE: Marriageof Miss Hoffmann and Mr,Kaufman a_Brilliant So-cial Event —The WeddingCeremonyaitdReception— Other Weddings and Social.Affairs. Reported for The Landmark, Mrs.Jacob Henry Hoffmann. ville,Va.ning at 4 nue. friends.jTheceremony took place in decorated —with Southern smilax and white roses.To the strains of Lohéngrin.played by MissRaeGill)the bridal’party -entercdfromthestairwayinthefollowing Irvingorder:‘The :ushers,Messrs.Goodman and S.Wallace ,;Hoffmann,followed by Miss Corinne Clarke and Mr.Isadore Wallace,Miss Ida Clarke)joriained the bbi@al party Tuesday|and Mr.William Fox,’Miss Babette Kaufman and Mr.’W.H.Hoffmann, Miss Elise Wallace and Mr.Benja- min Hessberg,Miss Leah StephanyandMr.J.V..Wallace,who tookplacesalternatelyoneachsideofthealtarformedofpedestalsdraped with smilax over white tulle, ‘sup- vorting crystal eandelabra with lighted tapers.The groom entered with:his best man,Mr.Clarence Kaufman.followed bv the maid of honor,Miss Carrie Hoffmann.sister of the bride,and little Miss Mildred Wallace,the flower girl. ing room.from the hall. Dracoll'gown fashioned of ivory satinwithoverdressoftulle,and T.Meacham left yesterday}an raped fromthe shoulders withcoxecombplaits.Her veil of —tulle, caught with orange blossoms,extend-ed to the end of the train.The ycor-onet.of orange blossoms worn by thebridewerethoseofhermother.She carried a presentation bouquet The bride,who is a sirikingly hand- some brunette,was radiant in her bridal costume.Miss Carrie Hoffmann,the maid of |Calle |Mrs.taffeta shot with silver overflounces |pisher,the latter of Norfolk.Domi- ino and hearts were played at eight|tables. }seore prize and Miss Gilmer was pre-ae *fons::sented.with a prize as ‘svlaitedchiffon,and carrjed a.French |5."Pp as guest of hon honor,wore a Callot model*of white of flesh tulle and ‘silver lace,and car- ried pink roses and lilies-of-the-valley.Little Miss-.Mildred,.Walldce,—the flower girl.wore a ‘rock of pink basket of pink roses and sweet peas.The bridesmaids wore Lucille costumes of pink tulle over pink satin;trimmed.with flounces’of silver lace and French buds of the|Mr.Boyd Monteith of Huntpastelshades,and ¢arried LaFrance roses and Marguerites. Miss Hoffmann was,graduated from,Randolph-Macon .Woman’s Col- ‘\jege in 1913,and is ‘an exceptionally talented and accomplished young wo-man.Mr.Kaufman is a member of ville,and is a young man of unugual promise. Immediately following.the ceremo-; by -the}.ny.a reception was»givenbride’s parents from 7.30 o’clock to 10.The entire ,home was profusely decorated.with Southern —bamboo, smilax and white roses. In the drawing room,in which the ceremony took place,were Mr.and Mrs.Hoffmann.parents of the bride: Mr.and Mrs.Kaufman,parents of the groom;and the entire bridal /par- ty..Mrs.Hoffmann wore cloth of gold with overdress of orchid tulle, bodice of.gold and orchid”brocade.Mrs,Kaufman wore a gown of gray chiffon ‘velvet. Miss Rose Stephany directed -thegueststothedining-room,where buf- fet refreshments were —seiyed by Mesdames W.M.Barringer and-J. F.Bowles.The table was done in sweet peas and tulle. Miss Celeste Henkel directed to the punch room,where Misses Rae Gill and Elmina Mills -presided at thepunchbowl.Misses Annabel Walton and Mary Bettie Feild were in the gift room,-and-the —bride’s _registerwasinchargeofMissSarahAdams,| In the library were Mr..and Mrs.'})|William Wallace,Mr.and Mrs.Har- irv Hirsch,Mr.and =Mrs. Clarke,Mrs.Morris Levy,and Miss- es ‘Carrie and Miriam Clarke.‘A stringed orchestra played throughout the evening.j Mr.and Mrs.Kaufman left imme- diately..after the reception on —the night train’for New York,where they will spend their honeymoon:The bride wore a tailored traveling suit of dark green cloth,trinimed with mole skin,with a stnall mole skin hat and.muff.; Out-of-town guests:were Mr.and Mrs.J.Kaufman,Mr.Clarence Kauf- man.Miss Babette Kaufman,Mr. William Fox and Miss Atice Rosen- lstock of Danville;Mr.and Mrs.Hen- ry Clarke and daughters,Misses Car- vie,Miriam,Ida and Corinne,Mr. Leon Clarke,Miss .Merle Hessberg, Mr.M.Hessberg,Mi.Benj.Hess- berg,and Mr.Irving Goodman of Richmond;Mr.and Mrs.Harry Hirsch of Lynchburg,Mrs.Morris Levy of Lancaster,Pa.;Messrs.KEN,Wallace Mr.Frank C.Brown of Trinity Col-jand,David Oestreicher of Salisbury;Mrs.B..I’.Rosenbacker and daugh-ter,Miss.Fannie Rosenbacker,‘andMr.A.Rosenbacker of Winston-Sa- lem. Reported For The Landmark. At the home of her parents,Mr. and Mrs.William Wallace,318 Wal-nut street,Miss Elise Wallace enter- tained Tuesday evening at a dinnerpartyinhonorofMissAmeliaHoff-mann and Mr,Louis Kaufman,whosemarriagetookplaceWednesdayeve-ning.‘The invitations ‘were limitedtothebridalpartyandout-of-townguests.‘Those present were MissAmeliaHoffmann\and.Mr.LouisKaufman,Miss Babette Kaufman ofDanville,Miss Merle Hessherg ‘ofRichmond,.Misses 6 and «LeahStephany,the Misses Carrie,Miriam,a and ké.of Richmond.Messrs, nd, The wedding of Miss Fannie Ame- lia Hoffmann,daughter of Mr.and andMr.Louis Lavaille Kaufman of Dan-took place Wednesday eve+o'clock,at’the attractiveHoffmannhomeat862WestEndave-_The’ceremony was performedbytheRey.Dr.Edward N..CalischofRichmond,in the presence.of the immediate family and a few intimate 2 the drawing room.which was.profusely bamboo, The bride} came down the stairway on the arm| of her father and entered the draw- Miss Hoffmann wore an exquisite|irs.T;Foy White court|» ;courses of refreshments followed the; of| white orchids and lilies of the valley.|wy to her sister,Miss Arleene Gilmer,| |who was fascinati |mother,Mrs.ascimaung!ing a salad ‘course and sweets. |Statesville on the afternoon train;ac:|;companied by Misses ;‘and Estelle Fleming,and was met ati SHING!ES and LUMBER ||the railway station by Mr.Monteith,|||who had come to Statesville earlier| the firm ‘of J.Kaufman &Co.of Dan-|in by Miss Morris and Mr.Holbrooks ofdoreWallace,W.°H,and 8.W.Hoff-Huntersville,mann,D.F.and J.’W.Wallace,theformerofNawYorkcity.The home was artistically decoratedthroughoutwithpottedplantsandcutflowers.In the dining room the colorSchemewaspinkand‘white,the tabledecorations.being pink azaleas andwhitehyacinthsdrapedwithpinktulleandsmilax.The favors andplacecardsweremostattractiveindesign,hearts and wedding bells withorangeblossoms,filled with mints.The place cards were unique withoriginalverses,written by the host- ess,betraying characteristics peculiar Nene ea ee courses “Cu- pid’s Ledger,”a publication written Te rare arta expressly for the occasion by Miss|mrs,Sena “wien”Atta ° Carrie Hoffmann and Jack W.Wal-j|writes:“I first.used Chamberlain's.Cough|lace.was distributed by little Miss |feenety apo cnt veers abo;At that time|Mildred Wallace.While Miss Hoff-timc”ft provedte he just ered most of themannhasbeentherecipientofmany|broke up the cold in a few days,and the functions prior to her marriage,none cova enna fmcuenens.1 have told many|was more elabotate,the dinner ‘being (of;frends of the kood,1 xeoelved throughperfectinitsappointments.jspeak of it in the highest terms.’Obtainable|Miss Wallace wore a fetching dinner everywhere,gown of gray satin with over dress of ADVERTISERS will please bring:gray tulle and ‘saphire trimmings.'change of copy early. Miss Hoffmanmwore-pink satin with.ad.-guaranteed “after 12 o'clock to-over dress of silver lace and —tulle,'!morrow.*with corsage’of lilies of the valley...,tsteer@.|(aAdy eNAtthesametimeMissWallaceen-i per Mes We aa ok than 25cents.Cash must accompany order.)| F,Kirk.The bride and groom left Huntersville,where cellent young‘woman, year employed in the postoffice.at Huntersville and has)many friends there who join those or er homecommunityinwishingherhappiness.| Mr.Monteith is a young farmer who is held in esteem by his friends. .evening.Mr,and Mrs.J.H. Hoff- i'mann gave a dinner party at their ‘home to other ©out-of-town |guests||here.for.the wedding.The dinner |jwas served in eight courses.The din-|WANTED—Position as bookkeeper or ollice| ‘ing room was decorated in pink and}Clerk.Write C.R.,care THE LANDMARK.| |green,the table center piece being!ifive crystal vases,connected with a|FOR RENT—Two-horselerystalchain,containing pink,bou-|High School District. |vardier and asparagus fern.The! |Place cards were penn go Ohad brides | a Oe eee an ee salted were.POR RENT—The Nicholson house on |%nuts,streety“Cupid’s Ledger,” FOR SALE-—Thirty-five shares Diamond Fur-!niture Co,stock and two shares Realty ‘and!Investment Co.stock.CARORNA MOTOR|an Tt | Get possession of barn GAYTHER,Statesville,N.'C. Jan,%—2t. ;j DORMAN THOMPSON,executor.a little paper pre-|Jan.7. |was read at the table. postoffice.R.A.COOPER.*Jan.7,—-2t. :entertained at)WANTED—Second-hand fireproof safe,two tables of bridge Monday after-|be cheap.R.'L.WEATHERMAN,noon at her home on Davie ayenue,|‘ville,N,C.dan.7 Mrs.E.N.Lawrence made the high |ror RENT—Cottage with score,but no prize was awarded.veniences,DR, Hamp- ae, alTwo}M.R.ADAMS, jgame.Miss Katherine McDonald of FoR SALE—Pigs.|Charlotte,who visited Mrs.R,M,)BRO Jan.7-2.| |Gray,was a special guest,*|FOR SALE—Two lots on Park Street.C.8.|i |1Mrs.Clarence Stimpson entertain-|TOMLIN.Jan,4—8t.ed Satur :i -||aturday afternoon complimenta |GINNING NOTICE—For remainder of season’ my gin will be running only Fridays andSaturday.Even exchange of meal for seed, Highest eash price paid for cotton and sedd.J.'T.JENNINGS,«Jennings,N.C.}Jan,4-—8t.e |} |FOR SALEMRS.M.ville,N.C.,R-5. her holiday ‘guest...The! guests -were received by the hostess|and guest of honor in the reception hall,where pimch ‘was served by C.:&.Raynal and Mrs.A.A. Engine and “aw mill.‘Apply to| The party went direct)to Broad Street Methodist parsonage,|where Miss.Long -andMr,.Monteith|were united in marriage by,Rev.John | immediately after the ceremony for! they will live,| The bride is a daugnter of Mrs,Ma-)ry J.Long of Elmwood and is an ex-|She was for a} No change of: Jan.7-24".lg farm in Harmony *} and land ‘at once,dwelling April ist.B.G.!y Bed fj pared especially for the bridal party,’fOR SALE OR RENT—Seven -room houne.|{All.modern conveniences,three blocks from|jf Mui i modern con-| Jan,7-—1t*,:}; M.P.ALEXANDER &/ff | E.WESTMORELAND,Moores-|* {dy by pe fs Vere , octane penn} SAVE! 4 big as a wagon wheel, accumulating,but start you will have anything. never et U.S.Depository. |FOR RENT—Brick wareroom at rear of Wil-|Miss Hal.Morrison won the ‘jiams Furniture Store.WALLACEco.‘ her WANTED—White girls to wait on table.MRS.|a:2 er)JNO.H.GRAY,Hotel Iredell.Dee.31.|E,G.Gilmer,in serv-|———~ss Hci eas aia pean geceHORSES,MARES AND MULES—I AM:AT} |mty stables with 85°head good Horses,| Mares and ~~Mules.Lot of nice young | Horses to trade for medium-priced .Mules,|Cash or time..C.E.DANIELS,Dee.24.|4 ‘Rough and Dressed — The hostess was assisted by Miss Rose Long of Elmwood.and||Mr,Mon sville | |were married*in Statesville Wednes- jday afternodn,Miss Long came to Nora Adkins! the day by automobile,accompanied ae W AT Ik IN s. ye puones.|Ramsey-Bowles-|“paonns |“187 |Morrison Co.|#87 ||16Shit Was (96 | Today we show some beautiful new Waists, made on new lines and of excellent material..’ LOT NO.ONE. Henry| White Wash Habutae Silk,some embroider- ed,some plain-tailored—special value,$1 each,| LOT NO.TWO...eebnheMES|| dery Trimmed,good values,...$1.00 each. LOT NO.THREE. Striped Tub Silk Waists,assorted colors |‘and some all white,extra good value,all sizes,34 to 44.06 go $2.50,each. REGULATION MIDDY BLOUSES. Made of good gtade White Jeans.Some allWhite,some with Navy Blue Flannel Collars and Cuffs—extra value || Some more elaborately made and trimmed Shs le Ni ime os 4 ce Ey OU CORCH, Sizes 6 to 20,.fe Send us your mail orders.: -Ramsey-Bowles-Morrison Co., ‘The StoreThat Pays the 1“.Lei}0 aa Dec.B1—8t*.|———sapeushapensinespanabaetn BROS.Dec.31st.|f/Supreme Hams Libby’s Rosedale:Peaches,25e. BIO TOR ee ie havi aw uae 22¢.Peeled Table Pesches,15c.‘size,for ..LOR oie ic Coun ek er oN 12¢,|Libby's Pie Peaches;10c.srze,for....9c.f-Libby’s Sliced.Pine Apple,20¢,826,TON icy baeetes NS hae min ohhed for Libby’s Grated Pine Apple,20e. BIZOy 5 LOB ake ance wa es wn 17¢, _CANNED FISH AND MEATS. White Lingerie Waists,Lace and Embroi- Young man,have you learned 1.oto save part-of..your earnjngs?.oe ;j A dollar may.look the size of a. 4 dime to you now,but unless you ;begin to take care of some of’ your earnings the day may:come wher a dime will,look to you as: You don’t have to have any big amount to begin saving and unless you Begin now apd learn the sav- ing habit through this bank. HE FIRST NATIONAL BAN ;--Statesville;N.Qs Capital $109,000.Four Per Cent Paid on Time De 20 1-2c.pound. Faultless Break- fast Bacon 25c.pound, "CANNED MILK.2 Waple-Milk ee icesccaok 15¢e:Liblly’s Condensed ..........9e,.Libby’s Evaporated ..........8e.Libby’s Evaporated .......2.«4¢,size,forCANNEDVEGETABLES.% Blue Ridge Corn’.........¢64 9e.°mie Meadow Corn .J.....6.8c.forFOGiniherpesOrewerieeee13¢.Pocahontas Peas ............17e.a eeStokelyBros.Peas ..........12¢,Libby’s Green AsparagusTips.22c.Libby’s White Asparagus Tips.27c.No.3 Tomatoes ......60veecee 9e. No.3 String Beans ..........1le. No.8°Hominy 2.0 echeeee 8e.No.3 Sour Kraut ..........55 8c. a CANNED FRUITS. Libby’s extra fine Red Salmon, RbCL RIZOy SOM eis5cetceues 22c.for Alaska Pink Satmon,l5c.|size, SU SON yy naa ne eien es tkaOras 12¢.or Heron Pink.Salmon,-10c._size,|Libby’s nd)sR REP HE IER agama Rana te 8c,size,f Libby’s Genuine Pork Sausage,5c. Bee TOR eereeeres 27e, Libby's “Sliced Beef,5c.size, LOR eeeciteoaees 138e. Libby’s Sliced Beef,10c.—size, GOR css cas copa eenrE 9e,for “The _’Phone No.229. vee...$1.00 each.| FRERASMUAS GSTS AENA CSUSB HYPE STATS ee | Men’s&Women’s Hosiery Haas Vienna Sausages 10. OF als gate mens,Libby’s Potted Me tneLibby’s Genuine-Deviled Ham Norwegian Smoked SAmericanSardines Shee e he ee ee eee ee ene Dee ee ees ewes Stuffed Olives,i0c.sigOPeeetyess:‘Libby’s Queen.( Libby’s large jars sour mit les,25¢.size’for ......,Libby’s large jars sweet mix PiJes,30c,size:for itLibby’s sour’mix Pickles,10c, Libby's ‘Sweet gets,16 prepared musta Eddy’s mustard drRytialbentley piedEddy’s mustard dressing,OF Veer SaNreene anDurkees’salad dressing wee e en eenes Oe ee heeowwel The Robert Bunch Cash ¢ House of Better Values.”’ Men’s Shaw Knit 25e.Lisles,all shades,i mA LE PR ICK Women’s 50e.Silks,White only, SALE PR IO Kh Women’s 25e,Lisles,Tan and Black SALE PRICK -..SALE PRICES ARE C_SEE-WINDOW Dis Nv aville,R-2,Jan.4 -—Themasholidayspassedveryquiet-cy:Shiloh school hristmas tree Christmas..eva, ‘appropriate programme byants.Rev,Robert DaviedatShilohchurchChristmasthosewhoheardhimsaythatchedanexcellentsermonforhagfilledthepulpitonlyafewWearegladtohegrofthisbrother’s great “zeal for.ther’s work,for it seems that very few young preachers are coming on toilltheplacesoftheolderones. Several of our young people who 8 away came home for the holidays. Mong these were Miss Mamie My- -|Farmers’Union DIDN’T GET AWAY WITH I| BoyWho Made an Experiment ‘With Powder’the Victim— Supper— Large Attendance at School—— A Wedding-——Personals. Correspondence of The Landmark,i Statesville,R«l,Jan.5 ~—The holi-days are over,and haw thankful we should be that awe.are.spared to live up to the present time.Let’s.all try to live better and nearer to our Cre;ator this year than we ever have,fprwemustrememberthatwehavenotthepromiseoftheyear1917.“As we réad our newspapers from week to week,we read of some one passing out of this world,prepared or unpre- pared,Death sometimes doesn’t give warning,After all of the great lrevival meetings which were held and|have returned to Mississippi to attended,we sometimes find ourselves and others doing.those things which we ought not to do. 8,who is teaching at Jonesville;iss Sallie Thomasson,who has a po-ition in Winston;Misses Lola Casey,Mary Thomasson and..Emma.Myers,)are jin school ise i )ee |..at _Misenhgimer;'salmon,pickles,pies, one of the ‘¢astern.counties,andlessrs.Roy Thomasson and Wadeome a.delightful party SaturdayMessrs,Thomas and Mon.Myers of New Castle and Mr.E.G. yers of Buck Shoals,rendered some cellent string music.They.werefistedbyMrs.J.R.Cook at the or-in.About 30 young people enjoyed @ occasion and all expressed them- Ives as having bad a pleasant time. Rev.Mr.Castle preached his first ermon at St.Paul M.E.church the ‘durth Sunday.The.people seemed to very much pleased with him. Double Wedding-—Visitors. Correspondence of The Landmark,‘ York Institute,Jan.5 —The holi- days passed quietly around _here. aieie was a Christmas tree at Rocky prings-Christmas eve.: ‘Messrs.George Walden and Jim puch are home from Iowa and Tom harpe from Montana:Mr.H.N. made a business trip to States- e Tuesday.”Mrs.‘P.F.~Murdock d Mrs.Sallie Mays of Hiddenite visited at Mr.W.A.Sharpe’s and Mr.&.M.Harrington’s during Christ- “Mr.Ashley Sharpe of\Charlotte pent some days at.Mr.Z.B.Sharpe’s. r.and Mrs.J.G.Lackey and little ghter,Lucile,wha,spent the hol- ys at Mr.W.A.Sharpe’s.have re- ned to.their home near Hiddenite. .Claud Millsaps and sister,Miss Rochalle,from near Statesville,visit- af relatives near here.Miss Mary wpe has returned to school‘at St “Point.Miss Mamie Harrington ted Mrs.W.F.Patterson in Tay- rsville.:: ‘Mr.Isaac Sharpe and Miss Maude nes,Mr.Harlan Willet)and Miss nnie Hines were married at the ‘home of the.bride’s father,Mr,Lee nes,December 29. ‘Mr.L.E,Crouch has bought ‘a new shing machine and Sharpe Bros. ve traded for a new saw mill. ‘There is some sickness among the Je folks—mostly colds.' ‘Eupeptic Springs School. orrespondence of The Landmark. The following named students of peptic Springs school were on the 7 roll for the first month:Boydoff,Owen,Eva and Essie Pharr, Ray,James,Floyd,Wade,Edith‘Floy Shaefer,’Victor Fowler,Ol- Mae and Ida Daniels,Eula Go- Corrine and Retta Douglas and ‘Templeton. he girls of the school are plan- to start a Schdol.Flower Gar- on the school grounds. ‘The boys have organized the Eu- ptic club,with John Sharpe .presi- and Rex.Weisner as secretary. ub will meet once a week.They also organized a Betterment with Ruby Douglas.president, “Templeton vice president and fadison secretary.Its meetings held “once a:week. ‘teachers are planiiing to open @ Moonlight School this week.There “be only a small number to at- ng School —-‘Mrs.Mitchell Very Ill. ‘yeanondence of ‘The Landmark Hiddenite,R-1,Jan.4 —The holi- @ passed quietly in this communi- nothing unusual happening.Some siting—some drinking. Mr.Carl Looper of Texas is visit- relatives and friends in the neigh- d by this school.Mitchell,widow of the -Mitchell.Her husbandatthreeyearsago.all else we farmers for some time.the farmer. WHEN 1 AM DED. no vi'lets over me am sone;th’brambull kiver meTHsleepon. fame a brambull br'ar,d ter live in th’woods sum hit sinitax,ef so you wish,ol ‘thing haint no ambish, ¢in when I am ded,ftombstoneatmyhed»h’opetiy 6 |. i Hey 1 git thar, ‘ood sumwhar,» in't Hevvin ef thar’s'no trees ckle ter scent th’breeze,Mnes ef th Sheperd’s fold ol yams ter pleeze? F e ‘saqueexed-out teers Ter me::fuse, ;supper New Year’s evening at thome of Mr. aren. s Ella Salmons,wao is teaching |other good things,such as a farmer’s| ey,who have pesitions in Winston.| .Lulu Johnson gave the young| lansfield Privette and Mr.Ramsour)| larvis,“The community was greatly late itchell,is very ill with pneu-! Juaper an’paved with gold — yousdon't know “whar. The Farmers’Union had an oysterthe and Mrs.W.A.Dear- Beside the oysters’they”served sandwiches and |wife knows how to prepare,}port a good time. It has become necessary to put more-seats in thé Plyler school house on account of the large number ‘of children in attendance. the exact number enrolled,but we are looking forward toe an teacher and also fora new school house.We are going to put forth ev- ery effort possible to.get the new building for the next term of school. Some days ago Everette Parker, a lad perhaps_of ten years,opened a shot gun shell,poured the shot and powder ina ‘snuff ‘box,applied the lid on the box and.throw the box away.Before he had time to think the flames flashed in his face. We hope his eye- Boys,thisciss# was swollen badly. sight is not impaired, warning.Don’t try it. Mrs:Andrew Unright is very ill with pneumonia.Mrs.H,J.Murdock has been sick for some time but is better. Miss Mattie.Tolbert spent the hol- idays with home people.Messrs.Will and Lemuel Hoover of Eufola are vis- iting relatives in this community. Mr.A.A.Hoover and Miss Mary Benfield were married last Sunday. ful and-happy life: ton-Salem purchased a nice carpet and presented it to Shiloh M.church. and wish-to-extend our thanks. A.Galliher.R.L.Murdock, es Elsie and Mary Plyler.Another tie Tolbert will take charge of it. readers a successful year. Christy Hurt. *Correspondence of ‘The Landmark. outman,R-1,Jan.6 —The holi-| beginning the’sate are over and inNewYeareverything oniet and-normal after a |Christmas and New Year. days “were celebrated here as in the seems to be ter off by the booze being off ‘the list. iting,sociables,entertainments ta Claus visited one and all. Mrs.—A,M.Johnson entertained their mas tree and social gathering.Mr and Mrs.W.T.Sherrill the married folks on Christmas night children of Mrs,Hinshaw’s-parents,_Mr.-and—Mrs F.Ky Ostwalt.\Mrs.D.F. ther,Mr.J. lorsville.“Miss Grace Christmas with Miss.Ophelia Gantt Simpsoir’s,spent the holidays 1|returned home after Year’s with herAverysuccessfulsingingschoolJohnson,in.Charlotte.Miss Emma|held for ten days at Linney’s'Kennerly spent the holidays with)‘ove church,conducted by Prof.|friends in Mooresville. Mr.Troy Christy suffered a very se last week, Christmas with Mr.M. ichange of copy early.No change 6 fad.guaranteed |morrow. ‘Ldon’t)know|« assistant |‘ a} match to it.and attempted to place! He| received a serious burn and his face We hope and wish for them a success-|| Mr,and Mrs.Bert Boger of ‘Wins-|entitled R.B.McLaughlin,admi BE. We appreciate it very much| Following is a list of the Sunday school teachers at Shiloh:Messrs.R. Fred.|Murdock,Mrs.A,P.Plyler and Miss-|© class will be organized and Miss Mat- I wish The Landmark ‘and its many THE HOLIDAY AFTERMATH Social and Personal Items—Mr.| good time The holi- olden time,except fire arms and whis- key were left out;end every one is bet- There was one grand round of vis-|- and gatherings of all kinds,and Old San- Mr.and friends on Christmas eve at a Christ- entertained Mr.and Mrs.Arthur Hinshaw and Yadkinville are visiting Simpson and.little daughter,Catherine,spent: the holidays with Mrs.Simpson’s,-fa- P,Babingron,in Tay- Johnson:spent Miss Mary Alexander,the teacher at at her| spending New) brother,Mr L.FE.) rious accident in being thrown from|his horse and getting his arm broken :to Mrs.RoW,Williamson and family}at the home of her son,Mr.}imoved this week to Columbia,S.C. died)Messrs.Rowe Overcasn and \Johnson of Statesville spent one dayIlook|duringrerlyformarketreportswhich!Sherrill,hunting.een appearing regularly in our,osItgreatly,ADVERTISERS will please bring) Yerskin R, after 12 o’clock to-) a *pers sweet ene er or Social and Personal Items,, Correspondence of The Landmark.4-Eufola,Jan,5 +The old yearwithitspleasuresandsorrowshaspassedandabright,fresh New Year “has}. dawned upon Us:May we all try to keep the record of this new year on a page white and clean.Yo saeMrs.J.S,Morrison,who has been}confined to her bed with asthma,is]— improving slowly. Miss Anna Bell Sherrill delightful-ly entertained about 40 of her friends last)Wednesday night,December 29,|» at het home near Bradyville..The guests were entertained and amusedlatdifferentgames.Miss Lillian |Bradford furnished good music with jher well trained voice and excellent > playing.‘The party was given in honor of Miss Sherrill’s cousin,Mr, Golda Smith,from Indiana., Messrs.Jo.Carter and Jo,Elliotte),resis sume their work as traveling agents. 'Mr.Henry Sherrill,who has been vis- iting his brother,Mr.©.A.Sherrill, near Eufola,has.returned to his jhome.in Indiana.His nephew,Mr. /Golda Smith,has also returned.Miss- es™Berta’Bradford and Katie Little+ left Monday to take up their studies at Lenoir College,Hickory.-Mr.Cole man Raymer returned to Atlanta’ Tuesday,where he will resume his study of dentistry. AAllre- SIMPLICITY. So runs the story,wrought in chiseled stone} A yace well run,without the vain regrets, He played.the game with Character and won, 1 Jinwer-long within the lone retreat, And loiter ‘neath the Cedar's perfect Midsummer zephyrs play with roses s And summer songsters sing with wlade. {read anew the novel epitaph frath our world too oft Ca“He lived the simple life and paid h CLARENCE STEPHENS Relieved in |Fifteen Minutes +=-No need to dose delicate little stomachs |with nauseous drugs or alcoholic syrups. ;Simply rub<a little Vick's “Vap-O-Rub” |Salve over the throat and chest.‘The va-;pors inhaled Joosen the tough,choking |phlegm and ease the difficult breathing, |One application at bedtime insuresasound night's sleep-.25c,50c,or $1.00.VICKS Vous SALVE SALE OF VALUABLE LANDS. By virtue of a decree of the Superior Court {Croup ’right tobacco when you fire-up some Prince Albert in your: old jimmy pipe or ia a makin’s cigarette.And you know it!Can't get int wrong with P.A.for it, is made right;made to spread-smoke-sunshine among men who have ...suffered with scorched tongues and parched throats!The patented process fixes that-——and cuts out bite and parch. All day long you'll sing how glad you are you’re You take this testimony straight from the shoulder,men. Youcan smoke a barrelof P.A.without a kick!It hands out all the tobacco happiness any man ever dreamed about,it’s so smooth and friendly.It’s a mighty.cheer- ful thing to be on.talking-terms with your pipe and your qongue at the same time—but that’s what's coming to you sure as you pin your faith to Prince Albert! R.J.REYNOLDS TOBACCO CO.,Winston-Salem,N.C. |}=pals with Jé’s an easy job to change the shepe andcolorofunsalablebrandstoimitateJAlberttidyredtin,butitiaimpossibletoimi-tate the flavor ofAlberttobacco!patented processprotectsthat!RINGE ALBERT “the national joy smoke eynoldsCopyright1916by te Tobacco Co. the Prince heie | iV Everywhere tobaccoia sold »yyou'd find Prince Albert |.cwaiting your cheerful visit.>.Bay it in toppy red bage,Sez ttidyredtins;10c;handsomepoundendhalf-poand humi-«dors ~-and--in that classypoundcrystal-glasa hamidor ;with sponge «moistener top ’thet keeps the tobacco eo fit!: of Iredell county,rendered in the!y odin ;A.J>Bass ve 6.-8.-Bass.and ot sell at public auction to.the high bidders, at the court house door in Statesville,N.C.,* on SATURDAY,JANUARY 22,1916, at 12 o’elock,m.,the following lands \in Chambersburg township,towit:ist.Beginning at a white oak in the Haith- aABALONEHOARD Dan Valley eox line;thence west 168 poles to a Uogwood,Barringer’s corner;thence west 62 polese,Barring »;thence south 801, poles to stake in Barringer’s line;thence east 220,poles to stake;thenze north 80 poles ito beginning,containing,110 acres more or less,excepting k 1-2 acres’conveyed to trus¢tees Shiloh M.Bo-church,South. 2d.Beginning at white oak,Hoover's line,and’corner:of Lot.No,3,it being Bass cor ner;thenee’8!88 1-2degrees east 160 poles to stake,Lentz line;thence §.39 1-2 poles to stake,corner of Lot No.6;thence north ‘88 1-2 degrees west,118 poles to stake,S.Hoov-}3er's corner;thence with his line north 45,4 degrees west to the beginning,containing 34 acres more or Jess. 8d.Beginning at black oak,near graveyard, Bass’corner,thence south 29 poles to stake, to ste |Freeze's corner;thence south:88 1-2 degrees| east 194 poles to pine,Lentz’s line;thence north 29 poles to stake,Hoover's corner;thence north &8 1-2 degrees west.194 poles to beginning,containing 65-a¢res more or less.» 4th.Beginning at_a }3.Hoover's corner jn Bass line:thence 5 degreeseast46poles,to-white “oak,corner Lot No:and Hidson lot;thence south 88\1@>de- frees east 160 poles to stake;thence north ginia. flour. The Flour of Quality. DAN VALLEY is milled from ‘the celebrated:wheat grown in the Shenandoah Valley of Vir- FP HAS NO EQUAL. Makes better bread and more } of it to the pound than other It is economy to buy DAN VALLEY.TRY IT. Cary €.Boshamer,.| Local Representative,’Phone 125 Black.elt.aw. CHORALERORIRTAOLAIAHE 81 poles to stake,corner lot No.2;thence north 88 1-2 degrees west 194 poles to be-ginning,containing 34 acres more or less,! Sth.Beginning at a stone in Hugh.Ply- ler’s line;thence east 130°poles to-stone;thence south 36 1-2.poles’to stone;thence west 130-polesto—stone;-thenee —north—83—1-2 poles to beginning,containing 37 1-2 acres, more or less.| °6th..Beginning at a stone,W.PB.Morton’s;corner;thence,with his dnd Bass’line north} 5 degrees east 20 poles to stone,J.C.Plyler’s!corner;thence with Plyler’s line north-874de=++grees west 60 poles fo stone in his line and} W.D.Plyler’s corner;thence with line be-| tween J.C.and W.-D.Plyler south 35 poles to stone;thence with W.D,Plyler’s line south &6 degrees east 5b 3-4 poles to stone,his Having their Dee, \cember,3, 28 degrees east 6 poles to stump,Morton’s}4,-|corner;thence with.his line north 84 des; grees east,50 poles to beginning,containing| 10 acres more or less. R.TY Dee, qualified a 19t6,~or~this notice recovery)estute will please 21,1915. NOTICE—LO-CREDITORS. Having qualified ‘ax admi jtute of W.A.Millsaps,dec}tify all persons having’cla {tate to present them to me on or before De- EXECUTOR'S NOTICE. Phylis all per- executor of to notify All.pemike settlement,J.C.FOWLER,Executor, istrator of the es- sed,this is to no-3s ugeinst said es- 1916,or this notice will be pleadedcorner;thence with W.P.Morton’s line north|in bir of ‘their recovery. said estate will.«make immediate settlement.1 Weatherman, All persons indebted A.MILLSAYPS, att’'y.Administrator, 3,1915, :se Terms—One-third cash,one-third in six|,—————+--++ roe Willtace Pe iehason of Stony seae aa ioc wens Be MeLA :|FOR RENT—Seven-room house Race street,var,i ew §S j .B eLAUGHLIN,|one piock’from the college.Modern con-Point is visiting his brother,Mr.’A.Dee.21,1915.3 Commissioner.|venieneeds.MRS.D.A.MILLER.—Oct.29 iM.Johnson,Mr:and Mrs.W.TT.;5 Sherrill spent New Year-s wth their)(~~nt sicsaronet ™ daughter,Mrs R.H.Neely,in Mat-}:thews.,;Miss Mattie Wagoner-is.vis-=9 iting her sister.Mrs.Everett.Denny,|u :e I apinConcord:Miss Grace Johnson has|bi :&.~ every one happy,>| 1 at our store. —W.F.WALL,"PHONE 20,°t Candies for Holidays make They are delicious and wholesome. Discriminate when you buyyourCandy---select Huyler’s Drugeist, Statesville,N.C. Restored To Health By Vinol my blood was poor and my face coverecwithpimples. After taking manoutbenefitVinol has retored my healtt and strength.’’—Roy F.Biro, iron tonic without oil,Try it on ou iW.FP,Hall Droggist.Statesville,N,€ ~BLERK ALL RUN DOWN ‘Shelbyville,Ind.—‘I am_a clerk ina hotel and was all run down,no energy,| I got so weak I had to}put up an awful fight to keep at work,other remedies with- Kor all ran-down,weak,neryous |conditions of men_and women,nothingequalsVinol,our delicious cod liver and q ae ||} }| Practice Economy This Year! Old Beck Sweet Feed, Little Ned Sweet Feed. Manna-Rice Chick Feed. fiem Scratch Feed. 1) r ,ti fiem SweetDairy Feed.° -¢,W.BOSHAMae:Ph integrity. HL. Pt ‘Feed Kdgar-Morgan Co’.s Mixed Feeds. .Not.sereenings or:offal,orworthlessby-products,but.se-lected feed seien- tifically blendedforresults,MadebyahouseWith a reputation:for é ER,-Local Representative,- one 125 Blacks,© _In Many Instances. The Season’s Most Jm- Prices Lass Than Half |portant Sale :Suits | Johnston-Belk Co. ‘learance Sale The Opportunity is Yours : 1 One of 12 Pe Of all Women’s and Children’s Coats andCoat Suits...oe Price reductions are greater than ever before. Reduction without thought of value.“ Many reductions are far less than - half.) Big Stores That Sel for Less "PHONE 212.| New Year'sGreeting|| J.M.McKee &Gompany.| ey t ee r We want to express our gratitude i E ) for the,very liberal patronage our :e a .eA é :"i esfriendshavefavoreduswithduringcus f }the year 1915,and hope by fair and ‘liberal treatment to share even a larg- ‘er portion for the New Year of 1916, “Very Truly Your Servants, sSea ree ee ee because it eliminates waste,_4 The impact of each explosion within the cylinders is ap- =plied directly against thepiston heads,consequently the .ve ;entire force of the explosionis utilized,Thereis no waste” i _,of power and better yet,no waste of fuel. ‘a =“As a reminder:way not make this,an Automobile | =) d adeA)waN eXLOMELMAKESYOUSICK!ILE ed,Heenan:’t Lose a Day’s Work. But take rio nasty,dangerous|you ‘sick. because it)makes you sickmaylosea.day's work.medicine.|mercury.or quicksilver|ing because That’s when!ach willthat:awful nausea and lag arnDodson’s Liver,Tone is take a spoonful of harmlessdson’s Liver ‘Tone tonight.Your!gerous calomel now. ae ‘of ‘Dodson's iver Tong under lis almost soe oe‘here, my personal money-back guarantee Commissioner _of Immigrationthateachspoonfulwillcleanyour4{sluggish liver better than a dose ofNisioes‘bnd-tal ofvent nasty calomel and-thatit:won't make Dodson’s Liver Tone is red liverYou'll know it next morn-|!ween the &Jnited States and Japan |ou will wake up fecling |’regard to immigration hasUsGsnecrosisofthebones.|fine,your liver will be working;clashes into soyr bile like dy-|headache and dizziness gone;stom-4 biNeking ib up.@ sweet and bowels regu- Dodson’s Liver Tone instead of dan-| Your druggist|iggist or dealer.sells you a 50-cent|i will tell you that the sale of ‘calorsel || SeANLIVERANDBOWELSMYWAYTHELANDMARK Se eT aeTry“‘Dodson’s Liver Tone’’When Bilious,FRIDAY, THE JAPANESE SLIP IN. Says They Evade the Law. Suggestions as to Hawaii.| Washington Dispatch. The “gentlemen's a ibe- some| loopholes which permit too many | Japanese to enter this country,it:is)asserted by Cammissioner,.General of | ‘mmigration Caminetti in his Wa,entirely {renort to Secretary of Labor.W.B e.Wilmntome!If yoy want to en-vegetal e,therefore harmless and!Wilson.He complains particulary of|nicest,gentlest liver and bow-|¢annot salivate.Give it to your chil.|the exception in favor of thownem-| eansing you ever experienced,|drem Millions of people.are using|°?S of families,and says:“Of the 9,029 Japanese admitted| luring the year,5.542 were males and|3,487 female The latter~consisted| laugely photographed brides,or[OFOXY siden so-called——young .women| ‘GOOD SATISE ACTION pat 8 what I always try to igive.If not.satisfied.call again.Timeis money.Why-not buy yourself some for,1916.[have time from $1 00 up. ‘H.B.WOODWARD _ Jeweler. roming to this country to join hus-| ‘ands with whom a-so-called marriage| hy ad been contracted in’Japan by ar-“agement.hetween..their,respective| families,often without the parties ev;|r,haying seen each hen ceak in aree majority of cases these cremen hemselves are laborers wano enter’the|‘elds and factories and work along- side their husbands.They are labor-| ors in exactly the same sense and to! —_See ee ee eer ee oe Teeter ee noales with whom they work,’ The Orientals are using ong Ameri- The Buick Vavein lead | Motor Delivers Excess Power .This type motor delivers more power by 10 to 15 per cent, than the L-or T-head types of equal displacement,and affords greater economy of fuel than either of these types |.Christmas.” Statesville Motor Com’y e “QUALITY.FIRST.”| ‘PHO.NE 140. 4 1; }t 1 |oractically the same extent as the| “an colonies,,too.Mr,Caminetti says,| §stepping stones for their entrance||:9 the -continental United States.| i They pain free entrance as laborers|\to Hawaii.Porto Rico and thePhilip-| |Sines,and then,by one excuse or an-| other,finally get to the United States| jand settle here.In the last year 2,-||‘37 thus gined entry in San Francis-| ;70 New York and Settle. |The plan to Americanize “Hawaii,| ae commissio ner sr ‘YS,a3 nou mak- ing substantial progress,although:“in; ‘erhaps none of the insular posses | ions is it so important that the pop-} ulation shall be overwhelmingly); American as in this particular group | of islands.”\ He suggests that Hawaii be put on} he same basis as the United States |5|Mainland with respect to immigra-| |ion.Jt is doubtful,he says,ifitis||-dvisable to permit any rarge number | lof Filipinos to enter Hawaii.He urges hat this government dse every effort o stimulate Americans to colonize ‘»Hawaii by giving ublic lands} here to them. He urges,also,that largest postoffices n Statés be utilized as employment | at]but.the) “geneies,where ‘the /postmaster can} Issued by this bank bear interest from date at the rate of 4 per cent per’an- num.Savings Deposits 4 per cent, credited quarterly.||.| IChéckiue Accounts either large or small cordially invite d. We want your business. So S SS O S S 9S 99 9 9 8 0 0 8 0 0 8 0 0 88 8 O 80 0 0 8 8 8 0 8 0 0 0 0 8S 00 8 0 0 8 0 0 0 OO S SO T People’s Loan and Savings Bank. OFFICERS: GEO.H.BROWN --.0.L.TURNER.5 President. Cashier: ee \i+:ryra7,+7+.C747:>3iryry.cfes+7*3.ofriry.7*.tf3773 C7BS$.43rg7}+:pSrryry+rH 77?7¢rti2+7cyPyrf+>Cyé7 rf 3 + 7 $7+ry7o7rfrycy:rf‘ 4+EOATTCKOA HO ACFEFORCEICRCRRCROROICTOLACRETORONORAORCH Seeds may be secured from the iead- [°rive an hour each day +o oring to-|¢ emmended on the Canadian and Mex- ican borders’to keep out the Chinese!‘ and other aliens. nse autes in.bringing.in the Orien-| tals,ho declares. CTELCL ES Varmers May Grow Indigo. |Carresnondence of The Landroark Jt may be of some interest to the! reople of the State to know that be-| fore the Revolutionary War the pro- duction of indigo was a leading in- dustry in North Carolina and South| Carolina.In 1777 ‘over’a million) paved were produced in the Caroli-| nas for the purpose of making the}dyestuffs that we now get,or fail to!.set,from Europe. Economie conditions caused the pro- duction of this crop gradually tocease;-but the Commissioner of Agri;| culture of North Carolina feels that| the recently changed conditions fur- nish a very strong argument in favor of ‘reviving this abandoned industry among the farmers,and thus not only| ivender our textile manufacturing in-!J jdustry indenendent vf Europe ~but lace into the hand.of our farmers| whatover nrofits might accrue fromitheproductionofthe~plants,..fromtfwhichthedyestufgaremade.as wall a3 the cotton from which the cloth, is’made—the salt-as well as the pork. The cemmigsioner,therefore,advis-| es the growth of indigo,in a small way at least.among the farmers of the State during the ¢oming,season. ine seedsmen and instructions for SSSSSIEETTSTSTTseiess tases esssesssserseesesess sse sess sss Tose ssatesase assesses testes sates growing the crop may be secured by Pe‘Commercial National Bank t ¥OF:STATESVILLE,N.C. Capital Stock Paid in -$100,000.00 Surplus and Profits.31,500.00 Members of Federal Reserve System.Po P S S 0 0 S 0S PO S S 90 S SO O S Your Banking business solicited and every accommodation extended to de- positors consistent with prudent bank- ee ing methods.; :Four per cent.paid on time and8Savinos 8 ‘Deposits remaining on deposit three months or longer. .OFFICERS: i W.D.TURNER,--_—,MORRISON,- --D.M.AUSLEY,@.BE,HUGHEY,- epeeeeee 22 9 9 9 9 9 9 9 9 9 2 9 98 9 00 9 8 9 0 9 9 0 9 0 4 *President, -Vice ‘President,Cashier..Assistant Cashier. PELIITAAITAS2 23eesereeesses Wetare in the market for several million feet of Old Field Be kenbes bealoo at once or to be contracted for nextLaoagonacashNeN»Geo,|Myets, application to the Commissioner of ‘Agriculture.JAS.L..BURGESS. State Agronomist. { This State’s Representation —in ‘National Republican Convention. The call for the Republican nation; al convention to’be.held in Chicago Jvne 7th,issued from the Republican national headauarters.in Washington iby Chairman Hilles,is the first under ithe new assignment of representation| and shows that North Carolina will have but’21 delegates in the conven- tion inst@ad of 24 as heretofore. |This is the restlt of the long-stand- ling agitation among the Northern Re-jpublicans for smaller representation from the South,which territory they have claimed has a very small Repub- lican vote but has as sarge a repre- sentation in the Republican conven-' tion as the Northern States,-where Bithe Republican vote is greatly in the majority.i In the next convention North Caro-| lina will have four-delegates at large.| Jone each from the first;second and}sixth congressional districts and two | from ‘each of the others.The first,| second and sixth districts will have but one,delegate each,because they|polled less than 7,500 Republican | votes ‘in the presidential election.of|1908,which was decided on as the ba-| sis,} $100 ‘REWARD,"$100,‘ The readers of this paper will be | pleased to learn that there ta at leant| one dreaded disease that science has |been ‘able to cure in‘all ite steges,:and that|is Catarrh,Hall's Catarrh Cure fa the only.positive cure now known to the| requires.a Gonsti-|{tutional disease,biti a Catarrh Cure|tutional.treatment,HailintakenInternally,acting directly upon | the blood.and muccus:surfaces of the ton of the disease,and givimy the pa-) tient strength by ouistituttonandassisting nature in dolr Itatwork,The proprietors have so muc faith in its curative powers that they offer One Hundred Dollars,for any case tne it fee to cure,Send for lst of timoniaAddress i,J,CHENRY &CO,.Tole- w x {i‘ever the country generally is reflect.|‘ed in monthly reports from the 12, iwaste,the sour leasy after giving it, jreections for medical fraternity.Catarrh being a con ip system,thereby destroying the coer uilding up the con-| ROM OVERhaa COUNTRY. Matters. Continued business fniprovethect| Pederal reserve districts. January 1,1916.Raine of Interest ,About tion Allen Nixon,43 years-old,a niem-!ber of the Arkansas Legislature,wats|shot from ambush und killed instant-ly,at his home in Franklin county,Ark. A joint®statement anuied by .the eeeat of the Mint and GeologicalSurveyshowsthatNorthCarolina produced last year 7,416 fine ounces’ of gold valued)at $152,300,and 1,400fineouncesofsilver. William Durst,said to be the sole |survivor of the crew of the Monitor which engaged the gays pe pal Tron- icled Merrimac in the historic battle ‘in Hiampton Roads.died at his home in |Philadelphia Tuesday,aged 70, Mr.John Crawford,a prominent and popular citizen of Lancaster,.S. tt.city treasurer,and manager of the insurance department of the First Notional Bank of Lancaster,.commit-}pie suicide Tuesday by shooting him- self thréugh the heart. The judiciary United States Senate has voted a fa-vorable -report on Senator Hoke! |Smith’s bill for the appointment,in the President’s diseretion,of addition:| al Wederal judges for the lower courts to relieve judges i retire.ifTherearemanyueoftheill-qf ness of the German Emperor.Ger-| man reports say the illness is not of| consequence,"other serious.A Paris newspaper asserts| that the Kaiser is suffering from can-) eer of the throat and is unable to}i speak,~ It is stated that union cotton mill| committee of the’ } whe had.failed.to. reports say it is| | operatives throughout,New England| will not accept the five per cent.wage| increase which many manufacturers, announced would become Monday. erease, Out of 5,011,441 men of wmilitary' age in England,Scotland and Wales,/ 2,899,268 were enlisted or scheme,leaying 2,182,178 men services.Of the men who did eome}iforward,428.853 were rejected by the recruiting officers. Fire at Birmingham,Ala.,Tuesday |} jnight destroyed the plant of the Tex- ham,causing a loss estimated at) |$250,000.Fourteen tanks of oil and gasoline,containing 20,000 gallons' oil poured The smugglers now |1 half down the stream. CROSS CHILD IS BILIOUS,— FEVERISH! Look at Tongue!If Coated, Clean Little Stomach,Liver, Bowels. Don’t scold your fretfal,ceavln child.See if tongue is coated;this) effective! The union operatives will,| it is said,demand a 10 per cent.it rejected |}under the Earl of Werby’s recruiting fwho’!ff did not come forward and offer their |} | | | the United |as Oil Company at North Birming-| other wage earners and employers.jeach;were consumed and as the tanks |} |An automobile patrol service is-rec-|birstin succession ‘and the burning |into Village creek,thelff James extended for nearly amile and}¥ |DON’T SCOLD,MOTHER!THE} || | is a sure sign its little stomath,liv-| er and bowels are clogged with sour: waste. When listless, cold,breath bad, pale,feverish,full of| throat sore,doesn’t) ieat,sleep or act naturally,has stom-! ach-ache,indigestion,diarrhoea,give) Figs,”and in a few hours all the foul 'a teaspoonful of “California Syrup of) bile and fermenting| food passes out of the bowels.and| rou have a well and playful~child again,Children love this ‘fruit laxntive,”and mothers can rest failssto make their little |‘insides” clean and sweet. Keep it handy,Mother!A_little row,but get the genuine.Ask your harmless | because it never: igiven today saves a sick child tomor-! druggist for a 50-cent bottle of “Cal-'ifornia Syrup of Figs,”which has di-.; ages ,and for grown-ups plainly on the bottle. terfeits sold here,so surely look and see that yours is made by the “Cali- fornia Fig Syrup Company.’Hand baek with contempt syrup. > New Year Flowers! We have provided wellwithFlowersforallNew Year functions,and for New Year Gifts for the young ladies who are al- Ways appreciative of your thoughtfulnessin sending flowers. Van ‘Lindley (o., GREENSBORO,B,©, babies,children of ©all! -Remember there are coyn-' any other~fig ge e n @2080nonoONONOBOOOOON -Rheumatism ae Howsis rheumatism recognized ®Some have said i Rheumatism is a dull pain, Rheumatism is a sharp pain,~~ Rhexmatigm is sore muscles, Rheumatism isstiff joints.~" Rheumatism is a shifting pain. All have declared—Rheamatism is Pain. Sloan’s Liniment applied :— The blood begins to flow freely—the body’s warmth is renewed+-the congestion disap- pears—the pain isgone, Sloan’s Liniment KILLS PAIN"(GUARANTEED)”~~ Rheumatism’and allied pains yield to the penetrat- ing qualities of this warming liniment. fs soo eo n s ™ New Year’s(ireetings MAY 1916 BE A Yearof i i A Ce e es SS Se o THE NINE Se CAR. aCarloads of Fords. Just received two carloads of- Ford Touring Cars.”Start the New Year right by buy a i a - Carolina Motor Com’;y, Statesville,Mooresville and Newton. ‘ THANKS! For the splendid trade given us this year,We ask ; that you continue it in the next. R.H.RICKERT &SON, JEWELERS. iu We don’t claim to know uel cheer the’¥ weather,but we do know howto Bicadivongenatrls And how about,giving your car a complete Ov Hing’ We guarantee our work to be as good as’thebest:ataeMOT‘“QUALITYFIRST.”3 i? re That.Would Have «me Boys.and —Girls ng An Opportunity.y ve Farmer. how I can’t feel it’s quite gaid an old,white-haired un- ele of the writer’s once,an old uncle had a farm adjoining ours, ‘ow Y can’t feel that it’s quite/' t that I didn’t have when I was i i all this information about bet- ter methods of farming,all this Scientific knowledge that makes farm ‘work so much more profitable and so |' much more interesting.It doesn’t seem right that I have had to live i life out blundering along in the ark,working by muin strength and awkwardness,when my whole —life would have been more _interesting |: ‘and more fruitful if I could only have || learned while young.the lessons I}} have now learned in my old age.” We <shall never forget the words of this worthy,hard-working old farmer as he talked,seslizing as he did ‘that the helpful light and knowl- ‘edge of modern methods had reached him only after his strength was spent} ed sé for another chance —another life in which he could have taken ad- ‘vantage of all the new spirit in agri- -eulture and new knowledge about ag- ricultut. Of course the farm voy of today has va far better chance to learn all these oo than our old:uncle had in his youth.,And yet with all the progress that has been made,not one boy in ten is studying agriculture in the schools;not one boy in ten is in corn club or pig club work;not one boy in _ten ever attends a farmers’institute. And the same condition exists with regard to girls and the new knowledge about home-making.Not one girl in ten is studying’home economics or '‘domestic science;not one girl in ten is in canning club work;not one in ten attends a women’s institute. Nine boys in ten,nine girls in ten are not being reached!The ’prob- ‘Yem before the forces of progress in -the South today,therefore,is to “yeach the unenlisted 90 per cent.of our-boys and girls and save them from the tracedy of The KnowledgethatComesTooLate. 7‘TREATMENT FOR BURNS. Simple Remedies For First,Aid ;—Prevention Best. Bulletin State Board of Health. ~“fhe best advice about burns is to prevent them.They are the mosi painful of common injuries,slow to heal and often result in life-long dis- “ability or severe disfigurement.For- tunately,they are a.the time of the accident free from infection,and if “kept clean will not result in blood poisoning. .The best thing :to’do.in:case of.a eyes burn of the skin is to treat it ‘with a coat of vaseline,lard or other greasy substance,to exclude the air.A paste of soda and water,or flour and water,will-exclude the air and may.be used with good results. The same treatment ma.-be used in case there is ablister,but if the burn is deep and the flesh is destroyed. a physician should give the treatment. The after-treatment vf burns consists mainly in keeping the injury clean and free from infection. *Some of the most serious burns have resulted from accidents that could have been avoided..Moihers ~too frequently leave their little ones -§n a room where there is an_open fire or a stove with a fire in it.A fender or a wire sereen:before an open fire removes this danger.Per- haps the most serious burns are those resulting from the use of oil in start- ing a(fire,especially a smoldering fire.A little forethought seems all that is necessary to avoid what is of- ‘ten a fatal result.Children frequent- iy,burn their hands and ignite their ‘clothing by playing with’matcheg. ‘Matches are dangerous playthings for the poison that they usually con- NEED FOR TAX Crusade to Equalize Burdens) Progressive Farmer. ation reform in North Catolina,and there -isngeneral interest in the an- Mecklenburg county is likely to make this the basis of his candidacy forea place on the State Corporation Com- mission,which is also the State Tax: Commission. yessed at from 10 to 30 per cent of their real value,while the poor are frequently taxed on 100 per cent of $300 extra they haven’t got at all (poll tax). recently told in the Progressive Farm- ery how Union county last spring as- sessed the farmer’s ‘cotton at 9 cents the weak thus.going on the books at full value—whereas right in the ad- ioining.county.of Mecklenburg,Mr. Watt reports such abuses as the fol- lowing in dealing with’the property of the are:The Seaboard Air\Line Peer railway had four acres of Charlotte and the end of life in sight.He long-|jand originally assessed_for.taxation at $1,500. 500 was toe much and got the assess- ment reduced to $1,250. eame the Norfolk ,Southern railway and took one-fourth acre out,of the four-acre total,and straightway the Seaboard claimed quarter-acre—and the courts °allowed | it $12,500! ing anybody’s candidacy,but we dg be- lieve somebody should start a crusade to equalize assessments in North Car- olina.\f REFORM.. |North Carolina has six woolen’ ‘four silk mills,according to the:Should Be Started in the State},Aoi fopeas ‘oy Commission Bl man of the State Department0: bor.and Printing.‘The woolenhaveatotalcapitalof$1,037,648 operate 13,382 spindles,268 looms and 25 cards.They are run with: 850,000 horse-power and,@nsume 1,-202,404 pounds of raw material.Theestimatedvalueoftheannualoutput is $750,764;507 persons are employed, 804 males and 203 females;only 10 persons under 16 years of age are employed,,and mills pay out $198,462 in wages and $21,230 in salaries for the year.(") The four silk mills have a capital of $2,059,726 and are»equipped with 64.560 spindles,452 looms,requiring 1,005 horsepower,.consume 100,000 pounds of raw material,have an es- timated value of finished product for) the year of $585,887,employ 136 op- erators,280 are male and 506 fe- males,employ 100.persons under 16 years of age and pay out $270,000 an- nually in wages.: Serious indeed is the\need for tax+ jouncement that Mr.W.W,Watt of Certainly somebody 1eeds to make it plain how the hold- ngs of the wealthy are frequently as+ ill the little ‘they have,and then on Thus Mr.R.F.Beasley 1,pound,his corn and wheat at $la yushel,his cows bt $50.and his norses at $200—the little property of pec none ai eee Superintendent of Schools... At the solicitation of my friends first,and secondly because of my love of the work,I have determined to be *candidate,in the Democratic prima- ries,and subject to the rules thereof, for the position of County Superin- téndent of Public Instruction.ad*.REV.W.A.LUTZ. IN FIVE MINUTES!.NO INDI-GESTION,GAS OR SOUR,ACID STOMACH! They protested that \$1,- Right)along $20,000 for the The Moment “Pape’s Diapepsin” ‘Reaches the Stomach All Dis< tress Goes. “Réally does”put bad stomach in order+—‘really does”overcome indiges- tion,\dyspepsia,gas,‘heartburn and fe.thiefGn ns ae .hy!sourness -in five minutes—that—just in.theeform of incomes and inherit-|that.makes Pape’s Diapepsin the ances:escapes taxation to a degree no-largest selling:stomach regulator in ins ee ean nets ‘The latest|the world.If what you eat ferments oublished State reasurer’s report!into stubborn lumps,you belch gas We are not concerned with boost- Nor need such a crusader |stop here.The property of the wealthy sene oil,the poor man’s light,as “ts shee rs times oe en resigts iS\and eructate sour,undigested food and colletted:from a special tax on,Kero:peeks head is dizzy and aches;breath} foul;tongue coated;your insides”fli? |, { || | Wednesday,January 12,191 We Will Sell 381 Acres,Lying 21 Miles Novel of Statesville,North Carolina,on aR, new Sand-clay Road,and known as the ROME REID Farm.This peer ee prer crt most entirely level.Has $4,000 worth of improvements,40 acrés dry bottom,| 300,000 feet of good Saw Timber,’be Tract No,—:130 acres in home place,one large 2-story,8-room dwelling,2 , large barns,every out-building a farmer would want..j ‘SEVENTY ACRES IN CULTIVATION! Tract No,2—32 acres,+10 acres good bottom,one small 5-room house,lying right on road,mor ; Tract No. Tract No. Tract No, Tract No. Tract No. Tract No. Tract No, 3 contains $2 acres,7 acres nice bottom,4-room dwelling. 4—28 acres,‘no improvement,10 acres nice bottom,fine upland. 5—25 acres,is a dandy,worth $50 per acre,probably be sold for $25, 6—25 acres,is as good as No.5,both worth $50 per acre. 7—50 acres,one fair dwelling and barn,fine<erchard,lies,well. .Mak 828 acres in nice tract,one fair dwelling,lies fine, 9—Is mostly in Timber. All are good red lJands....An opportunity in a lifetime to get you a home,Re- member,you need no money to buy any of thesdé Farms,Simply give satis- factory security.Terms 4 years in equal annual payments at 6 per cent.in- terest,¢‘ SALE will take place at 11 o'clock Wednesday,January 12,1916,rain gr ching: Our famous Auctioneer,John P.Jones,from Washington,D,C.,will conduct- the sale.We will have 2 Brass Band.©Let everybody come! So'R.V.BRAWLEY,Statesville,N.G.| it Theale Solves for you the ques- tion of entertainmenttheselongwintereve- nings..Entertain your friends by taking them- to this theatre...Wewill make .special rates for parties fand will gladly tain besides:their danger of igniting, ‘and should tbe kept out of children’s reach. ‘Remember Our Own Case,When Criticising England. fanufacturer’s Record. ing 0remembering that forgotten that it wou “possible to continue the Civil put for conscription.With all patriotism in this country and North against the South,the on,and the announcement of ee ttion riots and the threatened iption by the Union, ey would have been victorious, ms .has never equaled in the rel m hty volunteer army that it iged From the War Zone.. of Czernowitz, ‘thward,at various points in Gali a and Russia,continues the ary of any on.the variou are still o “reports frerch-of which claims:successe ‘ites r tive army.‘important events haveonthewesternline.in FalAfricaaBritishnavaLake,Tar ika about the surrender ofarmedsteamerKingani,ore of were killed. aon?c ‘.The people who are disposed to crit- jcise Buropean nations in their financ-) ‘the war might be interested in toward the close of | the Civil War United States 6 per cent ponds were selling on the basis of|P!2 er about 40 cents on the dollar in gold.|his cartridge ‘case.The girl in scorn | Those who are crvticising England about conscription seem also to have)did x ld have been im-/2 real singing chorus and a special or-| War |chestra insure fine interpretation ot |the this fascinating opera.—advt.|el Se| rampant sentiment.throughout the|CR ae | N Union |;| ad very speedily to adopt copecriP-|‘ this | tion of the nation.Without con-) the Confed-,; a patriotism,as great as it) @ number of volunteer soldiers the! otism displayed in England in the has fighting between.the Russitins Austro -Hungarians in the re-' Bukowina and| most fronts,The results of these bat- bseured by contradicto- m Vienna and Petro- taken cannot endorse Gowans Preparation’ rance,|too highly.Have used it for croup on 1 ex-|my little boy and have ‘always found has it effective and immediately so.”«Ask the}your druggist’for,a bottle. all;Gowans,because Gowans.is more pene- please bring the Gowan Medical Co.,Concord,N. lo change of7 a 12 o'clock to- reserve any number of seats. WE OFFER TODAY Hazel Dawn and JohnMasonin “The Fatal Card” A Paramount Picture in five parts. collected in all the inheritance taxes!4 with bilecand indigestible waste, for incomes,the failure to make “the|epsin”comes in contact with the strong bear their share of the bur-|tomach all such distress vanishes. Any man with an income of over |,as Fhe :me $1;250 from salaries,fees,ete.,is ren (roo and.the:joy:is its.harmless ties of North Garolina in,1914 not one)pyiapepsin will give you a hundred dol- sent of income tax was collected and |pays?Worth of satisfaction or your wee pag ie &oo oan 33 cou It’s worth.its weight-in gold to men ties in which no man-listed an IMéome |444 women who:can’t get their stom- ander,Avery,Bertie,Bladen,Burke,: ?Ae s capelY oe home—should always be kept handy in Camden,Carteret,—Caswell,_Clay,case of a sick,sour,tpset-stomach-dur- Dare,Franklin,Gates,Graham,|oof curest ¢Pre ON eet cy Greene,Hoke,Hyde,Jackson.Macon,SN stomach Polk,Sampson,*Stokes,Surry,Tyr-a ae rell,Watauga,Yadkin,Yancey.DOORS,WINDOWS, for some one to air the facts about hf taxation,and it will be a still better)MOULDING. who doesn’t pledge himself to three reforms:(1)heavier inheritance tax- enforcement of the income tax law, and:(3)for some method of seeing nearly a 100 per cent basis as the weak are. “THE CHOCOLATE SOLDIER.” Local theater-goers who appreciate wholesome comedy,will welcome the announcement that the ever popular as presented—by the celebrated Whit- ney Opera Company,will appear at) ary 7th.The music by Oscar Straus requires no commelication;for-its-se- there is a piano,orchestra or—phono- graph..All will recaii tae dominant ro.”The story was written as a sat- ire on the foolishness of War and of ling or discipline,go in.and do_its! lfighting.A subject very much in the jof the opera is laid in Bulgaria,dur- ling a period of war between that na-| lof peculiar fhterest_at the present itime.The title is taken from:the} uge in the room of a Bulgarian girl.| leonfesses that he hates fighting and| from Currituck to Cherokee!And as|ygmember the moment “Pape’s Dia- dens is nothing less than disgraceful.|ty,ttuly astonishing—almost:mar- quired by law to list it,yet in 33 coun-A large fifty-cent casé of Pape’s in 22 other counties less than $100 |druggist hands you your money back. of over $1,250 were as follows:‘Alex-|achg regulated.It.belongs in your Cleveland,Cumberland,Currituck,ing the day or night.It’s the quick Madison,Mitchell,Onslow Pender.|—°Sa sla It will certainly be a good thing ugif termers will eects Beare |Ce WATICIN . es with rigid’enforcemens;(2)the that the strong are assessed at as ESD brilliant and tuneful music and clean, comic opera,“The Chocolate Soldier,”, the opera house,’Friday night,Janu- lections have been ..played wherever |melodic theme of the opera,“My He- the men,who,unprepared’by train-| i public.mind these:days.*The locale ition and Serbja.Another coincidence | {fact that a Serbian officer seeking ref-| ‘prefers carrying chocolate creams in| inicknames him a “Chocolate soldier.” lA splendid cast of operatic comedians, :TREATED BY GOWANS 3 Stanners —~E—a> Severe cases of croup have been ||known to yield to an external treat.| ment known as Gowans,in 16 minutes, and it is said that one application on the chest and throat at night beforegoingtobedrarelyfailstobreakup! the worse attack.It seems unfair to |the little ones to let them suffer when such easy,quick relief is within reach of all.Then again,when croup and colds are neglected,serious results follow.Gowans is absolutely safe to use,even on,the most delicate chil- dren,as it is applied externally to the chest and other affected parts,and «|When covered over with a warm flan- ‘nel cloth,it goes straight to the spot /and breaks up the inflamation and congestion,Here is one of many thousands of testimonials:Prof.R. A.Peters,Atchison,Kans.,writes:“I Monday NAT GOODWIN ae ees ENS “The Master Hand” America’s best known actor in'‘a drama which provides him an unusual number of opportunities for the display of his genius.Be sure to see this picture. |a “Demand |trating.”25c,50c and $1.00 bottles, |Sample and testimonials on request of Lyric Theatre, C iY, = |pera House Tonight : THE FAMOUS —- ! Whitney (pera (‘o.i In the World Famous Comic Opera SUPERB CAST. (reat Singing Class, OWN SPECIAL. ORCHESTA.— \Ar The Opera thatset the,world laugh- i ing,singing and dancing He 20 Musical Numbers.|a PRICES:::: { :$1.00 and $1.50 |.| Reserved Seats on Sale at Statesville Drug Store.a :;|eos ¥ Photoplays of Merit.” ces _Music By Oscar Straus 4 STATESVILLE,N.C.,TUESDAY,Tes UARY 11,1916. NSULA EVACUATED.| and French Move Out—ish War Ship.Lost—ltal-Vessel Sunk and 200 Per- si—News of the War Zone. f complete .evacuation of the Ne Hipoli peninsula by the British andbeyaforces,the witndrawal of the Brench troops from the summit of Hirzstein,south of Hartmans-‘Weil- erkopf inthe:Vosges mountains;and the sinking of the British battleship King Edward VII after it had come in contact with a mine,are the out- standing features in the”war news,‘BS reported in the Associated Press summary:~ _.A British soldier’wounded was the‘only casualty suffered in leaving the»Gallipoli peninsula and |thé’British}m3 a Frevich were able to remove all~the) guns,except 17 old ones whichWwdestroyed.5 #re was no loss of life in the sink-Jing f the King Edward VILand-only .two/men aboard the pre-dreadnaughtwerewounded.,In the”capture —of| zstein,Berlin says 20 French offi- 8,1,083 chasseurs and 15 guns were en,Paris,in admitting the evacu- itign;says it was due to the capture!¥the Germans of a hill to the north~-fofHirzstein.caeOn the-remainder of.the Wester ntslittleactivityhasbeenshownTevitherside,except,in the usual bardments andmining “operations,omparative calm prevailsin the Aus-’tro-Italian theater. Considerable fighting is.still goineVeonatCzartorysk,on the Russiana\front,where the Teutons havé twicebeen.repulsed with considerable loss|'in-attempting to recapture that ‘tWn1fromtheRussians.Petrograd reportsWY:that the Austro-Hungarians have beenydrivenfromtheeasternbankoftheMiddleStrinpariverineastGalicia. .An attack by the Teutonic alliesaagainstthe.Entente allies in Greece a has not yet materialized.but the ae=roplanes of the Central Powers again have bombarded the ‘environs of Sa-loniki.:irs The Russians claim further success-:es against the Turks in the Caucasus region.Turkey,as a reprisal for thearrestofconsuls‘of the Central Pow-*ers.and their allies at Saloniki,©has taken into custody 10.French Sud"wee 4 British officials who had remained intheirrespectiveembassiesinConstan-»tinople,according to a Berlin wirelessreport.ow ArAmsterdam dispatch silys the,Turks also have interned 1,000.sub-jects of the Entente powers in retal-jation for the.treatment of TurkishsubjectsatSaloniki.Two:hundred’Montenegrins fromAmeri¢a lost their lives’by the sink- ing of an Italian steamship whichstruckamineintheAdriaticsea. The steamer .was carrying a quantity of supplies and 424 recruits for theMontenegrinarmy.As the Montene- grins were not American citizens we are not interested.‘Reports come from Berlin and Con-stantinople that the British have suf- fered severe losses in Mesopotamia, where the main British force is on the ¥etreat,and that a transport was‘5 sunk in the evacuaton of,the Gallipo- li peninsula,which caused:great:loss. With the withdrawal of the British and French forces fom the southerntipoftheGallipolipeninsula,aftertheevacuationofxneAnzacCove tnd Suvla Bay positions on the west- there has come to an end .a move- ment that was begin with expecta-t tions of achievements which would_have a great bearing on the outcomeofthewar.Thousands upon’thous-ands of men lost their lives in the en- ferprise of effecting yandings on theTurkishcoastandinthefightingthat ‘has been in progress since.In _addi-tion a number of.battleships.smaller War craft of the Entente allies,-haveheensunkordamagedastheyHour- ed a rain of shell against the Turk- ish.fortifications-in.an“endeavor.toaidtheirownforcesonshore. 'The chief military yurnvose of theDardanellescampaign,which was be- @un-in February,1915,with the bom-bardment of Turkish forts.at the en- trance to the straits by Entente al-}‘lied ‘warships,was the capture of Con- NO CLUETO THE F IREBUG. Officers Fail toLocate Responsi- bility For Attempt to Burn St.Charles Hotel Building. The efforts of the local officers and Deputy Insurarice Commissioner,Scotttogetacluetotheidentityofthe person or persons ‘who attem)ted toburntheNewYorkHotelbuilding early Thursday morning,have so far proved futile.Mr.Scott made athoroughinvestigation,but left Fri- day evening without having develop- ed anything.He stated that the case was’one of the most baffling in his experience.The’incendiary had planned his work well,fire having been started at two.different.points, but.fortunately.the plans..were frus- trated before their purpose was real- ized.The fact that the fire started render’the-kitchen ofthe ‘hotel made the most rapid progress is probably all that saved the building.The,ball of twine placed under the kitchen was evidently fired first,as the fire in that spot had gained such headway that the smoke reached the second floor ofthehotelandarousedoneoftheho=tel employes.The fire started under the portion of the building occupied by.the Statesville Printing Company had made.no progress when the fire- men arrived.In fact the flames were still confined to the boxes egataining the balls of twine which had been sat- urated with oil,This fire could have burned for some time before the smoke would have reached the portion of the building in which people were sleeping and would,probably have gained such headway before being dis- covered that the building would have been doomed.The only damage re- sulting from.the fires was the burn- ing of a small hole in the floor of the hotel kitchen. Bridge Will Probably Be Built. Commissioners Brown and Hollar of Catawba county and Attorney Rob- inson of Charlotte,representing the Southern Power Company,met.with the Iredell board of county commis- sioners Friday for a further consider- ation of the matter of a bridge over the Catawba river at Island Ford. The mbiter was discussed freely by all concerned,but no definite action was taken.The Iredell board renew- edits proposition to pay’a:third of the cost of the new bridge provided the Catawba board and.“the Power company will pay a third each,and a resolation to that.effect was passed, Copies pf the resolution were’sent to the Catawba board andthe Power company for ratification,and it is be-lieved that each will act favorably. Under the terms of the proposition toll is to be charged on the ©bridge until the amount paid by the two coun- ties has been collected,after which the bridge.is to be made a free bridge. No toll is to be charged persons con- nected with ‘the Power company. seprieenenipeaed eeepcMatecColoredChildBurned to Death. The three-year-old daughter of Dan Stevenson,colored,who lives-on Mr. Robt.Dishman’s ‘place three miles west of town,was fatally .burned Thursday morning.:The mother left the child in bed asleep while she yore to the home of Mr.Dishman’s,\ short distance away,to get a backet | of water.While she was at r.| Dishman’s the magther heard the child seream and immediately ran back to the house,accompanied by Miss.Dish- man.The child was found lying’on the floor with praqtically all her clothes’burned from hér_body..--The mother and -Miss Dishman beat out the flames with their hands and.both received painful burns in so doing.A physician-was called and it was found that the child had-inhhled flame and was fatally burned.Death occurred within five/hours.#is supposed that the child went to the open fireplace to warm and her clothes were ignited. Mr,McLaughlin Will Talk About The Charm of Nature. The next event in the Chautauqua Winter.Course.will.oecur.Friday evening,14th,in Shearer Music.Hall, when Mr.R.B.McLaughlin will talk about “The Charm of.Nature.”A student of nature because he loves na- ture,what Mr.McLaughlin will have!¢to say on this”subject will be from: knowledge acquired from first hand. stantinople and the opening of*Bosphorus,which-connects theterraneanwiththeBlackSea,so ‘that| Russia might have an avenue for the} receint-of arms:and ammunition —and|~also for the exportation of Russ ian |‘erainm,For England,success meant the prevehtion of another Turkish in- yasion of Epypt,and the permanentsafetyoftheSuczCanaland.Eng-land’s’Communications with®India. Politically a victory was expectedtohaveapowerfuleffectuponthethenstillneutralBalkanStates,Greece,Bulgaria and Rumania,whose‘political status has for generationsbalancedwiththatofTurkeyintheévéer-changing scale of .Balkan poli-ties.There was cited the possibility, how.realized by Bulearia’s:entranceintothewar,of vreventing the estab-lishment of a Balkan line —betweenntralPowersand<Turkey.andthenossibleopeningofaland to India.an ambition which the ‘have long credited to Germa- the Medi-|t ‘November 2 Premier Asquith‘arliament thit the Dardanellesaignhadbeenafailure.Up toaber9thetotalBritishcasual?ties on the peninsula were 114,555 meni_killed,wounded -or missing. »j Miss Annie ‘MeKeo 0of,é.‘LincolntonandMr.L.CashNixon of Statésville,.formerly of Lincoln county,were mar- abot |grass and a study of (ey ioo in Lincolnton Christmas one +pon observation,and will not only inform| but interest.In years of observation tof birds and trees and flowers and! these things,| Mr.MeLaughlin has acquired a fund} of information that is most interest- ing and valuable aid his home peo- ple will do themselves credit as well as show appreciation of home talent, if they fill the house Friday evening. There is no chiarge for ‘admission. Holders of tickets will be entitled to the seats they haveyveserved but the general admission is fr ee,; Local Team Wins and.‘Loses. In the game with the.Winston-Sa- lem team,on the local floor Saturday night,the Statesville basketball team was defeated by a seore of 24 to 22. As i cy by the score,the teams wer@?pretty well matched.The Wins-ton-Salem team is fast and plays good elean ball,but the Yoeals.believe they would have proved winner had they not been handicapped by the absencefromstownofoneoftheirbest.play-ers—Newman—and the illness of Goach Btheridge.‘$Statésville won the’game with the Charlotte Y.M.'C.A.team in Char- lotte Thursday night by a séore of 25 to 22,‘/The local team leaves today —forGreensboro,where it is acheduled foragametonight,:From .Greensboro the team oes to Elon College,themeeeandoarCollege, 141, .jrance,who was Miss Zelda Cline, jor $716.50. MR.J.B Native of the CCounty and For-mer Resident of Statesville— Other Deaths—Funeral of Mr. Gill. Mr.J.Barnett Douglasss,who wasbernandrearedintheMt.Mourne section of ‘this counvy and whe was for some years engaged in the mer- cantile busines in Statesville about 30 vears ago,died Friday morning at 10.-a0 at‘his home in Winston-Salem.His health failed several years ago and he spent some time in the West.Whilehisconditionimprovedhewasnotable to resume active business. Mr.Douglass was about 54 years old.Near 20 years ago he eres Wiss Adélaide Cannon,een er Mr.and Mrs,J.W.Cannon of Goncord,and his wife and two children survive.He was a member of,the First Presbyterian.church of ins- ton-Salem.-The funeral was conduct- ed at his residence Saturday afternoon and the interment was in Winston-Sa-lem. While Mr.Douglass lived in States- ville he was in charge of the business of J.H.Thompson &Co.,in which he was interested,in the stere now oecunied by the Polk Gray Drug Go. On leaving here he,became a_trav- cling salesman and for 25 years—up to the time his health failed—he rep- resented a~Richmond house.Mr. Douglass had many friends and a number of relatives in this county. He was:popular with his —aequain- tances and his passing brings sorrow to those who knew and esteemed him, The remains of Mr.W.C.Gill,who died in Richmond Thursday,as told in Friday’s Landmark,arrived in Statesville Friday morning on No. accomnanied-by-his brother,Mr.Harry Gill of Richmond,and his aunt,Mrs.A.M,Witherspoon of Salis-hury.The body was taken,to the home of Mr.and Mrs.W.C:Moore, brother-in-law and sister of the de- ceased,jo west Front street,where funeral sefvices were conducted Fri- dav afternoon bv Rev.Dr.OC.BE.Ray- nal and Rev.J..H.Pressly.The burial was'in Oakwood cemetery. The Landmark mentioned briefly in its last issue the death of Mr.J, Rome Cline.who was for the greater part of his life a resident of Catawba and for many years a merchant there. The funeral and interment took placeatCatawbaPridayafternoon,* Mr.Cline enlisted in the Confeder-}: ate army at the age of 17 and was a member of Company B,.Second North Carolina cavairy.‘Ye is sur- vived by his wife and five children— Engineers Frank and John Cline and Conductor Robey Cline of the Ashe- ville-division of the ‘Southern rail- way;Wade Cline,an electrician in New York,and Mrs.George Lay0 Mrs.arrivedMississinni.Lowrance her father’s death, Mrs.Jane Miller Sharpe,wife ofMr.R.Q.Sharpe,died Friday at her} home in.Concord oe aged 65 years.°Funeral by Rev.E..D.Brown and interment at ConcordEee Sat-urdav.Mrs,Sharpe is survived by her husband,four daughters and ason. George,the 11-months-old son of Mr.and Mrs.©.I.Plaster of Long Island,died at the Sanatorium Sunday night at 9 o’cjock,death resulting from-a severe attack of broncho-pneu- followed by abseess of the lung.The child had heen ill for three weeks.._It was brought to the Sana- torium ‘Sunday afterneen and an_on- eration was performed immediately thereafter,to drain the‘abscess.as the last attempt to save its life.The re- mains were taken yesterday to Kan- napolis,the old home of Mr.Plaster. for burial,-Mr.and —Mrs....Osborne Brown of Long Island accompanied Mr,and Mrs.Plaster as far as Salis- bury,where they were met by rela- tives from Kannapolis. monia, Aldermen Sell $ “DOUGLASS DEAD. mete emer er Rae THE MOBS 1LOOT AN D BURN Three Killed,“Many Injured and Much Property Destroyed.at Youngstown,Ohio —Trouble the Result of a Strike. Two men were killed,100 persons, including a woman,were wounded, six city blocks were burned with.a loss estimated at.$1,000,000;State troops were called out to restore order astheresultofriotinginEastYoungs- town,0.,Friday night,following a battle between a crowd of strike sym- pathizers and armed guards at the wlant of the YoungstowN Sheet & Tube Co.Twenty-two persons were sent to hospitals as a result of the rioting...Others..sufferedminor--inju- ries.f The trouble was the!culminationof| a strike which,began at the plant of the Republic Iron &Steel Co..a weekbeforeandspreadtotheplantsof the tube company,the Youngstown fron &Steel Co.,and Brier Hill Steel Company. Rarly Rriday strike sympathizers and workers at the’sheet and tube plant clashed,but no one was injur-ed.Later in the afternoon a riot oc- enrred just outside the tube company plant and two men were injured so hadly they were taken to a hospital, The most-serious trouble started Pri- day night when the day shift at the sheet and tube mills left work.A crowd of 6,000 gathered at the en- trance to .the works,and”stoned a squad of police employed by the sheet and tube company. According to a statement maids byPlantPoliceChiefWoltzhefiredablankshotin.the air to seare the crowd and then firing became gener-al.Nineteen in’the crowd.were wounded,following which the mob,frenzied,surged into the East Youngs- town business district and set fire to several buildings.The torch was’ap- plied first to a clothing store ‘and then to a jewelry store.Both these storesandasaloonwerelootedandfired and liquor from the saloon was dis- tributed through the crowd.The Youngstown fire department went to the fires but was driven off by the erowd.The East Youngstown depart- ment also attempted to check the blaze but the hose was cut and the firemen driven away.Being unable te control the mob the sheriff asked for)troops, ‘fhe troops took charge and soon had:the situation in hand,.About250)foreigners have ‘been arrested fimPrioting and wavon loads of goods 'fould in their homes,taken from the looted.stores,..were.recovered.__For- eigners.compose the greater portion of the population of East .Youngs- town.Efforts tq arbitrate the —strike have,begun.’, |PREACHES IN CHARLOTTE. at her old home on a visit the day of Rey.J.H.Pressly Conducting a Meeting—Church News. Rev.J.H,Pressly went to Char- lotte yesterday to begin a series of services at the First Associate Re- formed church of that city,his firstservicebeingheldvesterdayafter- noon.In a notice of the meeting to be conducted by Mr.Pressly the Charlotte News says: “Mr,Pressly is regarded as one of the ablest ministers and forceful pul- vit orators in the A.R.P.Church and it is likely-he wil-be greeted by good crowds throughout-his_meeting here.” The First Baptist church will hold its annual roll call and reception at the church Friday evening at 7.30 o'clock. Rey.J,Meek White,formerly pas- tor of New Stirling and.Perth:Asso- ciate Reformed Presbyterfan church- es in this county,and for the past year or two a resident of Troutman, has accepted a call to the pastorate of Prosperity ©and Cannon’s ©Creek churches,in.Newberry county,8S.Cy Recently Mr:White has been living at Sharon,S.C.Rev,Dr.°C.Ee.Raynal ‘of’States- $30,000 ‘of Bonds,|ville was one-of-the speakers at a memorial service held in the Second The board of aldermen,,in regular ;Presbyterian church of,Charlotte Sun-monthly session Friday night,solc 830.000 of .80-year.5 per cent.funding| onds to Robinson,Humphrey,Ward- low ©o,of Atlanta,Ga.,at a premium The bonds were sold to /pay for street improvement:work.A number of other by the board,off or two of were within®a few dollarswhichwasaccepted. The session of the board was very brief.The only other business be- sides the sale of the bonds was to pass on the assessments,made against property in some of the street im- provement districts. which Prize For Labor Saving Device. Tt its last issue the »Progressive Farmér featured handy labor saving} devices of home construction—the de- vices being illustrated and the de- tails of their making being explain- ed.The idea was.to)givegall farmers the benefit:of handy devices which many have.provided for convenience and to save time and labor about the farm and home.There were two con- tributors from Iredell—Messrs.11.H.Wooten:of Bethany township,who!ihexhibited.a pig-pen door,and Mr.R.i.Lawrence of Olin township,whose invention was a corn sled harvester.Mr.Lawrence won second prize—$b5. Mr.Lawrence made #stéd and at-tached a seythe to it to eut corn for ensilage.The sled is driven between ihe corn rows and the attached scythe cuts the corn,Mr,Lawrence.says with this sled one man can do the work of four+men cutting with knivesintheordinaryway. bids were reccived, \day evening in honor of Rev.Dr.John W.Stage.a former pastor of that chureh,who died recently.Dr.Ray- nal:had been an intimate friend and}, associate of Dr.Stagg.On account of Dr..Raynal’s absence in Charlotte there:were no services at the First |Presbyterian church Sunday evening.of that):Preaching and congregational meet- ing’af®St.Michael’s church,Trout- man,the fourth Sunday at 11 a.m. Court Cases. Jo.Tucker;colored,was brought to Statesville from Asheville Sundav by Sheriff Deaton and placed in jail to await trial in Superior Court for attemnted forgery and passing worth- ehecks,Tucker,it is alleged, assed one or more worthless checks in Statesville some time ago and at-tempted to pass one to which he had forged the nanie of Mr.W.I’,Hall. After working his game here he went to.Asheville and.did likewise,with the gesult that he has just completed a term on the Buncombe county chaining,A eapias from Iredell was sett to Asheville and when Tucker nished his jobh.on the mountain roads ©was held for the Iredell authori- ties,i Gal.Waener,2 young white man who had been arrested at Cooleemeeonachargeofnon-support preferred by his wife,who lives in ‘this county, was.brought to Statesville Saturday evening by Deputy Sheriff White,whowant.after him.He immediately waived examination and grave $250 honda for his appearance at Superior Court, ITEMS OF CURRENT ‘NEWS. Happenings Hereand There in the State. The Hickory:Democrat has put on a new dress and the improvement is" marked, Figures from the census bureau state that during the past decade North Carolina has passed from six- teenth in point of population to four- teenth. The safein the postoffice at Spencer was demUlished by an explosion Fri- day night and robbers got away with $125 to $150 in cash and a quantity of stamps. The Seaboard Air Line railroad has bought,.100..acres.of-land»at-Hamlet and will build shops at that place for the construction and repair of cars— mostly freight cars. The Gastonia.Gazette,a .splendid paper,has entered upon its 87th year. Messrs.E.D.and J.W.Atkins have been,at the helm a little more than nine years and they are doing goodwork, The Boone Democrat reports that Mrs,D.C.Coffey of Shull’s Mills, Watauga county,intended to give her 8-year-old daughter a dose of calomel and administered arsenic by mistake. The child died in 15 minutes. Mrs.Robert Porter,a native of Wilkes county,was killed by an auto-mobile on the streets of Chicago Christmas eve and her remains were brought to Wilkes for burial.Hus+ band and five children survive. Frank Foster,who shot and_ki Geo.Hayes in Polk county's @weeksago,has been removed to Ashe- ville jail for .safe-keeping.Foster killed Hayes while the,latter was walking with some young women. ‘An order,has been issued by the ad- jutant general to disband the—Hert-ford division of Naval Reserves.Theorderis.because the officers of the di- vision have failed to measure up totherequirementsinproficiency. The third Road Institute for,North Carolina will be held at Chapel Hill February 7-12,under the auspices of the State University,the State High-way Commission and the North Car- olina Geological and Economic.Sur- vey.Road Maintenance will be the special,subject for consideration. Miss Dora:Love,who was hurt inanautomobileaccident.which occur-red at Monroe December 19,died Sun-day from the effects of the injury.The motor car was srruck by a trainatacrossingandMiss”Bessie’Love,| a sister of Miss Dora;who was in theear,was fatally injured,dying a-few hours later.; At a meeting of the Republican ex- ecutive committee of Buncombe coun-ty Hon.Richmond Pearson started something by proposing that thecommittee.write Col.Roosevelt thatitwouldbeunwiseforhimtobecome a-candidate for President on accountofoppositiontohim.The suggestionwasnotadopted. ITEMS OF ALL SORTS, Near.Corinth,Miss.,Sécien and Eu-gene Freeman,father and son,disput-ed about a team of horses and shot ateachother.James Freeman waskilledandthesonwasexoneratedon the ground of self-defence. Ada Rehan,an ,actress of note,died ina New York hospital a few|@4: days~ago.>Miss‘«Rehan,whose real name—was-—Ada—Grehan,-was~born ittLimerick,Ireland,April 22,|1860,and came to New York when a child. Three former officials of the'United States internal revenue departmentandfourothermenwiil,it is expected,vo on trial at the term of the United States District Court,which opened at Fort Smith,Ark.,yesterday.Mose B.Brock.of Salisbury,N,:C.,is one of.the defendants, Mrs.Christina Mayes,wife of aChicagoteamsterykilledherselfand her five children,ranging in.ages from two to seven,by,turning on the gas.Her husband evggested that her mind might have-become affected through grief over the death of her mother last summer, Cotton Ginning Report. The eighth cotton ginning report of the census,bureau,issued pesterday, announces’that 10,643,783 bales of cotton,counting round as half bales, of the growth of 1915,had been gin- ned prior to January 1.That .com- pares.with 14,443,146 bales,or!90,8 per cent,of the entire crop ginned prior to January 1 last year;18,847, 721 bales,or 95.5 per cént,of the 1913 crop and 12,907,405 bales,95.7 per cent.of the.1912 crop.The average auantity of cotton.ginned_prior to January 1 in the last ten years was 11,968,038 bales,or 93.4 per cent.of the crop. North Carolina’reports 696,072 bales ginned compared with 814,644 ginned last year. Slipped onBanana Peel and Se- riously Hurt. Miss Louise Sloan suffered a pain-ful aecident Thursday afternoonwhilewalkingalon®east Front street en route.to:her -home on Salisburystreet.She slipped on a banana peelandfelltothepaveméntwith,suchforcethatherknee’cap was dislocat=ed..She was earried into the home of Mr.W.W.Tharpe,where a phy-sician attended her,and during the evening was removed to her home,where she has since been ‘confined to her:bed.The dropping of bananapeelingson,sidewalks is a very dan-serous practice and is.dso a viola-Hon of the law. 4 house Thursday night,18th.The talks| SeIeTeT BRIEF ITEMS LOCAL NEWS, Mrs.P.B.Key,who has been“oe?vy feeble for a long time,iscritical- ty ill, --Spelling Bee at HollyschoolhouseThursdaynight,- and old invited, —Mr.Ratph M.Austin has a posi- tion with the local agency of the At»lantic Life Insurance Co; —-Mr.H.Morrison of Loray,this:county,heads the honor roll of the — senior class at Davidson College forthefallterm.The honor roll repre- sents an average of 95 or more, License has been issued for the marriage of Quincey Lee Freezeand..Miss..Fannie Plyler,John Ay.Stes...venson and Miss Mamie Houpe,W'm.|. Springsoung > P,P.Bass and Mary Bell Hoover,George Rod Pharr and Rosebud Long.4 areingmadeattheStatesvilleInn.Theirebuildinghasbeenrenovatedaetioednewcarpetsarebeing plated in the halls,and every roomisbeingequippedwithhotandcold — water. “Mi."Wh C.Wooten ‘of Bethany—township has been.notified that he :will be on the programme.of theStateLiveStockAssociationforatalkondairyproductsatthemeet-ing to be held in.Salisbury Janu- ary 25-28. ~—Mr.G,E.Dull,county demonstra-tor,and Dr.CG.L.Cruse will talk aboutlivestockatChestnutGrovepact bein mate at th improvements Will.be.iHustrated and pupils and pa-trons of the school especially and the—publie generally are invited to atend. »—A shipment of 18 cars of horsesandmuleswasreceivedbyHen-)kel-Craig Live Stock Co,last week.Seven cars were unloaded here and.the remaining six were sent on |toSalisbury.This is one of the largestshipmentseverreceivedbythecompany.amTwenty-five acres of land in iBarringertownship,..known as theMrs,Ailice Martin home place,weresoldatthecourthouseyesterdayby.Mr.John A\Scott,commissioner,toMr.$..0.Overcash’at $12.25 an acre.The sale stands open #0 days for in-|creased bids. —The announcementis made fromRaleighthatMr.J.D.Norwood:Salisbury:will beBnforMr.J:A.ness,C kdellsiperior©rt,who will becandidate:or ‘theat iheof tary of SMr.Hartness ‘says his activepaignwillbeginaboutAprilIst.—The county commissioners andboardofeducationmetinetaFridaytoconsiderthequestion’ofmedical-inspection of schools.It wasdecided-to accept the proposition of the State Board ofHealth for thein~~spection,but to defer the inspection—be)the Seen of the.schoolsnext a Meetings of Stockholders, The stockholders of the StaringCo.,in session last week,re-elect-ed D.A.Morrison president,CG.G.Teague vice president and T.0.Mor-rison secretary and treasurer.The‘port of the past year’s business shedaprofitof18percent.,and a 6 per,cent.dividend was paid,The capital‘stock ‘of the company is to be increa Mill- At.their meeting Saturday_the:di-rectors_of the.Merchants-&Farmers’Bank re-elected L,T.Stimpson pres-.ident,C.S.Tomlin vice presents,FoB.Bunch cashier and J.A.Knox as |sistant cashier. The stockholders of the StatesvilleCottonMillmetinannualsessionyesterdayafternoonandre-elected the:following board of directors:Fi A..Sherrill,M.R.Adams,W.F.Hall,=:D.Miller,Wm.Wallace,P.F.genour,B.F.Long,and JW.Cope.land..Mr.Wallace was re-electedpresident,Mr,Sherrill vice president,Mr,Miller secretary and treastrerandJ.Ws Kaneer superintendent, From Rockingham _ Farmers County, Today a delegation of farmers fromRockinghamcountywillarriveinStatesvilletovisittheStateFarm.Mr.W.1.Gilbert,secretary of the’~Commercial club,and other members: of the clubwill look after the delega-tion,provide for their transportation.to the State Farm and take them out on the Iredell roads if time permits,The Rockingham farmers are visit-ing the State Farm at Statesville andthecreameryatHickory...StatesvilleandIredellgivethemacordialwel-come, etiticbvalbibelCo ee eeeteepiofLocation. _J.B,Fraley and family andro"Praley’s parents,Mr.and:Mra, J.E.Stimpson,moved yesterday fromtheStimpsonresidence,corner RaceandWalnutstreets,to the N.W.Fow-ler residence on Davie avenue,Mr;Fowler's family has gone to Wilkes-boro to oceupy the residénce whichMr.Fraley traded to Mr.Fowler for ihisDavieavenueproperty.Mr.Fred,\~A.Thomas of the Diamond Furniture’ Co.will occupy the Stimpson ‘resi-’dence.”:1°eapuntipsoiieitlgnysleitatisctienieldiapiipiteiadaisMr.Deitz Changes Base.Mr.J.EB.Deitz,who was for someyearswiththe‘Southern railwayforatimeasticketagentandlateraschiefclerkinthefreightofficeisnowwiththeWilliamsFurnitureWouse,When the furniture companyisincorporatedMr,Zmadesecretaryandtreasurer,C.F.Bortnechiefclerkioffic ~The inevitable,the unsuspected,the surprising foethe actual ’e ht here at your door,or probably within an.‘hour’s ride,an EVENT RGOTTENin the annals of Statesville.+— THE BNTIRE $10,000 SToOCcEe OF.J.M.McKEE &COMPA TO oa city into a buyingf to pluck the ripest ‘ truth has leaked ‘out and NEVER TO BE NY,Statesville, ‘ § BE Sold Out Completely and Unconditionally,Beginning WHETHER IT’S ever heat, bargains in North Carolinaa today. A FEW OF THE COLD,OR WHETHER sa HOT,COME AND WEA y Tell your friends and neighkors—herald the good news everywhere PROFIT AND COOST CRUSHING PRICES—NO ROOM FOR DETAILS. FRIDAY,JANUARY.1th,and For Ten Days ‘Thereafter.| ATHER IT,WHETHER OR NOT.‘ This sale gives the’people of this section the greatest opportunity to dress from head to foot Ww ith the season’s most desirable merchandise at prices that will set the whole PR de i Every housekeeper who is economical and worthy of the title will be here.Every woman who fails to avail her self of this opportunity,fails % » *1 Be sure you are at the place. Remember the Date.WEST BROAD 1right ‘THE LAN DMARK ‘"TURSDAY,January 11,1916.— Wilkes County Teacher Won ~Suit.in Tennessee!~~ ‘A*suit affecting the rights of teach- ers and boards of education in Ten- nessee was decided at a recent term of the.Circuit Court of Johnston _county,Tenn>Miss Mpncy H.Welborn of North -Wilkesboro,N.C.,was employed as a teacher in the high school at Moun- :a City,Tenn.,at a.salary of $75mth.The board of education asked Miss Welborn to resign.She re- 'fused to resign and requested the boatd to state its reasons.Upon re- ceipt of the reasons,she still declined| »to ngsign,declaring the grounds were, “not’such as to justify the action,The, board thereupon discharged Miss Wei-| and elected her successor.She-immediately entered suit to recover*herssalary for the.scholastic year.Thecourt's decision is that Miss Wel-born-is justified in her contention,and the school board is directed”to’ pay:the,salary,with interest,to the |“endofthe school year.The courtheld.the bard if.education hadnoTighttotakeactioninthemanner ich it did. ie opinioh points out that thedefdantshouldhavebeengivenno-tice,‘and_the right to an investigation, 2 which she would have had the5rivilegeto.offer testimony in her é “own defense.; Contract Signed For History—Dr.Hill the Writer. The State Historical Commissionhas.closed a contract with Dr.D.H.Hill,by which he will devote the next five years,or as much thereof as may essary,to.writing a history of Carolina’s.par:in the CivilHeistoretirefromthepresi- deal of A.&M.College at the closeofthepresenttermandwillimmedi-) ate!thereafter enter upon his new;“Guties.In signing up this contract,with,Mr.Hill the State Histories]!Commission is acting for the North’Carolina Division of the United Con-oy te Veterans and as trustee for|und of $25,000,which is to be)Dicer to pay for the work, ‘the $25,000.He is not to pay)but to be responsible if the amount*t secured by subscriptions.Dr. will get $4,000 a year for his vor 00 less than he gets as pres-ident of the A &M.—and is to haveUclericalassistanceandhelpin“research.work as he needs. ‘ceicmetstomensinatvenenetmmnmtomcetenstes pterelve carloads of cigarettes areinSavannah,Ga.,awaiting shipment»England for British soldiers at thefront..They were shippedmond,Va,; Out MalariaAndBuild Up The SystemtheOldStandard.GROVE’S3chillTONIC.You knowtaking”the formula’is from Mr.é H.Ricks of Rocky Mount guar:ate NEWS IN CONDE!(SED FOI {tems ofInterest Gathered Frora!! Over the State.| A course in printing will be add-} ed-—-te-—-the--Winston-Salem graded schools and a plant is to be purchas-| ed-for-the purpose.| Our Fatherless Ones:We are pleas-| ed to note that Rey.Dugald Munroe has returned to his work in the Cleve-| land -Woodleaf field after spendingtwomonthsatRedSprings,recuper-| ating from recent illness. The 2-year-old son of Mr. S.B.Cook of Buck Shoals, and Mrs.| Yadkin|i eounty,was found-dead in-bed Wed- nesday:morning.The child was ap- arently in sound health when the family retired the night--before.!The town of Salem is 150 years! old.ft -was-on January 6 that a par- ty of eight men arrived from Betha- nia and felled the first tree in mak- ing the clearing for.the erection of the first house in ‘the town.Plans are being made io celebrate the event. Sam Roberts,a Yadkin farmer, was troubled by the “hawks carrying off his chickens.He planted a pole in the ground and fastened a chicken to the ton,.about 20 feet from.the round.He then seereved himself inthethicketnearbyandwithhistrus-! ty gun suceeeded “in.killing eight hawks during the day. Geo.Cathey of,/Buncombe county, under sentence of 18 months on the roads for selling liquor—sentence af-. firmed .by the Supreme.Court—can’t be found,and it is said the bond of $2,200 will be declared forfeited. When the Supreme Court decided against Cathey.his attorney put out'2 the word that an-appeal would be tak-| en to the United States Supreme Court.‘Meantime Cathey vanished. The dead body of Anderson T.Gur- ley,a farmer of Wayne county,was found in the river Friday and the in- dications are that the man was mur-|} dered and robbed,He had sold two ‘bales of cotton in Goldsboro and had ‘drawn about $35 of the morey.It is supposed he was attacked on his way home.Only $3 was found in_his pockets.Two negroes have.since ‘been arrested and are in jail.One of‘them has confessed and implicates a i third,: Gaither Felts of Elkin went out to Montana three weeks ago,taking with( him 15 trained hunting dogs,intend- ing to spend three \weeks with his friends and engage in hunting wolves: and jack rabbits.When he reached there he found all the game he ex- nected,but with it was snow,ice and blizzards galore,th@ mercury being | several degrees below zero,something | Mr.Felts hadn’t taken into his cal- culations.turned to Elkin as promptly as steaméouldbringhim. LEETNE SOC S IERELICREEA SRCTETIES Women of Sedentary Habits.Women who get but little exercise are llely to be troubled with constipation and indiges-tion and will find Chamberlain's Tablets high-ly beneficial.Nt sc good as a three or fourmilewalkeveryday,bub very much,betterthantoallowthebowelstoremaininacon- stipated conditione’They «re easy and pleas-ant to tak@ and.most agreeable in effect.Ob-,|tainable everywhere, ;worth ef inter ‘publ As a consequence he re-} BUILDING?WATKINS.BUILDING?mia STREET,-Z Between Lazenby-MontgomeryHardware D.RIC HARDSON a edt FB. RM |fROM OVER THE COUNTRY.|Chinese cotton manufacturers,with | {tems of Int erest .About Various fatters.I; Approximately a Non dollars’, al revenueystamps and nd dollars in cash were} stolen Th ty night by robbers who} blew open a vault in the old Federal| building at St.Pauly.Minn. L.Knox,surveyor of cus- the port of New Orleans,} December 22 shot and -killed| several thou tol toms for who on ltwo men in a railroad station at BatonRougeLa.,has been officially declared | sane and committed to the crimin:ul div sion of the State Hospital for the} insane. Consul Garrels at Alexandria,i Egypt,has advised the State Depart- ment.that he obtained affidavits from 24—-survivors-of the Persia,including} Charles H.Grant,an American citi+ zen,and that all confirmed previous; reports that “no.we arning was given, and no vessel was seen.’ Mr.Gardner of Massachusetts,Re- ican,speaking in the House of 3s Friday on proposals for mu Con nitions embafgo, Americans in a way that drew hot, protests from three Republican col- ieagues——Stafford and Cooper of Ohia: and Longworth of Wisconsin. W.F.McCombs,chairman of the national Democrat!:committee,de- clares that “the second term:plank” concerning the presidency was not a mandate of the Baltimore convention, and may be construed either as a rec- ommendation to the candidate or a recommendation to procure the pass-ing of a national _constitutional amendment. A brilliant.reception given at the White House Friday night by Presi- dent and Mrs.Wilson crowned the so- ‘cial attentions paid visiting delegates to the Pan-Ameri¢an Scientific Con-, gress during the past two weeks.,In numbers present and in splendor the affair surpassed anything of the kind seen in Washingten in recent years.: It was Mrs.Wilson’s first public ap=| pearance as mistress o¥the White! House. Prof.Godbev’s Humor. Charity,and.Children, |Among the humorous writers of the [ State we are obliged to put Prof., Godt vey of the Greensboro News in) the lead,The beauty about his fun is it does not strain him. ‘WHY YOU ARE NERVGiS The nervous system is the alarni system, |of the human body. In perfect health we hardly realize that,we have a network of nerves,but wheniealthisebbing,when strength is declin- ing,the same nervous system gives the alarm in headaches,tiredness,dreamful sleep,irritability and unless ‘corrected,’leads straight toa breakdown, To correct nervousness,Scott’s Hmul- sion is exactly what y@u should take;its |rich nutriment gets into the blood and |rich blood feedsthe tiny nerve-cells whilethewholesystemrespondstoitsrefresh- ing tonic force,Itis free from alcohol.\Scott &Bowne;;Bloomfield,N.J. WATKINS, Cy)ye criticised German>' delicate brain MUSTANG and Hall’s in Charge. government aid,‘have voneeine plans to wrest from the apanese their heavy trade in cotton goods and yarns in China.largest market for cotton goodstheworld,jong has beenichieflybyJJapanandIndia. “tthe meeting of the State Guard ‘icers in*Greensboro last week reso- inilatin:were adopted advocating the fostering ofthe National Guard rath- made far- in supplied er than the development of a new ‘Continental army." “CASCARETS®BEST IF HEAD-ACHY,BILIOUS,SICK,CON-STIPATED! Best For Liver and Bowels,Bad Breath,Bad Colds,Sour Stom- ach! a 10-cent.box. Sick headache,”biliousness,'conted ‘tongue,head and nose clogged up with a cold—always trace this —to ‘torpid liver;del fermenting food in’the howe stomach. Poisonous matter cloggwed in the in- testines,instead of being ‘cast out.of tne system,is re-absor-bed into the blood.When this poison reaches’the tissue it causes ¢on- gestion and that dull,throbbing,sick- ening headache. Cascarets immediately cleanse the stomach,remove the sour,undigested food and foul gases,take the excess bile.fromthe liver and carry out all the constipated waste matter and poisons in the bowels.? A Casearet tonight will surely straighten you out by morning.They work while you sleep—a 10-cent box from your druggist means your head clear,stomach sweet,breath right,complexiofi tosy and your liv- er and bowels regular gf ‘or months. Get yed,$or sour,. STATESVILLE,N.C. Drug Store, China,the(* grassy ~ tance of 20 miles,vu of xeturn trip ticket. We will refund railroad fare with purchase of $15 or more,up to a s $1.00 Men’s Dress Shirts cut to...0.0...6...ee 69e Ladies’regular 5e,Hameronicte NOW .6 vee tan RC,‘Men’s regular $8.00 Dress Shoe,now ........+%$2.19. Men's.60c.-Work Shirts,extra quality,now ......89.Rte Hee regular $1.25;ee tO i oe OM:on George Hens bed Domestie,ent.to coca)6 1-4e, :Rae rlanke §xtra quality,regular »lot D 8 aces :Men's all wool Shirts,regular $1.25 to $4.50,now 79¢.00 o alan set,full size,extra quality,regular Sia ne Peed ase é yd Laces,regular 5c.and 10c¢.va ‘ie a a ay oe Dey TIQW 6 ee ee eee mee rie hee ee ee ee ee ewe €Ox 2 ©eee ee Pe ee ee ee eee ee te we eee . *ee ane ue ee Ae nes ie ener Ie.Ladies’and Children’s fine Raincoats,values up to Taffetas,yard-wide,regular $1.25 yd.,cut to ....89e. &ne 10 L Bo ak o en Sweaters,regular ......aoe $6.00,NOW .6.sve a eee eee eee 98e.and up.Silk Poplins,fine quality,cut-to vyie seb aes :M $aB oe oe oe oT bees aah et :ey eee ee iia One lot of Children’s Shoes,extra quality,mow 49c.up.Boy’s Pants,regular 75c:and $1.00 values,now...45e. en’sso psc tan agheats bblters,regu ar 75€.,Cut to vUC,Children’s Coats,values up to $6.00,now 9&c.and up.Red Goose School Shoes,regular $2.25,cut to $1.49 and Ladies’Fine Shoes,values up to $3.50,now 98c.and $1.48.Ladies’Coats,(only:four left)-cut to ....2.....$1.98.$1.69.. eerie and va 1-2c.yd,-wide Percales and Suit-5 Ladies’Coat Suits,latest styles,values up to $14.Se 50c.and75c.Ladies’Waists,GUE TA eeea oe sale Ca a eo cu iGo a:Rus oF ein ts +Asal Sass 3 hobs Se),Anereneeenn eee $4.98 up.Ladies’,Mén’s and Children’s Underwear,wool and =ae =.gh .c.een now EUnet ie ha Lit ies’Coat Suits,$25 value,CUt te.et oer e128 86 cotton,regular 25c,value,now ......2...19e.: hilar ‘a eee Peo Sie Ngee BCs Men’s-Work Gloves,fine quality,TET ROT 39¢Regular 50c,value,now .....6 0.ices.eaon coe ee)BOC. _Omudren:s Hose,extra fine quality,now ........Tl-2c.Men’s Fine Work Shoes,Fegular $2.50,now ....$1.75 Regular-100¢.value,now ..6.2...5.lee 790.| i a s sae is es the ene Igreeatest and most wonderful money-saving event this section has ever seen._We-only ask you-doubters,skeptics,and’“shaw me”people.‘ o come and see for yourselve # :FRIDAY,J ANUAR Y 14th,AT 9A.M.: -1-Come Early.NY |T Lc &“C ymnvpanv Ride to the Sale::J.M,Micivees<é C Dp >|:BREE! ipon presentationCOMEEARLY! Ford Touring Cars. Ford. THE UNIVERSAL CAR 2 Carloads of Fords Just received two carloads of ” Start the New Year right by buying a - 'Carolina Motor ‘Com’y; Statesville,Mooresville and Newton. pet For Sprains,Lameness, Sores,Cuts,Rheumatism Penetrates and Heals. ’Stops Pain At Once * For Man and Beast 25c.50c.$1,At All Dealers,-LINIM "OUAMEY FI ”ASK \US Work Guatanteed-—ExpertWorkmen We don’t "lati to know.much ‘about the war or the weather,but we do know how to repair leaking radiators. And how about giving your car a complete overhauling? We guarantee our work to be as good as the best, STATESVILLE MOTOR co.,i Wd PHONE 140 “DANGER” CROUP and PNEUMONIA Come liken thief in the night and.seizeupontheinfantchild.Be prepared to saveealifeofyourlittleonebyhavingabot- tle ofBrame’Vino -Mentha Salve-———FOR-——— Croup and Pneumonia. Price Le,0c,and $1.00,bas sole.by all pealers or sentpost-paid int of price.°AME,MEDICIN ers once 2B ~y mY with ores Pine to be delivered at once or seagon.All purchases on a cash basis.* BOVE ELUMBEP CO., ..vary a HORSES,MARESANDMULES—I AM ATmy.stables with.36 post hi Horses,‘Mares and Mules:niece?young’{Horses to trade for|Se aFishes“Cash or time,0 Re baie al |astoe" Geo.H.Myers,Manager. Old.Field Pine Wanted !' We are in'the market for several million feet of Old Fieldtobecontractedfornext a enters Ai ar ae AllHoe“a hun “Weater ils:totostart.fires te: a. ‘troubles,and mthananyOnecol tell,st every kind ofmedicine,me any good. th\Idecided-to.try it.1aboutsixbottlesuntil l the ollie .eal ines rahad©mputtogether,=~eeibegan‘aski80well,and Tto aes‘a ut‘Several are now taking it,””you,lady reader,suffer from any a /|Goite L,Sheriill,M.D., ¢ailments due to womanly trouble, -$uch as headache,backache,sideacheeeleseness,and that everlastingly tired _Itso,letus ou to give Cardui afareseelconfidentiohelpyou, }past ,rest egal .ha faking Cardui t a‘won't regret it Ail maa Write to;Chattanooga Medicine Go.,Ladies’€ry Dapt.,Tenn,for SpeciadRebatesha ‘SUITABLE DIET \The effects of overeating during the holidays may ‘best be offset by \.White Beans, _,Pink Beans,Butter Beafis,.Canned Peas, '‘Canned Tomatoes, |Miller-McLain Supply Co. *|Train No.16 ar,6:40, apsbnrtoneionbdnnete felipe aotFatef.oer ae oo ho e s & ra r . due 10.06a,m.due 3:25pomceSs103868.mm.mints166p.m.due 10.60 yp mm :4 : ‘Train No 16 ar.9.60,leaves 10.88 aTrainNo.24 ar.8:14,leaves 6.14 p, From Tay!::lorsville.Trait)No.28 ar.10:00,leaves 10:40 «.leaves.7:05 p.Operated on Sunday. ma. m. m. mm.Nos.26 end 24 arenot Three thousand Villa soldiers andMayoIndianshavesurrenderedtoCarranzaforcesunderGeneralMa- driggal,in the vicinity of Quiriego, Sonora,Mexico,accorcing to reportsmadetoAdmiralWinslow,command-er of the United States Pacific fleet.While Villa was in Mexico at last ac-count and it was "reported that he had not given up”the struggle,hisforcescontinuetodeserthim.|SWAMP-ROOT SAVESKIDNEYSUFFERERS. You naturally feel secure when you know that Dr.Kilmer’s Swamp-Root, the great kidney,liver and bladder yemedy,is absolutely pure and con-tains no harmful or habit producing drugs.iThesamestandard of purity, strength and excellence,prescribed by Dr.Kilmer many years ago,is main-tained in every bottle of Swamp- Root.Swamp-Root is scientifically com- pounded from vegetable herbs.It isnota’stimulant and is taken in tea-spoonful doses,It is:not recommend- ed for everything.According to veri-fied testimony it is nature’s great helper in velieving and overcoming kidney,liver and bladder troubles. ‘If you suffer,don’t delay another day.Go to your nearest druggistnowandgetabottle.All drug stores sell it in two’sizes—fifty cents and one dollar.:However,if you wish first to try this great preparation,send ten cents to Dr.Kilmer &Co.;Binghamton,N. Y.,for,a sample bottle.When writ- ing be‘sure and mention the States- ville Semi-Weekly.Landmark. BLACKSMITHING! SEE LINEBERGER for anythinginBlacksmithline.Horse shoeing(No.'3 and smaller)60c,;No.4.70c.Shop rear of McElwee's Planters’ NOTICE TO CONTRACTORS! teeSealedproposalsforthé’construction of drainage improvements in Upper?Colldle Creek Drainage District for Iredell,€abarrus and Rowan counties,N.C.,will be received by ‘the Board of Drainage Commissioners up to 2 o'clock,p..m.,on the 24th day of January, Warehouse. v Subscriptions iesarhiannensictnnryessn ine tenuis“Taken to all Pub- ligations.‘Clube. ‘-.Rates. 1916,at the office of ZV.Turlington,Moores- ville,N:C./This work consists of about 11 miles of ditch.Plans and specifications are on file at the office of the clerk of the Superior Court at Statesville,N.C. Certified check for $170,made payable to the Commissioners of the Upper Coddle Creek Drainage,District,must accompany the bid. “the Board ‘reserves the rivht*to reject’any and all bids.ue J.A,CRAVEN, W..F.SMITH,; A.L.DEAL, Commissioners. Mooresville,N.C.,Jano 11—4t. 14x20 DrestedBucket Cedar Shingles! is made out of.Will neither warp nor split,and makes a prettier roof than any other wood.©.WATKINS,Statesville,N.C. THE. |Paine View Dairy ‘1.Has just had its cows tested 4 and they were found in good condition —anotherreasonwhytheDairy,with the Dacro:System should ~Peanut Butter. (OUR OWN MAKE) * Made fresh every day and sold in half-pound package rat 10:cents—just twice as Any quantity 4-inch and ©6-inch’DRAIN TILE on harid.i }2Common Bricks,Face‘|SBricks,always ready for|delivery,© Statesville Brick Co. ie -C.WATKINS for _\“Everything to Build With.”FULLSTOCK--LOWEST,PRICESpringee:Doors,Windows,Ceiling,looring,Siding,Boxing,;Mould-ing,Laths,.Lime,ement,etc.ext Planters’Ww.‘1Statesville. bepatronized. —PHONE 347 BLAcK{—|||{much for 10 cents as you =<a .generally get. |DRAIN YOUR.FARM |)Sherrill &Reece, Phone 123.108 West Broad St Don’t Forget Gold Medal Coffee in your next order.You will like it.A fresh shipment just in,We - have’.a complete linea,groceries,suchasPotatoes,~driedBeans,Peas,etc. —’PHONE 89—Kage &-Milholland. ‘|Will answer ’phoriecalls leftatDr,Long’s Sanatorium or HARDWOOD FLOORS i.Geo.M.Foard’s residence. erWrappers! Ve have the very besthmentButterPaper, can print your name &on same.Let us~have“your order for any”»quantity roxtwant.See us. Are perfectly sanitary,clean andeasytocarefor.Plans for a newhousearenotcompletewithoutrovisionbeingmadeforthem.n old houses the work is.readilylaidoveroriginal*fioors,taking theplaceofcarpetsSeemeorwrite. U.A.OSTWALT, STATESVILLE,N.©;|Jan.4 Box 143, a a tht ick meh whip meee -R.G.ROSSER,M.D. ‘GENERAL PRACTITIONER,“HARMONY,-+,-N.C.PhoneHarmony.Dec.21~8t* AD ie hThe same Cedar your.water bucket} Toincludea can of our©|. ae aPz) Show An Annual Event—The Selection of Seed. Correspondence of The Landmark.Peas ~Ever since-the corn show in States- ville it has.been my intention towriteanarticleforthefarmersofthecounty,calling -attention—to-“U1showitself,its value to corn grow-ers,the desirability of making theshowanannualeventinthecounty, some facts regarding the corn crop, and:the relation of the corn crop tothefuture,agricultural prosperity ofthecounty.‘First,@ want to speak of the educa-tional value of the corn show itself.Durine the vast eieht years ¢have at-tended hindteds.of corn shows.fairs. ate.,and I believe the Statesvil!s show was about as laree as any I haveseenoutsidetheStateFair.7nd the educational value was verv marked. The score card system of indeing is much better than the judging by comparison.In a large number ofsnecimensitisimpossibletodojus- tice by.comparison.Comparing theentireamountofcornattheStates-ville show.with the corn at some oth-er shows J-have-attendeds the lack ofskillinselectionwasveryapparent.The best show that I attended is the Asheville show,which occurs every vear on the last Saturday —before Christmas.and there the farmershaveattainedsuchskillintheselec- tion of the specimens that the show as a whole is far beyond any other held in the State;=4n;-@,great manycountieswherewehave“eld the first show the corn was so poorly selected that..it was,hardly fit for good feedcorn.Farmers have to be educated to know good corn,not only for show purposes but for gooc-seed. Good seed corn,or good show corn,should have the following character-istics:The ears should all be of the same length;the sare size,the same color,both grain and cob;tne same general type,the same length of ker-nel;the ears should be cylindrical and symmetrical in form,’well filled at butts and tips.the rows.running straight from butt to tip;the rows close and compact on the cob,and per- fectly sound.Some of!these points are not well observed in the selection of.seed corn,and if,they are not ob- served then there ¢-n be little hope of selecting such corn out’of the crop after itis grown.Like.produces.like, and the good show corn is the result of good selection of seed.Many far- mers say that all they care for is good feeding corn.That is all very true.but such corn aS I have described will always.make good feed corn,and what is more,the selection of such seed will prodtice more corn. During the last eight vears the corn cron has increased in North Car- olina 30,000.000 bushels,and to a verv large extent this has’been brought about by the use of better seed.be- cause we have held hundreds of corn erowers’meetings 1:which we em- phasized the use of good seed alongwithbetterculturalmethods.Prior to 1907.verv little was ever heardof seed corn.If a farmer had asked an- other farmer a better price for cornthatwastobeusedforseedthanhe would charge for good-bread corn.he would have been called a fool.Since 1910 many farmers have been willing to pay as much as $5 ver bushel for seed icorn,and thought they weremakingmonevbypayingtheprice. The selling of seed corn has-been much abused by persons of dishonest tendencies.because they would mis- represent their corn for the purpose of getting a high price for common corn.Every farmer should be very careful when buying corn for seed. It does often pay to buy good seed corn,-but.when ‘a farmer has securedgoodseedonce,he should continue theselectionhimself.I do not’want to write so much about:the use’of good seed-or good show corn.but more especially.aboutthe_corn-show -itself,—-and—how this feature may affect the use of good tiseed and the general_crop... T want to ask the farmersof Ire- dell county to make this corn.showsnannualevent.This time the Mer- chants &Farmers’Bank _promotedtheshow,and everybody admits thatitwasasuccess.I believe the farm- ers Jearned a gréat dealabout.corn.The samples were allowed to remain on exhibition for several weeks.and are there yet for the study of anyandevervone.That isa good feat-ure of the show.because it enabledmanvfarmerswhocouldnotattend on the show day to study the corn, and learft some of the characteristicsofthesamnles.The score.cards be- ing left with the corn was also a good idea.iItisnonetoosoontPbegin now togetreadyforthenextshow,if we are going to have one.It is none tvo soon to begin to select the seed corn,or if the farmer has no good seed of his own,He should try to find out where he can secure such seed as he wants.Then it is time the rarmer was gettine his land ready for the corn crop if he is going to.succeed in growing good corn,and well matured corn,is necessary both for seed and show corn.Manv farmers feel that itistoosmallathingforthemtotake ten ears of corn to “a little corn show.”Well,it.is not a big thing in itself,but its effect.on the corn crop of the individual farmer,‘andthecommunityas,a ©whole may«notbesosmall.Often farmers say thatitwillnotdotomakesomuchcorn, that prices will not be good,and.thatthereisnomarketforcorn.Toacertain,extent this is true,and will\betrueuntilwegettomaking‘morecorn,There will be a time just *be-tween the point where we supply ourownneedsandwheretheproduction reaches the point where we can use alareeamountofcornforthefeedingoflivestock,that corn may not be aprofitablecron.but if the time shouldieometousin“this section of —theStatewhenweshouldproducealarge eer of corn for the market,weshouldwantthegoodqualityofcorn as well as the quantity;or if the liveistockindustryshoulddeveloptolarge‘wroportions we “should need largeqhantitiesofcorn,and the bétter the ‘fhe Quinine That DoesWotAffect The:Mead |Biyneomo Spots Hott ISBeircr naa catiajoessot¢nears nortiningandd‘taund nervous: mot give a great _{bettercormabowwillbe worth all the trouble it woul * ry:ree eo OREO ge eee,aMR.MILLSAPS TALKS CORN quality the bettet its feeding value JE (Would Have the Iredell Corn’would be.80 there is no n why we shoulddea!of attention to the corn crop,and’as a stimulus to corn production I believe the d be to us;So why not begin now to getiready for a great corn show next year?1 would be glad to/f wee the farmers take the initiative |> themselves,calt-a meeting,and or-/¢ ganize a corn growers’association,|} have a board)of managers,and every farmer work for the corn show.If the 3,000 farmers of the county would |} organize and charge 10 cents each for annual dues,or 25 cents would be better,there would be enough money to rent a store room for the show, pay expenses<of printing,pay -hand- some premiums for the best exhibits,CR ee ae te i n na e tt n e s be.Why would not this be a fine idea? I believe the farmers were proud of the last year’s ‘show,and it was a very poor one,when the quality of corn is considered.I mean the skill inthe selection was poor in the main. Some farmers did well,but as a whole it shows great room for improve- ment.I am not criticising,but calling attention to a fact,and how to getaroundit,All these..points.may.beJearnedand‘they ought to be learned,and I bélieve the corn show is the best place to learn them.”Farmers,what do you think ‘about this proposition?Don’t you think it)a good idea?E.8.MILLSAPS. VISITS’NEGRO —SCHOOLS.|A State Inspector of Negro Schools |% Visits the Iredell Schools. Correspondence of ‘The Landmark.wy Prof.Chas.-H.Moore ofGreensboko,oStateinspectorofnegroschools,has|¥been in the city and county during/ the week visiting in the rural dis-tricts as many of the schools as it Se e 2s CR I T An Opp First Building and Loan.Association if you were INVITED and given an OPPOR- TUNETY to take part:in something that was going to be a BIG FACTOR in determining your HAPPINESS,COMFORT and.eveh-INDE- PENDENT EXISTENCE,wouldn’t you consid- er it an event of your life and foolish not to take advantage of it?Pint Saturday,February 5,the 59th Series of the First Building &Loan Association of States- ville will be opened for new shares,, You ere not only invited but urged to attend,ih this opening and begin systematic saving that will mean HAPPINESS,COMFORT ‘und INDE- PENDENT EXISTENCE.ou ind oa OF STATESVILLE. SPARE ERAREREERE ERODE DESEDSSEDESEOESEDSEESEHHSFEFEE ETT was convenient for,him to do. His work prineipally is to make anoteoftheconditionoftheschool |} buildings,the sanitation surrounding |¥ the premises,the character of the|9 school work,the efficiency of-—the] teachers and the general attitude of |# the pupils.The work in different|¥ counties he ‘visits is conducted in co-|% operation with the local school au-/% thorities.i It is not convenient for Prof.Moore|% to visit and inspect the work of'ev- ery school in Ahe county during this itinerary;-owing-tothe limitation of| time allowed for a_visit,viz.,one week;but he stays long enough to get a general idea of the rural school situation in each county he visits. The first day he came here he spent most of the time in the colored grad- ed ‘schook and observing the work in each room,after which,at the request| of the prineipal,Prof.Foushee,he addressed the .pupils and teachers, who were assembled together for the purpose.seas One of the several rural schools he has visited in company with the|® county industrial suvervisor,Miss}} Mary Charlton,is the Rankinsville m yieeded.Here Prof."Moore spoke to the patrons of the school,| who had been-gathered,and interest- ed them to su¢h:an extent that they|# organized to do their part in co-oper- ating with the county authorities to|% have a new school house by.another|% year.- He also went to Belmont and in-|§ spected the new three-teacher build-|§ ign‘in the course of completion there:|% Prof.Moore says it will be one of the}# best and most conveniently appointed rural school buildings for the colored children in any county in the State|¢ when it is finished.He also address- ed &meeting at Belmont. Friday night,Prof,Moore spoke to)# a mass meeting in the A.M.Zion church’on Centre street,on the sub- ject of education,and Saturday morn- ing he addressed the colored teachers of the county in the graded school building.18 Prof.Moore was appointed to this!§ position of State inspector,etc.,by the|# North Carolina ‘Teachers’Association| (colored).in their annual meeting in : Winston-Salem last June.He is unan-|§ imously endorsed by the State Board of Education,.which maps out his |} work and sends him out into the dif-|§ ferent counties to execute it. He left,here for.Charlotte.where school,where a new building is very|§ Prescriptionists! i RE sma kaki k mo | $LevineYe Our.private Prescription Department is always in charge of a Registered * Druggist of experience.oe ty Two Registered men,ready at all — times to take careof your prescrip-_ a fstionwork.© Each and every "prescription filled ‘ with materials of highest quality only.~ } The Best is none too good for your. wife,your child or yourself. THAT'S WHAT .°& THE STORE OF QUALITY«» GIVES YOU Statesville Drug Comp’ Quality Prescriptionists.~ Lome ys.Pee awa*4 aged or ne yit burg county. MATTERS OF NEWS. Three men were drowned and two others died from exposure when a skiff was capsized by floating cakes of ice:in the Delaware river at Bristol, near Philadelphia,Sunday. Major B.G.McDowell.83 years old, died Saturday at.Bristol.Tenn.He was a native of North Carolina and served in the Confederate army in the Sixty-second North Carolina regi- ment,Secretary of War Garrison told the military committee of the House of |Congress that compulsory,service was the only’really adequate basis upon whieh to’construct a military policy compatible with the idea of democrat- ic government. It is “announced that Col.Roose- velt will start,February 15,on a trip to the West Indies,to he gone until about April 1Ist..Probably the plan he will do similar work in Mecklen-|=== |x|FOR SALE! aires ) farming dwelling, ed by branches and springs. ERNEST G.GAITHER,cis"ANp PHONE 23. 300-acre Alexander County Farm,near school and churches, est railroad station six miles,fronting on both sides of road,soil and location well adapted for fruit,grain.and stockry,eix-roomWellwater+},:150 acres in cultivation,generally, level and productive,balance in woodland which will cut over one hundred thousand feet.of timber.Bargain at $17.00 per acre...- Seventy-eight acres one and one-half miles from Statesville,ad- joining the State Experiment Farm.Forty acres in cultivation,©” level and productive,five of which is branch bottom,balance in. woodland. located for dairy and truck farming, .Over two hundred fruit:trees.two tenant houses,barn and out-buildings. Three-room cottage,small barn,two branches. For further information call on or write, OFFICE NO.1, public ae near-. way until his friends fix up a presi- dential nomination for himi=if they can. Claude-R:Carter,postmaster «at Myrtlewood,Ala.,has,been arrested, ¢harged with.appropriating |govern- ment money...to his own uge,The dmouht ahvolved is said to be $1,620 and he was released under bonds of $2,000.—, Chief Ogallala Fire,who,fought with Sitting Bull in the Custer massa- cre,died at a hospital in Chicago Sun- day,aged 90 years.A week ago,ap- paretitly tired of life,he cut his throat and had been unconscious much of the time since. Invigorating to the Pale and Sickly The Old Standard general strengthening tonic, GROVE'S TASTELESS chill TONIC,drives out Malatia,entiches the blood,builds up the system,+ A.true Tonic,For adultd and children?Gc. No Pythian mestig Thursday is for the colonel’to keep out of the |>—So eecenen W.F.HALL, Huyler’s Candies for Holidays makeeveryonehappy,They aredeliciousandwholesome.— Discriminate when you buyyourCandy---select.at our store. PHONE 20...) ——rR “mn night,Meating,installation of.offi |ing in head.Remember the full namie andlookforthesignatureof1,W,GROVE.2°35 / —ad,x 'cers ‘and.refreshments Friday night., eeeirisWORTHWanepee —<—10.8 ela f Huyler’s ‘sft Rey ayeeeeteeveneveveebes ween eneees HE COMPTROLLER’S INQUIRY. Comptroller of the Currency Wil- Mams certainly asks the bankers some "““sarching”questions about interest “yates.He wants to know if they are charging,directly or indirectly,in violation of law,more than.the legal! rate of interest.The bank that ob- serves the law will not object to fur- nishing the comptroller a bill of par- ‘ticulars.Some of the newspapers have suggested that if the comptrol- ler has the facts to show that any bank has violated the law in the mat- ter of interest rates he should prose- cute and not*talk’so much,“The comp- rtoller has the facts,as his reports! show.He has done everything but call the names of individual banks, He has named the States in which ex- cessive charges are nfide’and’the number of banks making the charg:|¢are dead and the details of many of| It may not’be,and doubtless is!the stirring events have faded from|The ye t Bs cs. not,the comptroller’s tute individual prosecutions. a matter for local officers States.district..attorneys officers.But the comptroller is do-| ing his full dutyin the matter of pub- licity—calling attention to the viola- tion of the law—and pupiicity is about| the best remedy for a public evil;| it may be that the comptroller, n #ethoering the facts.he -is now call-| ing on .the banks to furnish,is pre- pating to go further.| Heretofore many.banks have pro-| ceeded on the idea that they had the| right to do as they pleased in the | matter of interest rates,and as bor- rowers generally felt helpless some} banks proceeded to’do that without | let or hindrance.The country is in-| debted -to:Comptroller Williams for! showing not only the banks but the} people that the banks haven't this| right;and if wrong :practices on the} part.of banks are eliminated,to Mr. Williams the credit will be due. It is not meant that all -banks} charge excessive interest rates,for| by no means all of then:¢o.YPropé- bly.the..banks Who observe the law| exceed those who disrégard_it.But| however that may be,those who do| not obey the law’should be made to}! ,obey it;should be shown that bank-| ers have neither the legal nor moral |, right to evade the law any more Ghani «other folks. And the banks who cnarge ee ive interest rates are by no means| the only sinners in this’particular. Many private individuals who loan | money are guilty of extortion that | would make Shylock ashamed.It is! hoped that the publicity given these matters by Comptroller Williams will result in reaching the Shylocks.\ duiy to insti-| That.is! —-United} The Landmark_heartily, the suggestion of Mr.Millsaps that the Iredell farmers make the corn show an annual-event.The education- _.al value.of these shows,as Mr.Mill- saps points out,is very~great.In -no other way can the farmers,gen: erally speaking,obtain so much prc- ..fical_information_about.the selection of seed—the-first step m corn grow- ing—as well as.facts about cultiva- tion.The fear that too much corn will be grown and the price run down is not as yet well founded.So long as we don't grow.enough corn for our | own needs it must be admitted that the practical and:business course is -to grow more.We can.certainly grow it and sell°it in competition with corn shipped from outside.Further- more,against the day that we grow more than we need and the price drops,we will probably have learned to:dispose of many millions of bush- els in producing heef and pork at a! profit.At any rate,there is no reas-| on at present to fear an corn crop. endorses excessive The plan.of the Texas oF armers’ Union,to ship cotton to Germany and| get around 20 cents net for it,is fine a if it would work.But since both Ger- _many and Great Britain have placed cotton on the contraband list,what’s to prevent Great Britain seizing the cotton,even though it is on Ameri- ¢an-owned ships and under the Amer- ican flag?While we have protested against the placing of cotton on the contraband list,the “ehange the situation;and once that cotton is seized the owners have to take 12 cents—or the usual market price—or take chances of longdelayanddelay(fhint might avail no- thing.However,the Texas Farmers’ Union folks know what they’re about —possibly-—and we wish them suc- zt ‘will begin soon’an in-:fon:‘into the cost of refining eae ceting:cing with a view tier er price “ad- =|tion,”-|Burke’in its list of the “ -|come of over $1,250,” Sy area In a recent REC ,of theProg BUSINESS;PROSPER Farmer,under the head of “ance and Incomes ‘are Escaping ae Country Most.ProsProsperous,But we find that that paper has We Must Prepare f ‘the ty-three{counties in,which no man listed an in-|Slump ‘That Will ComeWewishto}War’s End.correct the Progressive Farmer,for ssivenherit- 00 lwe know thatBurkelistedan income of over $1,-/8 memorandum on business =.|260 with Lister C.8%.McDowell,—transmitted to Prosidént Wilson,pic- Morganton News-Herald. ;Mr.McDowell looks after Federal);nerous state of its history.‘The jpossible to aid.in carrying would |* several income tax returns for Uncle Sam. The Progressive Farmer was talking| about the State income tax law.If several Burke.citizens listed incomes for Federal taxes—and the jncome must be $8,500 to $4,000.to get in the gresive Farmer asserts,listed incomes for State taxes,then the Burke citi- zens are in bad.Perhaps the News- Herald means they listed for both State and Federal income tax,but the records in Burke court house will clear ee up. 'At last a history of North Caro- jina’s part in the gréat”War”Be-) tween the States is to be written. it’s a pity that this important work | has “been deferred so long,until so| }many of the survivors oi the strug- |gle who bore an importarit part in it the memories of the few who Sut the delay is more the j fault of circumstances survive. to dwell 6n that now.What we can and should do is to give all the help to.a snecessful conclusion.is jour duty and privilege,qpenmenerennenpiecencetanncrese Statistics-gathered -by the janee people show that during United States, insur-| 1914 fireworks were responsible for the 40.lives and 1,506 persons injured —an in-Le crease of eight deaths and jed over the figures of the lyear, | lin the loss if 375 injur- preceding |_|‘3 Strange to say,these!figures|. jdo not mention the property lost | |from fires started by fireworks,which! is of course very great,All of wshich| is a strong argument for abandoning |fireworks as a part of holiday cele-| brations.| «The attempt to burn the St.Charles| jhotel property last week—the second|the Lusitania disaster. attempt of the kind on the same| building—-is a very serious matter.| The owners of the property reward of $100 tér evidence.It seems to The Landmark that the town should | also offer a reward,and citizens of! the community could well afford te supplement the offer.Certainly no} effort should be spared to,«mcover alt firebug..The community the merey of a man like that,eT |Another Protest to Great Brit- ain. The UnitedStates has sent to Am- vassador Page at London for presen- tation to the.British foreign office a note vigorously protesting against the British authorities interfering with and censoring mails from the United States to neutral European countries. The note is understood to have.al- ready been delivered to the British foreign office,but its text has not been given out by the State Department. Numerous complaints have been re- ceived from American business men and others that their mails destined to points in’neutral European-coun- tries have been opened by the Brit- ish censor.Steamships.carrying neu- tral mails to and.from the United States have been held up by Brit- ish warships and -takén~—to—British norts,,where practically all mails have been removed by the British au-thorities..The steamships then have been allowed to proceed and the mails detained and examined by the Brit- ish censors.After complete examina- tion the mails have been sent for- ward to their destination.This has| resulted in-much—delay—and—in-some|}instances confiscatio:of correspond-|} ence,f Want-to Quit Bartier:”, Salisbury Post. A former Salisburian, ed with a wholesale liquor shipping house ‘in Richmond,Va.,in conversa- tion with a Salisbury business man,| said that many of the wholesale liq-| juor.dealers of Richmond and some} lother wet towns in that.State had! ened a pettition to be presented to offer a is’at now connect-} ithe Gerieatire of the Old Dominion, jnow in session,asking that body to jvass an.act making vne.prohibition’; ‘law in Virginia operative on May Ist}! lof this year instead of November.Ist, as was voted some months ago.It as said that very few of these houses were making any money and that the ilicense runs out May Ist and many of | them did not care to renew. This sounds strange but it is said to be true;Itis not thought the Leg- islature will act in the matter but will| let the law hecome operative on No- vember ist of this year,as was orig- inally voted. protest doesn’t!Judges Allen and Long Recom-,the plank adopted by the last Demo- mended For Associate Justice. Senaters Overman and Simmons and all the North Carolina Represen-| tatives excent Mr.Dotithton have rec- ommendéd Justice W.R.Allen of the, State Supreme Court for the vacancy on the United States Supreme Court. Mr.Doughton has recommended | Judge BF,Long of Statesville. The President has not indicated| what he will do but’doubt is expressed that he will appoint ‘atNorth Carolin«| ian,caeamenaneneeemeiememeeennneen Gures Old Sores,Other Remedies Won't Core! The worst caves,10 matter of how long otanding, are.cured by.the wonderful,old oreliable Drs) swore.unreasonable, Porter's Antiseptic Heating Oil It relieves |Pair oy)Meals at thy same tite,Bes Oe $1.00,|B citizens of /and conditions In and.State the in-of individuals-and it-is useless |reus-the Midas_among the nations| }+32jfirsney first time in ovr history a aby way of Sweden. jings were planned. ivive the Secretary of Commarea iam tutes the coyntry as in the taegt pros: warn:ing is added,though,that war's ‘infla~ition of commerce will last only until|‘war's end,and that business foresight| falone will prepare the United States for peace. The slump that will follow ‘a war) abroad,the summary declares,must)find Americans ready to take’their|Federal list—and none,as the Pro-ishare of the world’s trade unhamper-| led by provincial notions.False:val-nes created by unusual conditions helfearsmavlulltheUnitedStatesinto a.fancied commercial security, “It is not to be expected,”theBec-| ment will continue in its present form i No one dreams that we can new or in) the future maintain an export’move- ment of more than five billions ac-| al value or that we may sanely-ex-} Tere anc apperent net balance-in our) retary says,“that our business a. |favor on merchandise transactionse:of |},Shred billions in one year.i “Ye is alike impossible and soaie~sirable that these things continue:It} is impossible because the world.has‘inet the power to pay to any one na-| ltion such ¥sums for any long pe-!tod in 1ddition to the waste of wear. havione are not spending their | incomes in our markets.but)their | japltal,and vast it is,there are| |limits to which the continuance of the) sroeesses 36 undesirable,for it Would rast as din oduee a moral overstrain thr Mt|vol be dangerous.“Wo shovld he subiécted shreuach | iaving such oa giant’s strength <to the te mptation to use it like a e@iant.| |Bevery evil that excessive power brings| to-men would ‘threaten us.”} Opportunities for a normal vros-| verity after the war sre ourtined,the Secretary pointing out that the Unit-od States has jumped to first place ameng the nations in.international ‘rade,.t | “Whether we shall remain the} the memorandum.continues,| depends upon the vision and energy! of ¢bankers,manu ‘acturers,mer-, farmers...We have‘for the:sound sys- the work i That ‘Ss and ttem of finance.”a Lusitania Case About Settled—| Germany’s Offer,| Two communications from Germa-ny reached the|United States Friday| -one éontaining a proposal to pay an| indemnity the Americ:lost in| hick ,Tapy bring negotiations on that subjéet:to 1 conclusion,and the other conveying| dissurances that German submarine| aninTnanaees operating in the Me@i-! erranean would not torpedo non-¢om- jbatant ships of any character without} arning he)em and according safety| o their pas ‘s and crews.- 'ions were delivered! Lansing by Count von Ber “the German ambassador. Official Washington considered ‘that America :and Germany at last were aar;a final agreement regarding the cpreiar*¢of submarine warfare. The Lusitania controversy,except | for the-wording of the agreement to!be entered’into,is-considered virtual- ly.ended.Understhe terms‘of the nroposal submitted for the approval »f the United States,Germany,while offering to pay an indemnity,makes the reservation that no admission of wrong-doing thereby—is..involved.It is contended that the Lusitania was ‘sunk as an act of reprisal for the British blockade of termany.. While Secretary Lansing is under- stood not to have indicated to Count von Bernstorfi whether the proposal was satisfactory,it is -generally be- lieved that..an agreement hasbeen practically reached. It was made clear at the State De- partment that the position of the United States in.regard to Americans having a right to travel on merchant ships regardless of whether they were armed for defense had--not—been changed thé slightest.‘ for Plan to Ship Cotton to Germany President H.N.Pope of the Texas Warmers’Union,in Washington last week outlined to Congressmen from the_cotton States.the Union’s pians for shipments of cotton to,Germany He said the cat- ton would be conéentrated at Hous-ton,Texas;thatthe first shin would sail February 1 and that regular sail-3 The cotton would Pope said,in ships own- ed by native-born American citizens and will fly the American flag.The ‘otton has been sold for 27 cents a oound delivered at destination and will net thefarmers about 20 1-2 cents, The market price is avout 12 cents and the British government has been saying that.for cotton.seized..Inas- much as Great Britain.and Germany oth have put éotton on their contra+ and lists,this(latest move-may rer contentions of the.United! against their action. caeneeneiaameminnapheinemnbeninminmianiael ates Can Be Chosen Conventions. It has been generally understoéd that delegates to the Dernocratic na- tional convention tuis year would alll” ihe:elected’in primaries and the calk for the convention leaves that impres-ision.Chairman MeCombs of\the }Democratie national committee says ©shipped, States ’Deleg By leratic national convention with refer- ence to this matter.was slggestive and not mandatory.and applies only ito States that have such provision.injalegalizedprimary.States that have ie legalized primary,or no ee for electing delegates in such prima-ry,will elect by conVention—in theone)way.’pt Whenever You Need a General.Tonic|«Take.Grove’s |“The Old Standard 'Grove’s Tasteless‘chill Tonic is equally valuable as a|General Tonic because it contains the’wel known tonicLAN arma QUINI I It acts on the Liver,Driveadaha,ria;Enriches the Blood Builds up the Whole System,5O.cents,, | || elty Artists, Production, Clean Show. Singers,Dancers,Comedians Mirth,Music and Sunny South.The Big Fun Show!The Laugh Loosener! The Latest Song Favorites and Musical Selections. ,Gostuming,Scenic and Lighting Effects Make this a Gorgeous Excelled by None of itsKind.An Absolutely No Vulgarity.No ‘Coarse Jokes. to Offend Any One. “NOW SEE THE BEST. PRICE AND MINSTRELS! A Superir Organization of All White Performers Acrobats,Musicians and Nov- “Melody.Sweet Songsaf the, Beautiful”dine Nothing YOU HAVE SEEN TaPe Ss Price of Admission 35c.,50c.and 75c. Seats on Sale at Statesville Drug Co._ Shiloh For Henry Gilbert. To the Editor of-The “fandmark? Shiloh township presents L.Gilbert to the Democrats of the county for sheriff.A good neighbor, a good farmer,a good deputy sheriff, and finally a good working Democrat, T believe the county “has had no bet- ter sheriff than he will make. The Democrats of Shiloh township witl greatly appreciate the votes of the Democrats of the other townships for him.SHILOH DEMOCRAT. Statesville,R-6,Jan.10-—ad* Rey.William.Barnes,a Baptist minister for over 60 years,died Sun- day in Asheville,aged:103 years. RELIEVES THE WORST CASES OF CATARRH. Think “Hyomei the Most “Wonderful! Treatment For Catarrh Ever’Dis- covered. Do-not_try-to,cure catarrh by us- ing sprays or lotions;it cannot be cuts} ed in that mamner.‘The only way in which this too common disease can be fully relieved is through a direct ap-' thatplicationtotheaffectedpartsand.will kill the bacilli of eatarrh prevent their growth. Breathing the air of Hyomei is:the only known method of treatment that can really accomplis:this.It,is the simplest,most pleasant and probably the most reliable treatment for ca- tarrh that has ever been discovergd. The comple®,Hyomei outfit is in- expensive and consists of an inhaler, dropper and sufficient Hyomei to last several weeks,.This will effect in- stant relief in ordinary cases,but for chronic and deep-seated cases of ca- tarrh,longer use ‘may be necessary, and then an extra bottle of Hyomei ean be obtained for a trifling sum.It is not alone the best (it’might be called the only)method of treating ecatarth,but it-is also the most vies nomical. The Statesville Drug Co.have:80 much confidence in the power of Hyo- mei to‘relieve catarrh,that they will for a limited time,sell this medicine ‘under their personal guarantee to re- fund the money if the purchaser can say.that it did not benefit. THE WATKINS’BUY “Everything\to Build With”in quantities and sell cheapest.All we ever ask of you,Mr.Builder,is to i“#Buy Where You Gan Buy Cheapest.”Cc.WATKINS,Next to McElwee’s|Planters’Warehouse,Statesyille,N.C. -WANTED! SCRAP BRASS—HeavyBrass7ic.per paren,Light Brass 5c.‘per FOR SALE New and second hand'racktoweforsaleandallkinds’ot boilerroomsupplies.ediAadNoURNER, Henry | Coat and rv 4 ::In order to sell every garment in the house before the\season 1is over,weveal begin this ‘Final Reduction Sale "Wednesday Morning at 9 0dock.0. {All Coats and Suits will be ‘divided tate threelotsforquickselling.’ LOT NO.ONE. Will have some garments paced oueniate.|3 up to $12.50 and $15.00.Special.$5.95 LOTNO.TWO. ‘Will have garments worth double the priceSpecial...$9.= LOT NO.THREE. and more,pee te ee Will include all our better pment rangingupto$35.00.Special .........$13.95. Be sure to see this showing:We Want to. sell every garment in the house this week and you'll make money_by buying now, Nothing charged at sale prices. t Wednesday morning at .o'clock theselling egins.Tee,re -RAMSEY-BOWLES-—°|MORRISON oeieatsBt1vosaaaten to k AA ient of the city electric light depart- {R e e d OR er i e SL ra n g ei t sa n s a ar e s e g n ep ws a b r e r ee s sven esandshand...Sar roonr:supplies=-C,“Hy Turner. ent Everything ‘te build -with.—C.Wat- ew e s ta h t e ph e ag e n ek e se t i S e s te n ee He e } ra n d tg . é Se So et es se A aa ag pi ke a t a e s ee e . “S.Hallyburtonof‘the vicin-yy of Morganton was an out-of-town visitor to the Statesville poultry show ‘a portion of the past week at his,for- firs.LP.Allen,little Miss Pliza-Allen,and Misses Ella and Evie 9 relatives in Salisbury and Dan-;Va.4Mrs,R.F.Northey,who spent a fewdavewithhomepeople,returned Sat-urday to Greenville,8.C.-Mrs,H.A.Scott has returned ‘to Her home at Kannapolis after spend-ing a few days with her parents,Mr.d Mrs.T.L.Steere.+MesdamesA.P.Steele and E.M.“Land spent y in Charlotte:Dr.Plato gham of Lenoir spentSaturdaynight@withStatesvillerela-tives.sieMissMary Colvert returned yester-iy.from a visit to her brother,Mr.J.Clifton Colvert.at Linwood.Ps“.Mr,.Owen W.Leonard is at home_from Kinston to spend a few days.-Mr.ee whe bad been at home for a few.days,left yesterdaafternoonfor.Forest City,Ruther..ford county,wherehe is superintend- ment.He was accompanied by Mrs‘ills and it is their piirpose to make\their home in Forest City.+Misses.Nona and Jett Brawley ofMooresvilleareguestsofMissAltie_Gorpening,Miss Nadine Brawley,who ‘was.here,returned to Mooresville yes-terday.«Mr.W.F,Bailey went to Winston-«Salem yesterday for a brief stay.Miss Mary Rockwell Brumley,whowtsaguestatthehomeofMr.andrs.J.H.ell,Peturned yester-v to her home,in Concord.©‘Rev.and Mrs.L,lL.Moore return-ed Saturday m.Charlotte to theirhomeinTaylorsville,Mr.Moore un-derwent.an operation for appendicitisataCharlottehospitaltwoweeksagoandisrapidlyrecovering.‘Mr.D.L.Millsaps of Damascus,Va.,who had been visiting his moth-er,Mrs.J,C.Millsaps,in Alexandercounty.spent Sunday in —Statesvillewithhisbrother,Mr.E.8.Millsavs, and went to Sharpesburg township yesterday to visit another brother,Mr,C,L.Millsaps.: Voticé:of Néw Advertisements. aJ.°Mo MeKee &Co,’s big ten-day sale begins Friday.; *Reward for evidence to convict for setting fire to St.Charles Hotel.—R.V.Brawley and L.C.Wagner.»Special at the Lyric this week.machinery...and ..boiler By gece +Join the:savings club.—Merchants _&Farmérs’.Bank.»~ »Greater New York Minstrelsat theoperahouseThursdaynight. :n-up coat and suit sale.—Ram-sey-Bowles-Mortison,Ca.%'Gorham’s.sterling.silver—R. ¥.Rickert&SonsAn.opportunity ‘for you.—FirstBuilding&Loan Association.Quality ~prescriptionists.—States-ville’Drug Co.~)The:Statesville Lumber Co.wants7,000,000 feet old field pine lumber,Notice to contractors.—Upper Cod-dle Creek Drainage District.*W.D.Turner.receiver,will ‘sell land Tuesday,February 15.Dry oak wood for sale.—J.D.Foard,Davis Mills,Hiddenite,will nay $1.-40°for wheat and 75c,for corn. »Mest.found,Apply to The Land-mark.‘.*:_----Wood for’stove and heater.Alex. Gaither.ters Fresh milk.’Phone 271 green.Duroc Jersey pigs for sale.—R.M. Good white shelled corn wanted.—Statesville Flour Mills.Additional stock in Star Milling Co. for;sale...”Watch charm lost,—S.R.Brown.Milk cow and organ for sale.—T.J. ,Ayers.'; :Seven car_loads horses,mares and-mules,—Henkel-Craig Live Stock Co. Turnersburg Items. Correspondence of The Lanamark. Turnersburg,Jan.10 —Mr.L.C. :Steéle spent last weex up in Tennes- see.Mr.’G,R.Hendren of Asheville is at home for awhile.Mr.Charlie Somers has been visiting in Salis- bury.:\ “Box-supper at Hebron scnooz house Saturday night. Rey.J..G.«Weatherman filled.his égular appointment at _Hebron lastoe{Sunday morning.:;j We have entered on another.new vear-and how glad we should be and how we should appreciate what the Jord.has done for us it the past year, Pastor Remembered. To the Bditor of The Landmark: ‘We.desire to acknowledge our ob- ligation to the members of Gool Spring Baptist church and friends in the neighborhood for the receipt of various articles of the necessities of life...With:all our hearts we thank ee for the gifts and appreciate the indly.spirit,that prompted them. WEDDING AT DANVILLE. week,‘dore and Franklin Wallace will leave fy.‘Noell ‘Reid of Charlotte spent today for Danville to attend the mar- left Saturday for a visit |marriage. lV.Long.Special guests of the elub ette Kaufman’ Miss Elise Wallace andeMegsrs.Isi- ond Mrs.M.Levy of Laneaster,Pa., will go from here to Danville for the Mr.Edwin Burton.Arey were mar- ried at the home of the bride’s moth- Thursday evening,the ceremony be- is a native of Elmwood community, they return’from their Northern bri- dal trip he and “his bride will make Mire.P.L.Watt Dead at i eet ae Pr‘Miss Kaufman and Mr.Herbert aaah. S|"Hoffmannto “Be Married)or prJan40—Mr |There Tomorrow—Miss Mv-|wattdied at her home in Neal and Mr.Atey Married in|at 4 a.m.yesterday,after a I illness,‘aged 61 years. Salisbury—Social Affairs..ed by her husband,two:sons Messrs.Herbert and Wallace Hoff-|and two daughterss two brothers and mann left yesterday for Danville,Va., where Mr.Herbert Hoffmann will be)place at the Methodist church here at married tomogram ereniney?Miss Ba-| te es en Mr.and |tor,Rev.W.T.Alby ~H.Ho i Carrie Hoff-k mann,Mr.and Mrs.William Wallace,Tan were oo for producg on the local market,Point,Jan,[0 — _Exga,26¢.per dozen, survived one sister. p.m,today,conducted by her highlyrespéct- ed ‘lady.<3 The co-operative creamery at Hick- ofy,which has been very prosperous, riage.Mm and Mrs.H.Clarke and {suffered a loss last year,it is stated, the Misses Clerke of Richmond,Va.,osy destockholders de ying too much for butter fat and preciation of putter stored.The cided to provide for more efficient business .management ievirrncanert and the creamery is expected to.make Miss Florence Edith McNeal .and}good, pound was paid for best grade cotton. _MARKETREPORTS. Btatesville Produce Market.The following ‘prices.were paid yesterday Spring Chickens 1c,tb.‘Turkeys,lobe.per aaHens,We,Ib. Roosters,be.per.Ib. Butter,16a.pet Th.”Beeswax,25¢.per Ib.jGreenHides,11¢,per Ib.lGreen,Hams,1c.to lhe.per Ib,Old Hams 18 to 20c,per Ib. Sides,12¢,per tb.} Shoulders,12 per Ib,Red ityneyy Se.per pound.,fSourwood Honey Comb,16 to 18e.per Tb. :Graix."The following prices were paid yesterday ‘or grain on ‘the local market:Wheat,$1.80 per bushel.Corn,(new),60e.per bushel.Oats,66c.per bushel, Statesville Cotton Market,On the local market yesterday 12¢per Seed cotton,6,20.Cotton seed 65,per bushel. “phe Gist of Ht. fe .:“Last Decet Thad a-v vereer,Mrs.A.L.McNeal,in Salisbury|was eee cite in ted 1 bottles of Chamberlain's Cough Remedy and (ADVERTISEMENTS in this column 10 centsperfine.No ad.taken for less than 25cents.Cash must accompany order.) ing:performed by Rev.Byron Clark,it ne ONS ae days until I was)woop—Cat stove and heater lengths.Prompt D,D.,.pastor of the First Presbyte-Motenif,Weatherby,Mo. rian church of Salisbury.Mr.Arey the value of this remedy,ask any one Who has used it.Obtainable everywhere,Seielahemstrneetinnnmmnpeseintrlersete. if you would know WANTED—Position ‘as.bookkeeper or office this county.and a gon of the late EK.patrea aa ‘ fy Arey”Hechas:been in business in AR eocie will Salisbury for some.years”and when ad.guarantee morrow. please «bring py early.No chdaafter12.o’eloc FOR RENT—Pwo-horse--farm...in...Harmony @ their home there. Mr.and Mrs.John H.@ray gave a dinner party at Hotel Iredell Sunday evening complimentary to ‘Mr.and Mrs.J.H.Hoffmann and their guests. Mrs.Levv’of Lancaster,and Mr.and Mrs.H.Clarke and the Misses Clarke of Richmond.The table was attrac- delivery.‘Phone 893 Black.ALBX. GAITHER.Jan.11-—-4t*. Clerk.Write C.R,,care THE LANDMARK. Jan.7—2t*.‘ High School Distriet.Get possession of barnandlandatonce,dwelling April tst.E.G.GAITHER,Statesville,N.C.;Jan,7--2t.:. HORSES,,MARES AND MULES?-—Just-re- ceived seven car-loads,and have the best as- sorted{lot and more-good Mares and Mules than we have ever had*at any one time, FOR RENT—The Nicholson house on”Bellstreet.DORMAN 'THOMPSON,executor, Jan.7.t Come to sce us at once,as the prices will certainly go higher later, LIVE STOCK CO. HENKEL-CRAIG FOR SALE,OR RENT—Seven ~room house. LOST—Masonic Watch Charm.Liberal _re-r es 3_Pigs,Pp JEXAN@E ; ward for return-to 8,R.BROWN.OR ‘SALE—Pigs,M.P,Al EXANFER & tively decorated —withnarcissus and one..The party numbered an even dozen.is The Blericemoh,club met,Friday afternoon with Mrs.J.F.Kirk at her home on Walnut street.Immigration :se talte FOR SALES-Two lots-on Park Streét.C.8: ferns and the menu was an excellent |pon gaLbe—Extra good Jersey * All modern conveniences,three blocks frompostoffice.R.A.COOPER.Jan.\7,—-2t. BRO.Jan,T—2t. "TOMLIN.Jan,4—8t. with young Calf.TM J.,AYERS,at Federal GINNING WOTICE—For remainder of season FOR SALE—Practically.new Parlor “Organ. 7.J.AYERS,at Federal build- was the club’s study topic for the af- charge of,the programme.assisted bvternoonandMrs.BE.G.Gilmer was in |STOCK—-$5,000 additional shares of .steck in|por SAL aiaca of 58 acres,near teen:N. Star Milling Co.for sale.Apply to STAR Mrs.&.Morrison.Mrs.Kirk served will celebrate “Anniversary Dav”Fri-|’ day of next week with a special social meeting at the home of Mr.and Mrs. .L_---|WANTED—White girls to wait on table,MRS. a salad course and sweets.The club |WANTED—10,000,bushels of good white shell- price.“STATESVILLE FLOUR MILLS.For RENT—Seven-room house Race street, fe of the-members will be invited.FE.Morrison,to which ,the husbands |For SALE—Full-blooded Duroc Jersey Pigs. R.M.HIX,Turnersburg. Entre Nous club Friday afternoon at, her apartment on Center street.The on Lowell by Mrs.’F.F.Steele,an ar- Miss Celeste Henkel and a reading of one of Bryant’s poems by Mrs.Zeb Mrs.B.B.Webb was hostess to they (OR GAip—Dry oak wood,on:J.D.FOARD,B3, vis Mills,Hiddenite,will payliteraryprogrammeincludedapaper|WHEAT—The Da eat and Tic.for corn.Jan THELyricTheatre ‘es ;vs ;ae, ticle on William Cullen,Bryant by |; Landmark office,uf property.and paying for ad.*iShows ouly those Picture pro- were Mrs.E.M.Land of Goldsboro and.the Misses @larke of Richmond. A salad course was served. The-following from.a Carson City. Nev.,paper of recent date is.of in- terast in Statesville: “Little Lois Hackett,age 8,daugh- ter of Mrs.Lois Long Hackett.is a talented little miss.Her recitation at an original poem,her own composi- tion,“and it~was a most clever.bit. The little girl will make her mark in the world beyond a doubt.” A NORTH IREDELL EVENT. es veAWedding anda Serenade— Mr.Casey and Mrs.Jarvis. Correspondence of The Landmark. Jennings,Jan.10 —Mr.W.A.Ca- sey was united in marzrage to Mrs. Della Jarvis.widow of Mr.Wiley Jar- vis.at her home .Wednesday evening at 7.30.Rev.Willie Johnson officiat- ed,inethe presence of a few friends and relatives who had got on to the proceedings.A most delicious sup- per was served immediately after the ceremony.On the following day Mr. Caseysbrought:his bride over in Ire- dell_to-his~pretty~home,located on a beautiful knoll on-the sand-clay road, rand shaded by a pretty grove of young oaks.Here we had the pleas- ure-of meeting the bride-and joining them in a most excellent dinner,which we all enjoyed_verymuch,_While—a few were probably expecting this wedding,it was a surprise to most of the people..We are glad to welcome Mrs.Casey into our community.She is an industrious,intelligent.woman, of splendid qualities and we are sure choice.©We join the hosts:of friends on both sides in wishing them many years of much,happiness.; The serenade—one.of “the biggest | events of this section for a time-——was pulled off Thursday night.The night was dark and cloudy and the weath- er warm,making it an ideal night for| the occasion.The crowd,consisting| of about 75 persons,.met at Mr,Jen- nings’store:Hach man equipped himself with a big pine torch and something with which to make a rack- et.They then marched in double file a quarter of a mile to Mr.Casey’s MILK—Fresh Sweet and Buttermilk for sale. *Phoné 271 Green.J Ceiling,Klooring,Siding, and Window FramesBoxing,Door Material and Mouldings. dar,Cypress and ‘fin Shingles..Nails, Ridge Roll,Valley Tin’and Shingle Se WATKINS,N McEt‘.Cc.,Next to McElwee’s the Presbyterian Christmas tree was Plagtera”Warehouse,Stateaville,IN,6. MORTGAGE SALE BY VIRTUE of powers contained in a mort-B.Alexander and wife, Clemmie Alexander,to James W.Brown,dat- ed the llth of March,A.D.,1913,and re- corded in the office’of Icegistervof Deeds of gage executed by ‘J. the payment of a note of even date with said mortgage,the undersigned amortgagee and..as+|° signee will sell the following described land to the highest bidder, eash,at the Court House door in Statesville, 3,at 12¢o’elock M.,on TUESDAY,FEBRUARY 15,1916, at public outcry, A tract of land lying in Iredell county,Cod- dle Creek township,adjoining the lands of J. .Alexander and others and bounded as fol- lows:Beginning at a dogwood near a spring, Allman’s corner;thence 5.44 degrees W.87 1-4 poles to a pine,Sam.Alexander's corner? thence S.1 degree W.61 poles to a_stonc,Cra- ven’s corner;thence 8.1-dezree W.8 poles to n stake,J.fT.Alexander’s corner;thence 8. degrecs BE.98 poles to a stake in Allman’s ling? thenee N:91-2 deereds W.23 1-2 pol stone in center of the road, 1,89 degrees WAT poles Alman’s corner;thence N.4 »ihe beginning corner,containing aeres-and—33-poles—more—or-tess- JAMES W.BROWN,Mortgagee, MERCHANTS &FARMERS’BANK,Assignee Jan.11,1916.By WaD.TURNER,Recciver, ‘Thomas Wise,in.the popular that Mr.Casey has made a wise| my gin will beerunning only Fridays.and Saturday.Even exchange of meal for seed, Highest cash price paid for cotton and seed. J.T.JENNINGS,Jennings,N.C. Jan,4-—-8t. Pp.WATT,Nov.80. JNO,H.GRAY,Hétel Iredell.Dec.31. veniencea.|MRS.D.A,MILLER.Oct.29.one plock from the coflege.Modern con-T tabledSir Ge P PRODUCTIVENESS. |Have you ever noticed how |worthless and unprofitable to the world generally are idle per- sons?Let everybody go to work and theincreased amount of |productiveness js «marvelous. i "Phe same applies to idle dollars. ;"TH .Take all the idle dollars hoarded dh about the different homes or © ‘@ayried carelessly in the pockets, j place them in the channels of — business and the resuit is mar-, ie me:y ' WY velous.eee Idle money placed-in a strong ~Wf bank not only earns something eed + ’for the owner but it is back in — the game and contributing its _ part to the general prosperity of everybody and everything. Deposit your idle money with this bank and rest easy that it wili be safe and secure. FIRST NATIONAL BAI Statesville,N.C.— .Capital $100,000.Four Per Cont Paid on Time Deposits. U.S.Depository. ductions that have been success- es in the large cities.You don’t know what you are missing if you don’t come here regularly. WE OFFER Today MISS PAULINE FREDERICK IN “LAZA.” . We don’t hesitate to say that you will never see a better Pic- ture than this.For:your ownsakedon’t miss it. (==[== Thursday America’s most beloved actor, stage success,«| “Blue Grass” “Blue Grass”is a story of the race track built around a South- ern gentlemanof theold school. We will pay ‘a reward of $100 for the apprehension and conviction of the per- son or persons setting fire. to our property—the St. pone each man carrying a big torch. @ march was headed by Mr.Jas. Lowe’s and the Weatherman boys’| string bands.The torthlight march,| making:the rainbow bend with we lroad,then going around the house twice,was pretty.They then had an interesting roll call that was amus- played in succession a few pieces, with the bride and groom sitting on the front porch.-As-the sweet strains of music died away some one of thecrowdsteppedforwardandextended the hearty congratulations of thecompany:to the bride and groom andwelcomedthebrideintotnecommuni- MR.AND MRS ©.S.CASHWELL.ty.“The bride and groom:responded 3100 REWARD.$100.-(be readers of this paper will be pleabad to learn that there is at least6eddiseasethatsciencehas wed leto inais:Al's 1positivecurenowknown to thrity,Catarrh 2,«requires a consti- curative powers that.Dollarsfor any|wen aead hat ails to oure.Bend for fist af ‘being a con- with ‘good humor. ‘fhere was-a hu- |morous!bachelor present nn somewitcalledoutthatwewoutaseren-ade him—calling him by name—next li its steges,and that|Christmas eve night.The crowd Catarrh Cure 14 the |then went home. Box Supper at Elmwood School.|; Correspondence of The Landmark. Box supper at Elmwood school Jan- uary 12,beginning at 7 p.m,Proceeds for the school,Public cordially invit-ed to attend.: Constipation and ‘Indigestion. ‘Lhavevused “Chamberlain’s Tableta andmustsaytheyarethebestIhaveeverusedforartindigestion.My wife also+osed™thenr:fortadigestion and:they ‘did het Charles hotel. R.V.Brawley, |L.C.Wagner. Jan,11—2t. ing.Out.went the lights then and | the racket began and lasted for two| rounds.The crowd then assembled in |T front of the house and each band) Mr.Wise will be remembered as} the star in.the stage success, “The Gentleman from Mississip- pi.”If you enjoy a good play, come to see either of:the above Pictures. MUSIC TODAY Sapreme Hams 20 1-2c.pound.Faultless Break-fast Bacon 25c. pound, Eagle Milk.suscelwisescenABO p 20 hs aeons)akselasve Libby’s Condensed ..........9c,|Libby's Potted Meats . Libby’s Evaporated ..........8¢.7 Libby’s Genuine Deviled Libby’s EvapoMtted ..........4c,size,TOF ..sresesceee sees Blue Ridge Corn ..........-.9.|Van Camp’s Tuna Figh,oo Meadow Corn .........8¢.TOR!ocho ecands abuse waeelvet:pcs.eee s phe dees neve cEBC.1g.10,Poeahontas Peas.............17%e.an on x a ig haeStokelyBros,Peas ..........12c.|Kingan’s Potted Meat,...“Libby’s Green Asparagus Tips.22c.|Libby's or Campbell’s Sou Libby's White AsparagusTips.27e.ported <\.sccuavanceee mereNo.8 Tomatoes .....6.+++++++9c.|Baby Mary Cove Oysters .4.) No.3 String:Béans ........5 ile.<es No.3 Hominy .......li.ssse Be,|OLIVES,Eee AND ¢ar oy &No;8 Sour Kraut .........+.,.8¢. Libby’s Rosedale Peaches,25c. Peeled Table Peaches,15ce.size, Pie Peaches,10.s1z¢,for....9c.POECe aes . Libby’s Sliced Pine Apple,20c,Linea Queen’Olives, i 17c.OF.\ ibby’s Grated Pine le;20¢.Tubby's crated Pine AM ite.|.less,2be.sine for cers CANNED FISH AND MEATS.| Libby’s extra fine Red.Salmon,Libby’s sour mix Pic for .Heron Pink ‘Salmon,10c.size,|Libby's prepared mustard, for.ies ;Z Libby’s Genuine Pork Sausage,85c."]Eddy's mustard dressing,16c, ete POR Cia i trees eee eee Pee ee POR er rer erad oe eteLibky's Sliced Bogf,1ée.”size,|Eddy’s mustard dressing,10c.size, Libby’s Slicec Beef,©10c.size,Durkees’salad dressing,80¢,.‘siz CANNED MILK.Libby's Vienna Sausage,10,’siz Norwegian Smoked Sardini CANNED VEGETABLES.American Sardines ...2}.5.+ Lines =Queen Olives,25e: OY vette vee ee ayoeStuffed.Olives,26 OPS antee eens FOP eae nes ees ...12¢,|Libby’s Stuffed Olives,: wee eee ee ee ewe en ee CANNED FRUITS. Bize;fOr ate eee nee a4 ames eee ee gene seleneHiZG)FOF sca vehweeneers aie tieLibby’s large jars sour mix Libby’s Jarge-jars.sweet mb t les,30c.size,for ......8 De.size,FOP.se ey es swieie eve sBEes POR S55 e's ees Se cER eee Alaska Pink Sarmon,‘1c.size,Libby’s Sweet Midgets,”t ECeas Ree cebarecss ore eles FOP ieee eect ences eRe Red Eis he wentea cee Rize,LOK Ls Sv Giwieeeenes TOROS ees tere ve ‘.+-18e.for did ke EE AS 449 Be.fG0G ts aki eee TSS for Poet and Peasant,Selection. Morning,Noon and Night,Over-| ture. William:Tell,Selection. MUSIC THURSDAY. Robin Hood,Selection. Stradella,Overture. Sweethearts,Selection, °® {|.Lyric Theatre. THANKFUL FOR TRADE! I want to thank for their trade all who traded with me this year.In the year which begins tumorrow when you need anything in the way of jewelry,clock or watch repairing,examining of eyes and fitting of glasses,I want you to come to me, R.F.HENRY,-Jeweler.- fi ah nme ISFACTION That's whatJ always tryto‘give.If not satisfied call “again,Time is money.Why not buy yourself some for.1916.Ihavetime from $1.00 up.:BL.B.WOODWARD. “GOODSA "oF f 8.Knight,Wilming- ton,ni SOikataable heeleetieee,ee + Jeweler. “The House of Better Values.”’ *Phone No.229.ee Se neac Dasha |e Sad mneemeneensiegane HOW'S THIS?— Recause we bought before the big ADVANCE is the reason we ‘are ~ going to sell you this car of WIRE FENCE,which has just arrived,=» pve ninisYey aay The Old \ first cockerel,second pullet. lor,city,first cock,first cockerel,first hen and.first pullet. Statesville PoultryShow.son,city,first cock,first hen,first show,R.L.Gill of |pair,best display;John Long,city, in Bhdw,J.D.Cochrane, pest White Orpington, pullet;best Buff Mrs.H.Burke,city,hen; Orpington,A.i L. cock;best White Wyan- -Coulter,Gonnell i ;bdst’Silver Wya rown,‘Troutman,hen; eghorn,-J.RR.Ninniss, sock;best Brown Harbin,city,hen; ~¥.Tharpe,city,hen; s.H.Burke, city,first coek,first hen,best display; J.Paul Leonard,city,second best dis-ton Miller,tity,j play. lfirst buck,second doe;J.Paul Leon- Springs,|ard.city,first doe. Long,city,first buék,first doe. R.O.\der,city,-.first pair, best .White Rock,| best display of rabbits was won by best /John Long,and ,Messrs.Crowson, Rhode Istand Red,W,‘A.|Alexander:and Leonard won the pig- Morganton,cock;rose /eon medals. and Red,Mis e Route 8,pullet; ill,cockerel;best frowson,.city, ‘comb Rhode Asl Payidson,Statesvil' best Asiatic,R.LG pair pigeons,’W.B. White Kings. The $20 cup offere ‘show was won by R.T. bury on,Black La for best male in show, on White Leghorn; ‘Yor best female in sh on White Leghorn; display,Bs A-Morrison, on single comb and Reds:gold mcda cockerel.hen and”pullet ,White Legho est Plymouth RK White Rock hen; ‘bird in Rhode I ‘A.Leslie.Morganton; pird in Wyandotte class, ter,Connelly Springs; pest bird in Asiatic cla Salisbury?’gold Leghorn “class, the New York,New Haven &Hart- ford-railroady-charged by the govern ment with criminal vioratjom of ~the Sherman anti-trust law,were found d for best pen in J.R.Ninniss, ow._J._R.Ninniss for nearly three months has been try- 20 cup for best ;ah NS : $20 cup for S’iNew York.The jury disagreed on ‘ase for 51 hours and at first reportedombRhode.gek,[ease far 5iforbestCocks|inat it could not agree. tk.R.V..Tharpe nouneed that a new trial ‘would be gold medal for best sland.Red class,W. gold medal best disagreed before the ‘eases against six other directors,who are to be tried separately,are taken up. ss,R.L.Gill, J.R.Ninniss,and Frederick F.Brewster.New.Ha- ven,and.Henry K.McHarg,Stam- ad Plymouth Rocks —-.J-ford Conn y i hrane,city,first second cockerels;T.N.Brown,were William Rockefeller,,New York; Charles F.Brooker,Ans6nia,.Conn.; Charles M,Pratt,Brooklyn;Lewis Cass Ledyard,New.York,and Ed- ward D.Robbins,New Haven, fourth and fifth he Sherrill’s Ford, dams,Dunlap.fourth U.§.Poultry },second and nd fifth pullets,first Newton,first hen, fourth pullets; ty.second pen.Pullet.mat- Newton,second fourth pullets; first cockerel;U.8. hert’Robertson, ockerel,second pullet; ‘third hens,first ar October 18-last and it is estimated the government is around three-quar- ters of a million dollars. eoekerel,third a “Poultry Yard rtson,fourth cock- .L.Adams,second pul Plymouth Rocks elly Springs, J,8)Poultry Yards,sec- fourth hen;B.L. &cock.third hen;I B.|of yeggmen that have been cracking ;,Sen : Coulter,Gon South Carolina,and who is charged, th pullet;R.Vi0city,jTharne,city second and third th Rocks —Mrs.Buf Plymou dacity.first .pullet, ode,Island Reds— organton,first cock, "fourth hens,second pen; ds.Charlotte,second cock, nd fourth cockerels. Het,fourth p te 6,third cock, first and fifth hens, rd and fourth pullets, nen:B.L.Sronce;¢l H."Wooten,city,fifth cock, ullet?W.F.Valley,#1;Mrs.W..C. p,third_pen. tv,fourth cock: Wooten,Bethany e Island Reds— Stony Point, ek;"D..Matt.Thompso cBek,first.thind and J and fifth pullets, rton,Morganton, ks,third cockerel.third +Miss Sallie David- Route’8,fifth cock, t,first pen;W. hen;first pulle lie,‘Morganton,.fi ‘Beaver,Apex, tikeleather,city, hite Leghorns —J. mite,first cock,first “seeond.hens,first.and second pen;W.A.Kestier.“sec=y ‘skerel;U.S,“Poultry gbcond and third cockerels.third| nan.fourth and,fifth cockerels: méLi¢ghorns “-R.O.Harbin, and second hens, Brom.first cock.first “Black Langshans —_R. Hiry,first cock,first d second hens, jrd pullets.first pen;J.Paul Ticonatd.city,third hen, laambian Wyandottes — ngg,city,first,cock,first and sec- hens,first,second arid third pul- toilet counter,and prove that hair is as pretty and soft as any— ithat it has been neglected or injured 'by careless treatment.A 25-cent bot- ve will double the beauty,-of your air.: lets.‘ ee Sitter Wyandottes —L.N.Brown Troutthan,first cock,first and second %*ry White Wyandottes —W.B.Coul- Gennelly Springs.first cock,first CCI ltom,first,second and third hens. Blue Orpingtons —-R.L.Reid,elty, Pigeon and Pet Stock Department.° °:ce expedition reacrday,five wee ter leaving New York,The ¢ tion Was taken from Copenhag y.|The Hague White Cochin Bantams —Jo:Tay-|The Hague by rail,goin ough} White King Pigeons —W.B,Crow- Homer Pigeons s—C,8.Alexander, Belgian Hares Sonn Long,city, Flemish Giant’Rabbits -—-John Carneaux Pigeons —C.8.Alexan- Five dollars in gold offered for the LSanseneenetneS Acquitted Six—Failed to Agree on Others.‘ Six of the 11 former directors of not guilty Sunday by ‘the jury that ing the case in ‘the federal court in the five others.The ‘jury had the Counsel for the government —an- asked for the five on-which the jury Those acquitted were D.Newton Barney,Farmington,Conn.;Robert W.Taft,Providence,R.I.;James’8. Hemingway,A.Heaton Robertson Those on whom the jury disagreed The defendants were indicted on February 26,1915.The trial began that the cost to the defendants and Noted Yeggmen May Be tried Here. ;Tom Dowd,alias Tom Price,who is alleged tombe the head of a gang and blowing safes in this State and together with Grady Koontz,now in jail ‘in Winston-Salem,with being Germany on a special train by pei mission of the German government,” A gang of six or seven men were surprised while robbing the postoffige)} at Penn’s Grove,N.J.,with the result second best display.that three of the band are in a hos- pital with bullet wounds and two oth-/1% ers are in jail.Sar |! What is known as the Susan B.Ane, amendment to the consti of the United States,providing for woman suffrage,has been -favoraly) reported by the suffrage committee of the United States Senate.Sa eae |ena e em ; and otherSkin Troubles ——We Guarantee——Hy to stop the itching and begin healing withthe first application or-return your money.There are lots of skin reme~) dies but Saxo is the only one they guare Having \qualitied as\»administrator of -antee like this.Why don’t you try it?we -S.D.Moore,Geseee 5 Deer no- .3G :or naving claims against his es- We Es stl Daveos $as al arent pe to me on ay hefore the TDa |: Doors,Windows;Mantels, umns,Stairways,Locks,Butts implicated in the robbery of.the Mocksville postoffice last year,has| been transferred from Winchester, Va.,to Greensboro jail.Dowd will be tried either at Greensboro or} Statesville.He was indicted in} Statesville at the last term of the Federal,court. Talking to a newspaper man Dowd, who gave his age as 63 years,said he was arrested at the home of_hiswife’s people,five miles out of —Win- chester,Va.,three weeks ago.He had gone there to spend Christmas and had onlybeen there one hour when eight.men came to arrest him.He) rsmiled°as he said “Might men to-ar- rest an old man like me.”f At least eight persons are reported to have beef killed ian explosion at the plant of the Du Pont Powder Co., at Carnéy’s Point,Pa.,Sunday.~ YOU CANT FIND ANY DAN;DRUFF,AND HAIR.STOPSCOMINGOUT! Save Your Hair!Make It Thick,|Wavy,Glossy and Beautiful at Once!Try as you will,after an applica- tion of Danderine,you cannot find a single trace of dandruff or falling hair and your scalp will not itch,but} what will please you most,will be.af-) tera few week’s use,when you sec new hair,fine and downy at first-— yes—jbut really new hair—growing | allover the scalp,A.little.Danderine immediately doubles the beauty of your hair.No} difference how dull,faded,brittle and| scraggym,just.moisten a cloth with! Danderineé and carefully draw —it| through your hair,taking’one small| strand at a time.The effect is im-| mediate and amazing—your hair will| be light,fluffy and wavy,and have an, appearance of abundance;an incom-| parable lustre,softness and luxuri- ance,the beauty and shimmer of true hair health,.‘i Get a 25-cent bottle’of Knowlton’s|drug store or youranderinefromany st pullet;U.S,Poultry Yards, kerel,second pullet:i artridge Wyandottes —W.J.Ma- o tesville Route 4.first cocker-| first and second.pullets; city,second hen. White Orpingtons— Miller,city,first and second }Orpingtons —A.@aville,first cock.first-hen,unk Cornish —J.1". Route 1,first cock,first cockerel,| Phen.fifth pullet Gtesville Route 4,fourth cocker-| d-and fourth ity,.third and fourth.cocker-, d hen,first and second pullets, Wagle,States-| J.GC.MeNee-| ‘Cornish —R.”A.Cooper, second,third and hens;Jas.Ws Wilson,city,first ines —A.L.Starr,,first cockerel,first,sec- ‘useovy —Ducks ~-Stony Point,first drake, eS Tt.Burke,gity,first, ,Heat e 6 to 14Days 11ieetiind imoney if PAZO | WOOD’S Prosperity Seeds. With bright prospects a-head for good prices on Veg-etable and all Faran products,our farmers should feel en-couraged to plant improvedvarietiesofseeds,so as to increasetheircrops. WO0O0D’S VEGETABLE SEEDS;long known for their supe-rior quality and productive- ness,nave greatly increasedin‘demand and popularity WOOD'S GRASS,CLOVER andFARMSEEDSareoftestedger- mination and superior quali-ties.Write for prices. WOOD'S DESCRIPTIVE CATALOGgivesvaluableinformationabout all Seeds for the Farm and Garden. Mailed free on request.” T.W:WOOD &SONS, 'SEEDSMEN,=Richmond,Va. increased by interest. do so at once. Merch ! +. .We are no w in the midst of taking oANNUALINVENTORY. |~Many good values from throughout our " stock are being placed in our January = .Sale at Bargain prices.: |=>MILLS &POSTON.== CaN TANTANTONaN(aN Yours truly, "(aca SIR WW APILT NNTSATANCL NELD?WUDT MOLD SLECTICLE MON 4th ‘day of January,1917,R. Forty-two kinds Moulding,Ready-tate of Mrs.S.Ei Moore,deceased,I hereby Made Door and Window Frames,Col-'|notify all persons having claims against said and |estate to present same to me 4th day of January,1917. R.B.McLaughlin,Att'y. C.WATKINS,Statesville,j-GC.dan,4,1916. :—:#are hy The Backbone w Of a nation’s wealth-is.made up of the sav- ings of the people.To he permanently suc- cessful we must develop the savings habit. DurChristmasSavingsCl Make a deposit each week,or several weeks in advance,and next December you will re- $Ci .}zs ..ceive a check for the entire amount paid in, time,you may open a regular Savings Ac- ~count instead of spending the money. Classes Offeredto.Suit Every Pocketbook. If you have not already joined,come in and The club will be held open several weeks yet for the convenience of those who want to join,and have not found it convenient to do ga. ants &Farmers’“BANK OF STATESVILLE. “The Bank For Your Savings.”; “NOTICE TO CREDITORS. ham’s Ster! B.MeLaurhlin,-Att'y.Administrator.Gorha §er Is all that could be desired.We have it in Knives,Forks and Spoons of all sizes and in sev- eral different designs,at the right prices. have Catalogues and price lists we will be glad CKERT & JEWELERS.; Silver NOTICE TO CREDITORS.sane | Having qualified as administrator of the es- Pi s a on or before the to give you.R.H.RI SON, iver Chi The farmer who uses Genuine Oliver Chilled Plows is one who not only believes: in ‘Preparédness”but backs up his’faith by:his work...The continued tickling .of Mother Earth with Oliver Plows.has brought big bank accounts to hundreds of Iredell county farmers.Are you one of them?If not,now is the time to get on the band wagon.Buy from us and be Yours truly; Plow | ea e If you prefer at that fLazenby-Montgomery Hardware Co. Th Many Instances :TheSeason’sMost Im-- Prices Less Than Half |portant Sale onSuits Johns Clearance — Of all Women’s and Children’s Coats and Coat Suits. Price reductions are greater than ever before.oe ie ag a ey pene eeton-be The Opportunityis Yours. Reduction without thought of value. Many reductions ‘arefar less than half.a One of 12 Big Stores Th for Less |a ho have used Gowansrationinthetreatment ‘re colds,asthma,bron- t ‘troubles,pneumonia,etc.,n praising its many fine quali- ans being more’powerfulismuchreferredforGeta‘bottle of Gow- at n more pre or monta -Ji-O —Taaege haemaernari apaymnpunentnssmoetcnivn tees CROUP WITH GOWANS PAN -AMERICAN ‘POLICY. ans,=rub it on the affected partsghtandnoteimmiediaterelief. DWn't let some unscrupulous dealer put something off on you “just as good,"“Demand Gowans,because Gowans isSampleandtesti-8.sent freeby writing to Gowag Medical Company,Concord,N.C, Ga ©ANS TOLaonUulDU =r MeO rae eon or eeolenente aten The Buick Valve-in-Head ~Motor Delivers Excess.Power ~because it eliminates waste.‘ of power and better yet,no waste of fuel. Christmas.” ;~“QUALITY FIRST.” -The Statesville Realty &Investment Co. a.their insurance will be void under certain conditions hamed in the contract,@f the policy which they buy.We deen:it advisable to mention:eof the causes under which the same will be rendered valuele riz::-1—Vgtant or idle property for longer than 80 days—apply to my your agent for.permit.:i :“féchanics making additions to,or extraordinary altera- -tions in'or on property—always get permits from agents. :8—Property upon which there is a mortgage unless notice of same is given—apply to your agent. *4-Any change in the title or ownership,or interest in proper- ¢ty insured other than by death.: 5—Assignment or transfer of property to another. 6—By:any;increase in the hazard,notice must be given. 7—The taking of other insurance without notice. ,8—Keeping explosives on the premises without permit other than kerosene oil. 9-—-Property encugibered by chattle mortgage. *Policyholders should read lines 7 to 30 of the’printed contract It is impossible for agents to know of these de- ficiencies unless notified.Call on us for any INSURANCE infor-of their policies. _mation.::“WE INSURE ANYTHING INSURABLE.”<§=|-J.F.CARLTON,Manager, *PHONE 54..STATESVILLE,N C. This type motor delivers more power by 10 to 15 per cent, than the L-or T-head types of equal displacement,and affords greater economy of fuel'than either of these*types The impact of each explosion within the cylinders is ap- plied directly against.the piston heads,consequently the entire force of the explosion is utilized.There is no waste As a reminder:“Why not make this an Automobile Statesville Motor Com’y "PHONE 140. ==INSURANCE!== As @ “great many policyholders do not peem to know that er eer nearetn meeereeaseee oe ee THE LANDM ARK {Controller of the Currency Calls sa SoS Banks For Information. «Yssuing a call for the statement of eondition.af national banks.at thesloseof“business December 31,the r i Comptroller of the Currency goes ThePresident Tells What It is—further than at any.previous time to Address to Scientific Congress.jlearn if money is being loaned by The United.States government's metcnal bane zens aah es “4 eps ‘se visuty laws.e asks for a list oPan-American,policy was revealed loans by all banks during 1915,“upon in dethil by President Wilson in anjihich interest was charged or col-| address before the second Pan -Amer-'ectcd.either in the shapeof interest.|f dican Scientific Congress Thursday/4iscount or commission,at rates), wight,He explained the praposals}which would amount wo more than the submitted to South and.Central|sguivalent of 6 per cent.per annum,”{°! American diplomats ‘wy Secretary}“Banks are cautioned,”says the Lansing as a basis for an effective}cell:“to prepare this statement with jmareement between all the republics|care end accuracy.hen this report of the Western Hen spuere,“not only shall have been received,national) \for the international peace of Amer-bank examiners will b@ instructed to ‘ica.but the domestic peace of Ameri-|verify the reports submitted by some| oa?ibanks.and if errors or discrepancies| This progranrme as outlined by the|should be discovered which may seem} |President proposes that all the Amer-j'o make it neeessary in order to se- jiean nations shall take concerted nec youre accuracy to verify the reports| ition as follows:submitted by all banks,the examin-| Juarantee to each other absolute |ere will be given instructions accord- inolitical independence and territorial|ingly.” j integrity.:The.call also asks banks to state Agree to settle all pending boun-whether it is their custom to require Jary disputes as soon as possible,by|0 rowers to carry deposits when lamicable processes,mast loans are granted,how much they are |“Agree to handle all disputes aris-|now loaning fo non-depositors,and line among them by patient.impar-|how much.is loaned and not secured itial investieation and to.settle them by collateral.‘ ‘by arbitration,The aggregate of amounts which |"Agree that no revolutronary expe-borrowers have refused to pay banks dition shalf he —outfitted against or hacause of alleged usury is asked and ‘supplies for revelutionists shipped to also the total payments made by| jneiehboring States.banks as penalties for usury.The call| \The President said tte Monroe doc-|"sks for complete information as to ltpine always had ,been and .always|the connections of officers ‘and direc- lwonld ‘be maintained by the United|tors of any banks in other banks or iStates on its own authority,but that)trost companies,their salaries,lia- ithe doctrine did not.disclose what at-)bility os payers or indorsers and guar-| ltitnde the United States would as}2nto of papers and the amount of lauma towards other nations of the}overdrafts against them. ihemisrhere.and consequently the oth- l=»nations had heen Aistrustful of ite Continuing.the President said: TUESDAY,-.-January 11,1926. | Judge Claytén’s.Plain Talk to Grand Jurors. '*|“Tha Monree doctrine demanded ee ae |merely thet FRurovean --svernments|,An invitation to “hyphenated citi- \whonld not attemnt to extend”their!zens”who put the interests of their Loe ia.wy ie ee ie the |native country before those of Amer- Atlantic,did not disclose the use|...«a ¥oe bsyhichtheUnitedStatesintendedtp|ica to “get off the face of the earth, make of her power ou this side of the |2s issued by United States Judge |Atlantic.“It was a hand held up ak Cae of Apes e.a iwarning.but there was no promise in|¢GY Ores Pe aes poe .ay- “+of thet Ameried Was Point to do jh <r s were made.in-ad¢eae |sith the jmplied and partial protec-ee Es NE \orate which she anoarently was try-|!c¢to resume %e investigation Jnto line to set up on this side of the water the aetivities of German agents in rand I believe you will sustain mein ee eee are te anid Vere an Lhhn etatema at i “You gentlemen,e@ sale are en-ithe statement that.it has been fears ns ae RO re eat dan eeiek end susnicions on this seore which)‘erme ere A .oe eve had che save hitherto prevented the.greater|SU IZens.any ol You NAVE NAG:% lentteanen nnd d eo and tru:_|misfortune to be born in.a_foreign parenee ie See Ne ee be.|eountry,1 hope that you can,truthful- LAmarien have not been.certain what ly oe ian aay ae love aptusrics the United States would do with her|ore 08D the dary ee ae oe fr ower,That dovht must he removed.|vont Seen ee aa etiaee “And latterly there has been a very poring ieake oe criticise Institueservice,le criticise institu- itween the wank interchanze of views between)”1 if lesi 1 1 ;'he authorities in Washineton and),Hans oh 1 ve re.to do ot et "hose who rerxesented ‘the other)Um get o the face of the earth orvobackandfightforthecountryfrom |Statos of this hemisphere,-an inter-|%*h eae ‘change of views charming and hope-|whence he came, GOOD NEWS. ful.because based upon an increas-} ingly sure appreciation of the spirit) ‘in which they were undertaken.These| iz ta come into her own,into her le-|It and Profited Thereby. nitimate-own.in 2 world of neace and avder.she must establish the foun-! |hereafier doubt them.|fad to learn where relief SCHRCHNCH ADACHI EHH H NH IIEHD |“T fione and belicvs that this can |found. BOSON ,he.accomnlished.These conferences g »eet have enabled me ‘o voresee how.it)tne pack j et paten (3 ,e 2 ®would be accomplished.Jt will be ac-|ei seer fs rani ie ae Hi = ,j complished in the first’place by"the|Deoan’s Kidndy Pills.Gur citizens are)@ er l Ca 0 S 0 Cp OS]i sai is ae abanletels volt telling the good news of their experi | :H fics)independence and térrsiorial in-|enée with this tested remedy.Uere|® on ;:‘ogrity.Tn the second place and aS |g an example worth reading:iz ae a Hi,necossarv corollary to that.cuar-|seer ie :Z seer | :;H jantesing”the agreemrnz to stile all).Mrs.C..B.Morrison,789 W.Front! P Issued by this bank bear interest_from H |mandinet boundary disputes among St Statesville;says:“F-tried-in eat: f ‘:themselves should they unhapnily |:thi init ld date at the rate of 4 per cent per’an-Hate cell be bandied by patient.im-|ta Bet Somer Ne eT ee :,Pp P ey re rece snes ee backache and kidney trouble thati; .aad 3 Hi vbitration:at agreeme ces-ol hum.Savings Deposits 4 per cent,$ee to the peace of the Americas,|had bothered my for years,FVinaily,| .'as Hithat no State of either Continent.will|pas,.Pt i d ereditedquarterly,BL pemiihe ecole aary eepeditions|used Doan a ene Pills and they ‘3 Hl scainst another State to be fitted ont made a great improvement.I had ta-|§ -o 4 an.its territory,and-that they -will|ken tj ‘eh pete na 11aCheckingAccountsdontraheGieenpeetodotthemunisOneSheeNeeee Fh ahem ;Hitions of war for the purpgse of sun-|Was in good health and best of all,I ‘:H oe TE ee against neigh:|hayen’t been bothered by my kidneys| <either large or small cordially invited.:“You'see that our thought is.gen-|Since.’-s \§ eae -Hitiemeén.not only the international |Price 50c,at all —dealers.Don’t || We want your business:neace of America.hut the domestic),‘{i ee neace of America,Tf American States |simply ask for a kidney remedy—get|: er :.‘Hinre constantly in ferment,if anv of!poan’s Kidnoy Pills:ehe same that | a oS am ee p tnaishs pcm ceampc i Remi.tie oa iceman water eee taco them.are,constantly in ferment,there |?ne :nas =ss ::\ P 'I oN.d S “4°3 B k Hiwill bea standing threat to their re-,Mrs.Morrison had.’dle sirhade| ,i i (é x eink Rilations with one another.It is just!Gg,Props.,Buffalo,N.Y. i j eop e@ S ail an avings an *\#las much to our interest to assist each|»PSEA deed tabettbae F ;a :Hi other to orderly processes within our} z ;+c Blown borders.as it is to follow orderly}i mS OFFICERS:processes in our controversies with ae :L :one another..These are very ‘practi-r GEO.H.BROWN -President.eal suggestions which have «©sprung)‘: é a ae S up in the minds of.thoughtful men 0.L.TURNER Cashier.and 1 for my part believe.that they| :ioe ere going to lead the way to some-| iG ECACACRCHCROELE thing that America has prayed for for|/ er ere meraa =Se ————————|many a_generation.For they are!|q —:'\based,ir the first place,so far as the, :istrong States are concerned,upon the| ‘9 ie ®‘handsome principle of self-restraint,,6 ::jand respect for the rights of every-| ¥i body.-They are based upon the prin-'om ;i 1 ciples of absolute political equality among the States,equality of.right,| not equality of indulgence.They are) based,in short,upon the'solid,eter-|We have provided well ae nal foundations of.justice and,hu-| manity.{:, “No man can turn away from these)with Flowers for all New ,things without turning away from):*r M A Y 1916 BE the hope of the world.These are,Year functions,and for sy things,ladies ‘and —gentlemen,for |1p : a pty which the world has hoped and waited New Year Gifts for the Su ;eek:;.with prayerful heart.God grant that)'‘ ;es it may be granted to America to lift);young ladies who are “ale ;:ghee ree Y f this light on high for the illumination||Z ti ¢ ao:ae A of the world.”||Ways appreciative of your \f i ‘ear 0 ne Peru,was selected for :vs PP J .;~,the next session of the Pan -.Ameri-i i ;\can Scientific Conese:which meets thoughtfulness an sending a in 1921,the centennial of Peru’s dec-|‘ <3 3 laration of independence.‘The choice|flowers. or # To Our Friends ae a -|PEACE AND PLENTY and Customers. made by the executive committee was. on suggestion of the delegation from Chile;whose chairman,Ambassador Suarez Muiica,is’president of the congress.There was virtually no)op- BadCold Quickly Broken Up: Mrs.Martha Wilcox,Gowanda,*N.Y., writes:“I.-first used.Chamberlain's Cough Remedy about eight years ago.>At that time I had a hard cold and coughed most of the Van Lindley Co, GEEENSBORO,B,9G. :|\e ‘eentlemen have seen that if,America|Be Siatesville Readers Have Heard|g “Good aiews travels fast,”and.the|; ‘dations of amity so that no one will|/Sad back sufferers in Statesville are|s may bel Many-a lame,wenk anl ach-|2 || PAGE. anata arse ee seab anaes SHowtoavol—‘Operatio These Three Women Tell How They ee Escaped the Dreadful Ordeal of |Surgical Operations. compet Hospitals are great and necessary institutions,but thshouldbethelastresortforwomenwhosufferwith ills”peculiar to their sex._Many letters on file in the Pinkham”Laboratory at Lynn,Mags.prove that a great number of — women after they have been recommended to submitto anoperationhavebeenmadewellbyLydia.Pinkham’sVegetableCompound.Here are three such letters.A sick women should read them, Marinette,Wis—“1 went to the doctor and he told me I must have an operation fora female trouble,and.Lhated to have it done as I mi« married only 2 short time.IT would have terrible pains and my hands and feet were ¢old all the time.I took Lydia K.Pinkham’s Vegetable Com- pound and was cured,and I feel better in every way.I give you permission to publish my name Ulli because I am so thankful thab I feel well again.” |—Mrs.Frup Bennxe,Marinette,Wis.-¥ z Detroit,Mich—*When I first took Lydia E. —4 Pinkham’s Vegetable Compound Iwassorun do’ with female troubles that I could not do anything,and our doctor— said I would have to undergo an operation.I could hardly walk without help so when F read about the Vegetable Compound and what it had done for others I thought I would try jt.I got a bottle of Lydia E.Pinkham’s Vegetable Compound and a package of Lydia E. Pinkham’s Sanative Wash and used.them according to directions. "ney helped me and today Lam able to do all my work and Iam well.” —Mrs,Tuos.Dwypr,989 Milwaukee.Ave.,Hast,Detroit,A Belleves,Pa.—*I suffered more than tongue can tell with terrible — Bearing down pains and inflammation.I tried several doctors and they all told me the same story,that I never could get well without an operation and I just dreaded the thought of that.Talso tried a: good many other medicines that were recommended to me and none of them helped me until a friend advised me to give Lydia ham’s Vegetable Compounda trial.The first bottle helped,I kept taking it and now I don’t know what it is to be sick any more and I. am picking up.in weight.Iam 20 years old and woe 145 pounds,' It will bo the greatest pleasure to me if I can have the oppor- tunity to recommend it to any other suffering woman.”—Mis Froeticurr,1923 Manhattan St.North Side,Bellevue,Pa, If you would.like eect advice write to Lydia FE.Pinkham 4 Med,Co.(confidential),Lynn,Mass.Your letter will beopened,© _vead and answeredby ®woman and held in strict confidences_ eta ESN re SPECIAL SALE —_—OF ——Men’s &Women’s Hosiery Men’s ShawKnit 25e.Lisles,all shades,oe SALE PRIC K “"19Ce Women’s 50c.Silks,White only,ae: SALE PRICE “|190, “Women’s 25c.Lisles,Tan andBlack,- SALE PRICE oo QO. SALE PRICES ARE.CASH.——SEE WINDOW DISPLAY-_——’PHONE NO,88.——— SHERRILL-WHITESHO HUNAN MENTTATA UIE:ATT = i Peroterssessy Commercial National Ba OF STATESVILLE,N.C. 33 3 3 3 7 Capital Stock Paid in -$100,000.00. Surplus and Profits -31,500.00 r Members of Federal Reserve System.ON T TT ET VS T VI L E SS S I ee s ee e B Your Banking business solicited and ii every accommodation extended to de-_ k positors consistent with prudent bank- i ing methods.—*Be C He .»Four per cent.paidon time and Savings BS 5 #vis .geeDepositsremainingondepositthree if months or longer. if PDN iia eB hajOFFICERS: iH AsW.D.TURNER,- - -_.~.President, kK.MORRISON,-~~Vice President,—'D.M.AUSLEY,- -<9 Cashier,,@.it.HUGHBY,-Assistaht Cashier. PSSPTT HILT ETIA LATTERTA ATT TIe a A e PLETEATA TTI IT TST Ts WELL BUCKETS,STOVE PIP We havein stock Well Buckets made up in any size,No used about bucket.Any size or weight Stove Pipe made to o1 Also full line in stock. 35 5 5 5 8 5 5 3 3 5 3 5 STATESVILLE:TIN CO.,H.C.Mohler,Manaj ?Pilate ke UM Kil a 114.East me 4 ‘ee :pas *Bi time.It proved to be just what I needed.It Si ne st ta ’Gace broke up the cold in a few days,and the Polk Gray Drug Co ; |tesville Housefurnishing Co.piri aise sitet 1 recive inoush||:” j Uy :°of my.friends of the goo received throug’ me ‘ah ‘FIST Pg MER ES se RO SSN mnnemineaaReE a ate bcge RS ee shaban bei ‘this medicine,and all who have used it :hecal Agents,. ae Sapa ‘Ps seanoh Rabtoiaanat ates :speak pf it in the highest terms.”Obtainable ;{.:(:\oe }§c ‘ ae le 5 *y we aa aa kK ESTE RRMA RTO ERAS ES:it 1 aa ,it ;ie ; eT e 4 on “\\ fae a Ay si +* es eT Lise eet a i ‘ia x ,‘ ::cai oe Te AR E BR EFEB ee Se e ee ea s aee te e ui1 isi :better known every year that Old Field Pine a rial of any. fa.year and select from this only the best for We do not~findit necessary to doa great dealof ‘advertising in order to sell our stock, i as the demands for the kindwe manufacture é are greater than our supply:It is becoming ag rpeliomoal makes the strongest and most durable mate- We handle several million feet All who have used our stock say theworkmanship isthé fmaking iilding material. very best that can be had.Get ourprices. Weare prepared to Sa Aaa ne nectiontahietieneiai ae i Apply to EUGENE”Secretary and Treasurer. pay cash for any quantity,orif you.‘wish — advances on lumber being cut‘we shall be glad to.help you,- 4 Don't sell your timber or lumber to people living elsewhere. Trade.with home folks-who will always give you fair treat- ment and highest market prices.Wewill help you if you will gene fl TO.THE OWNER OF Why.do you sell your timber tosomeone who does not liveiin the county?”Do you not know when,you do this that you are los- ingmoney?You can sell to your neighbor who owns a saw mill for more money,ore | voll can cut your own timber and save what | the other fellow would make.-Wearepre- pared to assist you financially by advancing money on the timber.It will be money in your pockettoseeusbefore making any trades;We do not care to buy standing timber but will assist you by helping to get. everything’out of it.See us before ou sell, ‘a =—— STATESVILLE,N.©.FRIDAY,JANUARY 14,1916. j KILLED CONVICT.STOCKHOLDER |‘MEETINGS.|THEY’RE AFTER HAMMER.|MEXICAN BANDIT MURDER.BRIEF ITEMS.LOC cNeill,a Negro State|Annual Meetings of Sharehold-|Randolph Citizens,Through Ma-|Negr a Score of Americans|Mob Killed Negro.Who Had}—a box supper at ct,Met Death When He}.ers of .Banks,Cotton Mills!rion Butler,Ask the Removal Slaughtered in Mexico—Sharp|'Confessed Murder ‘and Rob-|schoo!house Saturday night, mpted to Escape.”~and Other Corporations.of the District Attorney.Demand on Carranza Govern-|_bery,—Dr.J,.F.Carlton has:re 1 McNeill,colored,aged about|Tuesday was annual _stockholders’}.In a\Jetter:addressed to the Pres-ment.:A dispatch tothe daily .papers pointed notary public for ee ; re,a momber of the force of{meeting day for all naitneal banks ident ‘and accompanied by a petition!Nineteen persons,all or nearly all/Says that about 100 men,riding in au-||Mr,Jno,8.White,who has. pre 2 re h las!‘awk alleged to be signed by 1,500 or more]Americans,who were en route.trom tomobiles and ‘armed and disguised,|laid up with the la:grippe : .conviets at work on the States-|'oe out.¢Pana:aie and the]citizens of Randolph county,former|Chihuahua City,Mexico,to reopen took John Richards,a negro,’from|days,is improving,and will ir Line-taitroad,was ‘shot and i eae ete inate so Rotates Marion,M.Butler tine baked paines at a point in the State of Chi-Golashors Shi Toseday |rian and|out.a hts 1y.evenin wy 5 ,pipe §met.ac-lthat the President remove United|/huahua,Mexico,were massacred |'ynehed him.=Bichards.een ar-|—Regular mon meeting of,the mae Shy meee fer ‘pitts ‘8 f evar iooueans States District Attorney W.C.Ham-|Monday by Mexican‘bandits,supposed |tested for the murder and robbery of|Iredell Teachers’Aaenclation:at the. Sai the th “ren neh SOR a ed wr GE 1915 5 ¢gt mer from office because of miscon-|to be Villa supporters.Anderson T,Gurley,a Wayne county|college tomorrow morning,at 11._ -oe inggro:made a break fo Fehler cheat:oc deeiiak iniprove.gust in ofiites cosa Pablo Lopez,a Yaqui.chief,andfaxnter,and had conteaned.The mob o'clock.UH ts cde da coroner’s inquest was hel i readies ‘ove-|Washington dispatches to State pa-|General Reyna,two Villa.generals,|tcok him to a river bridge where the].__4.ai - Puesdey-night about Whidnigh€and |ponkers vlng-the-pastfewmonte the [pers Say it is charged im the petition fed the men who”assassinated’“the body-of his victim .was found,bang,pcccin ak leita slteeeon eae che jury found that the guard was en fbi ids had’ch 8 a fee th that Mr.Hammer,among other things,}American miners,near Santa Yse-ed him.to-a tree and riddled his:body}man High Rana see ;5 g tude.of business has changed for the|;cfused.to:prosecute cases of alleged|bel,Mexico,and-the.massacre was]With bullets.Pid High School.»”CAN justifiable in shooting the convict.near,ne pe 4 election frauds in Randolph eounty|committed close in the wake of a Car-Richards’confession implicated os il ss 2 Ped oe |MeNeill was a member of a squad ti ce the Fi “ee TB wi ae Ae when.brought to his official attention |ranza troop train,according to infor-three other negroes,twoaf whom,|,.")ne Geri Wear ager abet of ‘convicts which had been at.work ee .aa Na aA we me land that Hammerhimself helped to|mation of the affair gathered at El|Ben Coley and Isham Smith,were in]iy,i.pies y :take ienigh MiAMeE TM.‘dpe At'a point about’a 0 _nh on =ty Somat nerpetrate the alleged election frauds.|Paso,Texas.Statements made by J.|the jail at the time,but thesé men stents hae buriat:to Davie mile from the camp,which is.located Se ak °to Tike ieatnean ?Delamber The petition asks that Mr.Hammer|Gaudelupe Gardena,conductor of a the mob,at.the request of Deputy y y 70 tan Deora Torch cf Hacracly,Mr.ats oesbs a Wee eae the be removed from office.and that any|train-bearing the Americans,and Sheriff Toler,left in their cells.Since —Gov.Craig has ‘a Roper had lined up the men twolsame d iad algae Pel iy go other action be taken that will secure|Thomas B.Holmes,the only survivor making his confession Richards had|B8,Armfield a delegate to the | GRcamne anid.started.then’dn.the a7 eee ee ee a8 Sain of |the “ends of justice,:of the American party,indicate that|showed signs of insanity,feigned or|tional Drainage ‘Congress,to march to the camp,when McNeill,ac-|tent.in Sivittends oe J td a ie Mr.Butler’s letter to the President |the murder.of the United States cit-real,and it is alleged that.he made at Cairo,HL,January.19-21.rs cording to Mr.Roper’s.statement,a eit x f $100000 anak 12 168.33 was says that there is attached to.thelizens was.deliberate.another confession before being put to}—Mr.J,M:Oakley,night.miller at; broke,from the ranks)and made ‘a ray ‘a the nidivided:profits:“lcharges and specifications affidavits)"Conductor “Gardena,in an affislavit death,in which he again implicated]the Statesville Flour Mill,has dash for the woods.Mr.Roper tcsti-of Th Sr encldard racclectad "ha:fal:and other evidence sunportive there-|given.to the British consul at Chi-|others.caer [his family to Statesvile from Re fied nt the coroner’s hearing that he |jowi e haart ne hire tbe Me Roc Adele and on the face of the transcript|huahua,said that the train bearing]“When the mob arrived at the jail|ville.They are occupying a house called on the negro to halt after he ee hn z Oa WT Kincaid.oan memorandum of all the:~papers|the Americans was stopped by a de-|the jailer told them he did not havejeast Bell street.cet : Pea ot daw tome bie the conviet.did pina Saat nr Rs te ae submitted,*y..1.7.{railed train in a cut.This train is the keys to the cells,A few of their]__1p to January 1st 9,086 bales of foe atneken tia pest.Ac ti convict Briste "TD Miller .7 Si a a There are five charges,which re-|said to have been a part of the equip-|number were sent to the home of ‘Dep-cotton were ginned in.Le : aiieretra thicket «heaide the:road Bane Lie i ee ee late..to alleged practice of fraud in|ment bearing Carranza troops.The uty Sheriff Toler,who was called out)oq with 9,615 on same: cher iibt:fact from tie “wuard tne i as es ea ane connection with the election of No-}conductor said that Gen.Reyna held and forced to accompany themto the year..In Alexander coun latter fired ra him’with*e shot,gun|t.he we st sd Mr ree on Beet aa vember 3,1914,and ‘alleged.non-per-|the trainmen under guard while the|jail.When Toler and his custodians|}ales were ginned.compared.with ““Joaded with ‘buckshot and‘the negro md Me Mill Bae s Oraaidenk:a t formance of duty,as ‘district attorney-|Americans were robhed and shot dead.|arrived at the jail the mob had broken|¢9g on the same date last year. fell to the ground.Mr.Roper halted Toh OW.Gh oe work Be ng ne It is claimed that Hammer counseled}Details,obtained were te-the effect the locks from the cells and had],The Statesville Bar Associa the other convicta and held them.un-aati ,aka,O:ry ta ee ‘ing jand advised voters and officers ofjelec-|that a score of Mexican.armed men the three negroes in charge.Finding ata ‘meeting ‘called seid thar sen dem dnver at his gun until:Messrs,C aeath ¢Mt -a Pe ment since’“tne ytion in Richland township,Randolph attacked the train which was bear-them deaf to his entreaties to!respect Manilad -avents rt :eelctin : Br cet wan cad Will Jurnegs peaulenis inty lected ‘coehiete.Mecmiaeneeiarames mci and violate their|ing the mining men to mines owned|the law,the deputy told the mob that}|On&Y PuiiGs Pamsel&ogPea ~of the-eommunity,;-who-were a short a Ae kh a atid:“3 eral hook:city by"whieh voters’were prevented |by the estate of Potter Palmer.of|there was grave doubt of the aon’,Bf ciate Justice of the UnitedStates 8a-" distance away and had been attracted and -LB "Ror a)ndivid iit BOOKS front-votingat the election for a Bepsigiicage.‘There were some 200 oth-Bolts and Coley and they.woke ety reme Court.The ‘resolution by the sHot,reached the scene.Exam:soot ead “iw romain RE oa sTresentative in Congress and deprived er bandits grouped as-a-reservestorce;while—Richards..was taken.The y t to Coy eae “Doll Renee ination revealed that McNeill was feted oa aoe e the cht eta Hi of their privilege as clectors”;that/along the right of way of the rail-)Screams of the prisoners at the jail Washington.gressman ghton ete eine teow killed instantly.A inued in charge of the collection de-the)took possession of ballot boxes]road.eee aroused a part of the eommunity.|/"A501 :ea at : 4 ber .ofeat had enteredhis left partment.unlawfully,that he failed to perform|—-The dend ‘bodies of the murdered The mob had taken the license tags|.—Mr.J.H.‘Thdmpson,wh sehouldes and.back and Ma pe heon-ons |e i Rerhorc :‘ij his official duty—that he failed to]men were expected to reach El Paso,|and numbers from the automobiles in|been assistant postmasterat — z et he back of in Si r_two en-|"The stockholders of the-Commercia prosecute persons and that he miscon-|Texas,Wednesday night or yesterday.|which they rode,-but in their haste|Wilkesboro since.1913,has_resij .tered the bac 8 National”Bank"also—heard—good-re=|iycted himself by official action to-|'There was much indignation at Ei Pa-|one machine was left in the jail yard,|andwill become manager of theMi The convict’s,body was taken to the}ports of the past year’s business,the]ward Facey IP t ;ane rae |Dod)i f st year's business,ard a grand.juror,‘3 a which may be the means of identifying |Grocery Co,at that place.Mr, camp and Sheriff Deaton and Coroner /annual statement showing,the total!:Sib et eeuie tee SE ne ia some of the party.eee a at pine ottona,{Sea RENE A .}son is a native of the Mt,Mourn -W.A.Moose were notified’later in the|resources-of the bank at the-close of |Mr.Heritage Named to Succeed ye _ep /BO!et :oe e avening.Mr.Moose,accompanied by|the year*to be $613,583.01,compared]fr,Barringer.:Mexico.In Congress Wednesday there|The murder and robbery of Mr.|toin of this county but has lived ::rae ik A Re So DE f ;were heated speeches In both:houses,|Gurley was a brutal crime and as soon|North Wilkesboro for many years.Hi vaputy Sherif “White and Mr.J.Rl with $585,772.21,a year ago,an in-|a+.meeting of the board of direc-|mainly by Republicans seeking to turn|as the negroes were arrested there|was in business there’prior to Alexander,left Statesville by auto-|crease of $27,810.80.The usual 8 per g Yr ee ;:.Meee mobile about 10 o’clock,reaching the bent,in dividends was paid during the |tors of the Iredell Telephone Compa-the ‘incident to ‘partisan advantage,bay ep a of trucking.tbe a ing:AESEUeraNE BORTTAN AR vf camp before midnight,and the in-year on the $100,000 ‘capital stock and|"¥,Tuesday night,Mr.KE.0,Herit-eed ere WAR Pang clamor for inter-eet aera The teil eat to a matter of information The. quest was held as suon as the witness-|the undivided profits were substantial-|°F°Was elected secretary.and:gente:“s neat ry of S Lansi ith}:fed ona night but was left Lander 28 anne tne es and jurors could be summoned.|ly increased.The bank begins the al manager to succeed Mr.W.M.|,Secretary of State Lansing,with)guarc ay nig)ft)weather has beenvery warm for Mr.Roper and Messrs.Johnson ahd|new car with improved conditions |Barringer..__Mr.Heritage,who was|the approval of President Wilson,dis-|unguarded Tuesday night.Gov.Craig}yary and this warm,damp wes Jurney were the only witnesses exam-|and en prospects.:“Jan applicant for the,place,was for-patched to Consul Silliman at Quere-|is naturally much disturbed about the not good for health.We are pre ined,and they told the story of the|Director sf the C ‘cial Na-|merly in charge of the local office of |taro,Mexico,for presentation to Gen-lynching and says ‘every effort will be|relief today from the h : ined,an ¥Leg POR tQEs.AG”SOMAMOTCIAL,sxe Ad ae}i eral Carranza,a note denouncing the|made to punish the lynchers.The ef-|more’relief than’. shooting.as given above.The coro-|tionla Bank were re-elected as follows:the Bell company and is now in the )¢ral “arranza,at a.:by bo f than’we ner’s jury,composed of Messrs.J.R.)W.D.Turner.E.Morrison,©.M.|¢mploy of the Bell.While he is not|Slayitg of Americans ,and calling|forts,however,judging the future by|way of a ‘cold wave,Many Alexander,H.GC.Hunter,W.L.Chesh-|Steele,N.B Mills,W.F.Hall,J.E.|2 town and has not been heard from|upon,the head‘of the de facto govern-|the past,willbefruitless.*c}waves promised us ire,Red.Harbin,H.Ot Sate ed A (aire SW Arle Kusley {since he»was elected,he is expected|ment for the immediate pursuit,cap-Committee of Cangress Invited |t®appear,but:this’ “i Ac Turner,rendered the following |C,g..Poston.Mr.Turne,rwas re-elect-|t,necept the place.an eume aoe DURBAN Of Cie:DRE PeA "|—An item in the W *Yerdict:“We the.undersigned—ju-ed president,Mr.Morrison vice presi-The board decided it would be}tors of the deed.“The“note urged the to Inspect Our Cotton Mills.respondence of day's. rors,find from the evidence that Ad-|dent,Mr.Ausley nashier,CG;-—2g,||Wise to separate the.offices of secre-|sending of troops to other districts}ror gome days.hearings have been|Observer says je.Comptrolier am MeNeill came to his death from’Hughey —assistant cashier,Frank |{ary and,treasurer and create the of-wrens Aa peas ganger of los-|in progress before the labor com-|Currency announces “among ‘ap “gun shot wounds from a,gun in the!Armfield bookkeeper.Mr.Clyde Walk-fice of treasurer,simply as a busi-ies oe ives +er oer De mittee ofthe House of Cangress on|als of resetve agents the Com: “hands of--C.—E.Roper,and—that_the|er was elected a-bookkeeper-to-suc-|7°88 proposition in handling the busi-B same Tne We Ora -|what_is-known as the Keating child}National.Bank of.Statesville.”~ anid C.BE.Roper was justifiable injceed Mr.Krider Wood,who has gone})"S*and Mr..H.P.Griér,the pres-|partment ordered an investigation:of |}anor bill—a bill designed to pre-|is-an error,.As Statesvilleis ve ino him.”alejs :1¢|«dent of the company,was recommend-|the murders with a view of determin-‘the shi in inter-State|Federal it d:there: ooting him.to Raleigh.Wa i vent’the shipment in in e reserve city—and.there: McNeill was from Wilmington and a ed for treasurer.This change is rec-|ing whether ,they resulted from the!ommerce of goods manufactured by|Federal reserve city in NorthCa “was serving a 15-year term “for at-}The annual meeting of the stock-ommended with the distinct under-|failure of the dé facto government]child Jabor.Several North Carolin-|lina—a bankhere;could notbe “tempted-rape.He had served less;holders of the Bloomfeld—Manufac-standing that the salary.of the sec-alpha Pea sed in &Zon’|ans have testified before the com-jreserve agent.scp hae CEES than-three years of his term.His|turing Co.was held Tuesday.The re-tetary and genete paseagee ars the qwhethed tne men.fost their lives as|mittee and one of these,S.F.Patter-|'—-Mr.and Mrs.Irvin Steele ©of. body was brought to.Statesville Wed-|port of the secretary and treasurer reasurer sha not exceed,the:Salary|eee a ealt-of 2 bandit outbreak.[20%head of the Roanoke Rapids Statesvillewill,forthe present at: “yiesday and prepared for burial,-Un-|made tothe meeting.showed a good paid Mr.Barringer,who was secre-Thi eon iat th .b -ae a ;; _°der instructions from Raleigh receiv-|business the past year and the mill is|tary,treasurer |and general manager.y ich cou d not oe een foreseen.visit and inspect the North Carolina ing with Mr,W. ed vesterday.it was shipped last night!now in a flourishing céndition,running |All this is Subject to the approval of [Instructions to seek information:0n}ootton-mills.“Hie said:Steele;who is manager of* ;v.eed eel See eae »TUNNINE |9 stockholders_at_the annual _meet-|this point-were telegraphed to con-|"ay tnvit and vt raat anager to Chapel Hill,where,it is assumed,it\day and night.Six per cent.was paid}:Ben te hate the 25th sular representatives in Mexico and now invite each and every mem-}Bros.planing «mill and lumber t will be used for.dissecting purposes|in dividends during the past year and ing to be held on the 2oth.ae ees ‘ber of this committee to visit the cot-|negs .at’Mocksville,had been d i ,.se ‘‘director:4 along the border.,:rte ‘edical school.a 4 pre cent.3 vas declar The ‘directors ordered:the payment}OF .-\ton.mills of North Carolina as the : .ie ioe ie oe Hyde county Tuceday ie cn Fase of a semi-annual dividend of 4 per In the note to General,Carranza the th ing his time between StatesvilleseegetfiguestoftheSouthernCottonManu-|Mocksville,’and he and Mrs.°S' x ¢>s rst jo ’\$42 ..53 .W) and has been in the aE Cyivf the future.Messrs.N.B.ae E,Nor cent.we vase pe Eee RN en ae ee eas fac ney their home with his unel State.as aj.convict guard tor —She WwW ae ee Aus He Neath of Mrs.J..K.Goodman—|ted in territory.announecd to be_in trip will Rok eat te sake veyou;hor +P.Bincaid;on Davie avenve Oh nuiser of convicts have escaped|Yount,I.0.Steele snd A.P.Barron|Other Deaths.control of orem forces.Thelthe government,a single penny:In|Not the Man.PANG ae Wiens / from the Air Line camp.during the]were ‘e-clocted directors.and the di-|Mrs.V.Pinkney Bost was found men ee il we oe Carranza fact,I urge you to make this trip.80]p,;ite ft Nex ee ‘past year or two,and in most cases|rcctorsinturn re-elected Mr_—Mitts dead_in bed,last Saturday-mornings|¥#sinformed,eS theyhi :hey.were)many false—statement—have been }in5 Chi rite:"Okara ee the guards fired at the escaping con-|nresident,Mr.Ausley vice president,at her home near Newton.Mrs.Bost|Americans,aft h he Se ae ‘made about cotton mill people that I “p sla h Pat red?Mantle cvlets.Rifles:were used,however,and|Mr.Yount seeretary and treasvrer|as in her 58d_year and is.survived the weeny wr the a of the)ind all other cotton ‘manufacturers,A fires £whe:ae wtih th urice. vn every instance heretofore the con-land W.L.Saunders superintendent.{by her husband and six children,She|Catranza.military,authorities:would be delighted to have the com-|s nGerson,Who was th the revent #icts.hed covered so-much distance A Ss was the mother of Mr.Will Bost of The representative of Gen.Carran-|nittee see for itself that the condi~aieDowd of"of Charlotte efore the guards fired that they es-|The stockholdets of the Stateaville Troutmat,this ‘county,and of Mrs.{7*oe the Car red_Secre-|+iong in the cottonmills are as good!on 1d had -he art ed injury.he convicts are not/Loan &.Trust Co.,in session Tues-Ola Orders of Mooresville.,_|tary Lansing .at tho oon Pek as anywhere else ‘in the United ol ted today 7 OK. #hackled and have equal chances with|day,re-elected directors as follows:The 14-months-old daughter of Mr.ernment ‘deeply he Villa f the wo 8"!States.””Maurie ‘And tay on.: “ho puards in the matter of a-race.|W ’D.Turner,F.Morrison;D. M.|97d Mrs.J.M.Smith of Chambers-tardiy action of the.Villa,torces hat Mr.Patterson said the committee];Ooi *vill beds pidloea killed? it Gaither.of the convict camp,|Ausloy,C.M.Stécle..W.F Halt--J.{pure township.died:Tuvsday and was|{illing_the Americans and says 19%!could select.the mills they desired$0 han the aera erm Oe “says he and his guards have instruc-B.Armficld,N.B.Mills.Mr.Tur-|Puried Wednesday -at-Amity.efficient action will be taken to bring};epect,that their arrival would be that b left an ete eee tions to fire on-escaping—prisoners ner-is-president;_Mr.—Morrison Mrs.Lizzie Hall.Goodman,wife of|the murderers to,justice.”=|kepta:secret so that no preparation sla is section for whenever necessary.president,Mr.-Ausley secretary and Mr.John K..Goodman,died sudden-Statesville Team Plays in Bad could be made for the visit.~~ea Musics (A iieres ce Be lrensurer and W.E.Webb manager of |ly yesterday morning about 2 o’clock|””oe The committee todk no action on the|44 revenue office atNewton when Mi MATTERS OF NEWS.insurance department.at her Kame at Mt.Ulla,She had|Luck..invitation at the time but some of the:Me ue ney been in failing health for’some time.|The Statesville basketball team is|members seemed disposed.to’accept 16 re eee dene b Gen.Huerta.the former.Mexican]The Statesville Grocery Company She hihi a 60 p vents at el is hoving eee me ed yt trip ue the invitation.a of Dr.T..E.and Sea!&OPO ie ho has been in the Amer-|Mek ars.“An's al session Tugs-|Survived by her husband and __five|week.t was defeated in Greensboro ;ed .TOE.ant ee Gre dap.at £1 Paso,Teéx-ifcicknolders,In,aynual session EB.children.Mt.Goodman is a brother of}Tuesday night:by a score of 59 to 24,Seriously Hurt By‘a Fall From Geo.Anderson,He has been dead thesecradorks;1 ten years—a victim of tubercjane‘ously ill.RB FT,Cow z_{Mr.Geo.C.Goodman of Mooresville.|and lost again at Elon College Wed-|-.a Tree.o ,wet alias oe a epee of Craven cotnty vy sey ee ino e Miss Mary Abernethy,whose death nesday Ment by &score of ae XO i B,F.Cauble,16-year-old son of Lee ae et nas cn Arrested for the murder of |Fowler and W.M.Barringer.The di-at her home in Shiloh township was|The result of last night’s game atl vir.W.OF.Cauble,fell from a tree in Aeersadihedtcomain’a tanibate vee .sls nad -e-clected -Mr.Bar-mentioned in Te Landmark a week|Chapel Hill is not known.The de-‘7 ri t ees eae atances ee une Shiner eunident a ee ago,was 74 years old instead of.81,|/feats are attributed to the fact that the woods near his home at Cleveland Baby Accidentally Shot—W:und: :ae :i ca .ioe /|Wednesday afternoon and_sustained ae ae E..Sumpter.an employe of the president,Mr.:Watts sécertary and)|?8 Was reported t.The:handmgen,the ae Cou saereatiaet ye a rather severe injury.He was hunt-Probably Fatal ‘i 7:oe,anni vaaitreasurer.The company enjoyed al gq ::——=|sence of Coach Etheridge 2 ing squirrels and climbed a tree to Katherine,the two-and-a-half-year, uumber Co.at Lenoir,.was)°"sae ee 15 +4 trai Steele,J.B.Armfield,W.W..Turner.|star playerg who could not make the ;old daughter of Mr..and Mrs..A.. |the belting of the plant yes-soe dyes gat ae a ia be its iG;Gaither and W.Ty Kincaid of |trip.Mr.Mitchell Orr,wno was una-|#et to a squirrel den.“When a a Blount,of Barium was-shot and prob- md instantly killed.nsual dividend January St and Begins)statesville,C.L.and.Samuel Turner|ble to leay@ with the team Tuesday to 18 feet from the ground he fell an ably fatally wounded Tuesday af thie na yeak.-WIE file.DrORDEGEE:of Monbo and J.H:Pitts-of Catawba|on account of ‘illness,joined it at Seen tae he Seiad Chae.he noon.The baby “girl and her bheDarpenatigarletpeeandeoChapelHillyesterday,could not stand on,his feet,his lower oe Bred ;about sae.yeare,: eg of the.University offon beardcatinae Wedn soe org Gaither of Mocksville were elected|Date “Changed For Mr.Me-este er apparent?ae Ted a of then got hold ate pale. nnsyivania,at Philadelphia.Fait Gag TaEtiug full he and taditional members.of the board.W.|--Laughlin—Rev.Hugh —Black ‘een eon it oie Medical Ae them pot hold of 9 -22-caliber Mrs,Foy Lamar.wifeof a young |the prospects for a good year's busi-7.7 ets rhe re ON mata Wednesday Evening.tention.Yesterday he was brought woick had been left See farmer of.the vicinity of Eufala,Ala.,ness are considered fine.Directors ruenar Stan suree Ww.A Cefoert cee-|On account of conflicting dates,the|to the Sanatorium for treatment,Tt |ner o “room,“Cs]ae anda bride of a week,was helping |wore re-electéd as follows:N.By Mills,|yo Podnev W.Turner assistant|2Ppointment for Mr.R.B.Mclaugh-|was feared that his spine was injured,phlei he me Pie i . Se eee dente when sherp,M.Ausioy,A.P..Steele,E.Morti-|secretary,J.L.‘Turner superintend-lin,who was to discuss “The Charm of |but X-ray.pictures made at the Sane-IANS th iad oe i ether was killed by the accidental discharge|son.C.L.Poston and W.T,Kineaid|("°°hes "nd-|watuve’in Shearer hall this evening,|torium disclosed no serious injury to vee A a eh er xipiday ! “of ‘the weapon,of Statesville,H,Clarke of Richmond,;Si has been,changed to the 28th.the pine and no.broken.bones.The|disc!nt ‘Me ae eing una A storm and severo.cold weather in|.W.Brawley of Mooresville and W.|I’annual session Wednesday.the|Rev.Hugh.Black of New York is|condition of:his.limbs'is due to the ik explains e ball passed¢ ‘Middle’West.the past few days|D.McLelland of Stony "Point.Mr.|stockholders of the Statesville Furni-the next appointment for the ‘Chau-|shock of the fall.Immediate improve-t rough the baby’s.body:and one “resulted in much damage.At{Morrison was’“re-elected president,|iure Co.re-elected the ‘following|tauqua,Winter Course.He will ap-|ment and final,recovery is expected.att penetrated.bon he shee His station,near Nashville,Mr.Steele vice presideht,Mr.Mills|}card of directors;L.C.Wagner,A.|pear,In’~Shearer hall Wednesday|_,ei (at tas acca but the chances i Wednesday,a cyclone:destroy-|seeretary-and,treasurer..and_—T,__M.}p__Barron,RB,-MeLaughlin,-D,J.evening and his subject.will be,“See-Church News.ik _Npemainast |er Recovery,ves . timber of houses and four per-|Crowell superintendent,_“y |Williams.P.F;Laugenour,J.G.Shelsting America Through Scotch Spec-|‘Services at Front Street Presbyte-|Catawba Man Buys F TAT segment =em y :ca edt Spt a :.u aa ré-injured.he annual meeting of the stock-ton and W.A,Thomas.The-directors'|tacles rian-church Sunday morning at .If in Olin. holders of the Turrer Mills Co.ofBastMonbo~Was held in the assemblyroomoftheCommercialNaiional Bank.Wednesday afternoon,a ma-jority of the stock heing represented. abi cotton mill,invited the committee to|make.their home in Mi A F, 7 o>Hudent*was killed and six oth-in the annual bow!fighthe_freshmen and sopho-The stockholders of the Paola Cot- re-elected.Mr.Thomas.président,Mr.Wie Maeraves o'clock.Following.the service a ‘cén-vO McLaughlin vice president,My.Shel-A Runaway Marr sage.wregational meeting will be held .to||The R,.R.Reid.place in Olin, ton secretary and treasurer.The com-|,Miss Lucy Wilson and “Mr.Robertjhear the report of a committee ‘ap-|ship,containing 881.acres, pany had a prosperous,year and paid |Eliott,a Bloomfield couple,eloped|pointed to recommend -a-pastor -and|Wednesday ‘by Mr.R.V. f Judge ¢10 percent,dividend)The pompeny to Nowe last.pay en to take sh ee as the congrega-|Mr,%esRgovine of.Ca Hon.Wi D.Turner is one of the at-ete np actories are ‘being opyrated over|and Were married.ey left on_the/tion may .desire.ship:for,$11,000° totneys in the case,:Sonne:bee Me apres aencions time-—all,day_and a ‘portion of the/afternoon train and when Mr,Dock|At a meeting of the officers of the!pects to occupy the ‘The Enterprise says the Moores-|officors ahowed.remulia Neto.wate eg 4 thelr wibacens he bad a sey oficer Me)eh eit Wes decided to eal oe aitonded’the ee:a a cars she §were}ae ‘ir arture,da ayvevening it was deci oO call’)bu ite::bopare hg Daushters of the |considered’very.reasonable,and indi-|The Statesville Realty &Invest-|telephone Newton ote op the|nesting of the Ten of the congrega-|he oe ffspro vee W_Confer ;secured admission|cations for successful business ‘this|ment Company “the of will hold|marriage on the.ground that.his|tion,to be held at the churchStay awley has 5 “he tomporary order.restrainingthécommissionersofAlexandercoun-ty.from issuing $150,000 of roadbondswillcomeupforahearingbe- fore Judge Cline at Hickory today. to the Soldiers’Home for William L.|year are reported fine.A 6 per cent.|their meetin F }ic¢ie a |yenr ¢x ent.|th ting at the offi¢e of the com-|daughter was less than 18 years \of|afternoon at 3 .o’¢esat patti har eee Soe nt cease meyalie i a ut aneaees even The Henkel-|age.~officers located amy -pair a}buildin be atnday echo!room All eo.the Jo. ont,at Sta POR aera st and 3 per cent,Octo-|Craig Live Stoc pany meeting |few minutes after they had been mar-|men of the congregati ged to}went of town, rogiment,at Statesville,.'.»Tber Ist.Messrs,W..D.Turner,C..M.lis also’scheduled fy Tuesday..."ried by a Newtoll,wibniated,tend.‘ee en Are et sehen we x *&j /bi Ae Ser)»;f ‘7 * Spd:NEO: 4 + bee wet ganehinOs 16./is sold for iy purposes =|remainder is for.news.— **Ifor sale is TheLandmark's.santas posed trade. :ladies‘business ‘but theirs;or at a has”demonstratedDamountnecriticism‘will ,of adorning them- to be he and theaewisehaslearnedaethy« mae weies il keeps his core about their‘style of dress. d ,however,there has been papers about men wear- wrist watches,the talk being in the lighter-vein.This was so much of an innovation,as it is not a cus- Recen ‘tom for men to wear anything on their wrists except handcuffs on oc- casion,that,it.was not supposed that a ,except a few of the jionable who are called men them:from.those.who. x were.‘really wearing wrist watches.But there are indica- tions that the custom may become fairly common.‘Ona train the other day a Landmark man observed amale passenger throw his hands to the back ‘of his head,.and there,in full view,was a wrist watch..There was nothing about the wearer to distin- guish him from others except the Sri ‘watch;that'is,he did not seem to he of the ultra-fashionable sort. ‘The Landmark doesn’t keep:in ‘close touch with the styles and more men may have been wearing wrist watches than it supposed.But this was the first view of one. The growth among our people of thehabit of sav ing,laying aside part| of one’s earnings—is mostly 'gratify- ing-and the banks are encouraging the practice by boosting it.The build-} ing and loan associations were the! first to encourage this sav ings habit ,_-in the South..-Their help is mainly | through making-loans and-the service =they render in this way cannot be es- seme~---timated.Any.community without-2 ~~ous associations.and...through eno ~~done,-b-but_hewas misinformed. building and loan association.is badly behind.Statesville has two proeer their help hundreds of people have been|' able to own homes and other proper-they could not have owned withoutthishelp.Then the banks added sav-ings departments,encouraging small deposits on:which interest is pa id.All the Statesville bants have-~sav- ings departments and the yearly de-posits in these are considerable.Re-cently the Christmas savings clublanis-being featured.and 4t has ted the savings habit materially. The idea of-beginning,the first of the year,to save money to .spend.atChristmasappealstomanywhowould not save otherwise;and the habit once begun,the accumulation appeals to many,by no means all the money is apart,at Christmas and the savingshabitgrows.The Statesville bankthathasthisfeature—the Merchants&Farmers’—put on the plan two ‘yéars”ago.The second year the Amount of the savings—$10,300— as twice the amount of first year and it will be larger this year.Savingencouragesthrift,industry,and onceoneacquiresthehabitheisontheroadtoindependence. A letter fromSaher Ney McNeelv,‘the American consul who lost his life~4n the destruction of the Persia,writ-4en-from-London to-his-mother,wasreceivedbyMrs.McNeely at her--home in Union a few days ago.TheiletterwaswrittenDecember18,and ‘and destroyers “all the way,”and thatthetripwouldbeabsolutelysafe..Mr. McNeely was of course writing what‘he understood and believed would be On | As the merchant sells goods, or the manufacturer his product,for 9 sgene pay expan and get pay|% work,so.does a newspaper|nsceeforits,product-—the printedsheetandacertainamountofadver-tising space therein—for the samepurpose.To giveaway copies of thepaperoradvertisingspace,is taking that much money out of the publish- er’s_pocket,This is preliminary to sayitig thatTheLandmarkcannotsurrenderitsspacetotheboostingofcandidates. It is news to say that.John Jones orJimJohnsonarecandidatesforcer-tain offices or expect to be;and any citizen can suggest,without cost, anybody for office.It is alsopermis- sible to say incidentally,in’a news communication,that a certain candi- date or candidates are favored,but this must be’confined to a few lines. Any article purely boosting any par- ticular candidate for office.must be}, onid:for.at.advertising rates,-This{ essary’in.self-defence.So far there are a dozen or 15 announced candi- dates for office.in Iredell.If a friend of one writes to the paper boosting him,friends of each of ine other can- didates for the*same office will ‘feel called on to do the same.Itis obvious that this would take a great deal of space and impose a——burden_on_The Landmark it does not feel called on to bear.In other words.the paper can- not see that it owes it to these can- didates,to their friends or the public to give its space—-which is money to it—simnly to boost individuals for of- fice.“The Landmerk has been too iliberal in this respect in the past,butthefact’that it has allowed itself to be imposed on heretofore does —vot |warrant the continuance of the prac- ;tice.Any discussion of vrineiples in eon- nection with candidates.-—anything ithat pertains to.the public welfare rather than to the fortunes of indi- vidual candidates—will not only be vrinted without cost but is invited: and candidates.who-feel that they ihave been misrepresented will be al- jlewed Mriited space yn which to set) |themselves straight.But purely | soosting articles for avowed candi-{ Aigo must pay ad.razes.f Senate Report Denounces Roose-| velt.| Washington Dispatch." Charges circulated during the last| session of Congress that administra- foreign business firms in urging the | passage of the government ship pur-) “hase bill were held to be baseless in} majority and minority reports filed! by the Senate committee appainted to, investizate ithem 3oth reports also found.the shipping interests blame- less of illegal activity in opposition to! the measure.The majority denounced Theodore Roosevelt for failing to appear before | the committee to testify concerning| his published assertion that President|Wilson andSecretary Bryan “haden-| deavored in the intarest of certain for-4 sign business firms to secure for the| the interned ships of one of the bel-' ligerents.”The charge,the report said,had its origin in that “ungener-ous trait of the human mind which} makes it pronéto attribute unworthy| motives ‘to redoubtable rivals and par- tieularly nolitical antagonists.” “The writer,”added the report,| culated to give weirht/to his utter- ances,finding himselfwzinout any ha-| sis,even of a hearsay character,for sthis”slanderous attack upon the high-|*° et oficer—of—his-government,simply+ esorted to.a palpable sophistry to} fecnos the responsibility for the as-! sertion he had made.”| ‘the 80th of Decemberthe “Persia_went Would Be _Ashamed-ef-the Fear: sto the bottom.;Up to this hour the information re-Ceived icf this country—so far asiblie—has—failed to discloseoeor‘what sunk the Persia,The“gurvivors say they sdw no submarine.‘One report ‘was that some of them saw the “wake of a torpedo,”but];is_not stressed.The report made iy Mr.Grant,the American surviv- ‘er,says 4g terrific explosion.occur- The.saloon became filled withoke,broken glass and steam frommeboiler,which appeared to haverst.”In the present state-of af-feirs any vessel sunk at sea by anSxplosion_is either torpedoed,struck by.a mine or destroyed by a secret_@nemy who has placed a bomb.onrd.or .something like that.Inesofpeaceanunexplainedexplos-ionwould be a oe poard the Persia¢tributed to a defectiveSoll‘iceteam boilers sometimse ex-lode ee some unknown cause.ey are as likely to explode.in timeofwarasintimeofpeace;the Per-Bia may have been wrecked by’thesionofadefectiveboilerandneithersubmarinenorminemaybeaefault—but nobody in this countryWwould-believe it,even if you couldveittothem.But don’t say ThekbelievestinePersia’wasretebytheexplosionofadefec-1 veudeiler,It hasn’t said that be-it déesn’t know what the causeItispointingoutthattheex-:ee eal have Reeuls from aveboiler.oiler exploded,Wecording to ‘a gufeivor,and nobodmnen‘vi Big ‘Wage increase, »Because of the prosperous condi-attending the steel andiron trade,finance committee of the Unitedtrendcorporation,acting on‘ecommendation of the.heads.ofubsidiarycompanies,has decided botxe Me de of a on al per.cent,the ad-to,take effect ey 1.Theeeaffectthe|.Jha ‘¢orporation’s|Banoo mer and willualpayrolbyaboutigtoestimatesby~ee +especially.the: ve F,Hal,Drugsist,Statesville,N.Ch of Dumping. Persons who predict destruction of| American industry ,through the | “dumpinge”’—of—eheap—foreign-made} goods after the European war,were| described as “pessimistic-prophets of; evil by Secretary Danicis‘or the Navy,! in a svecch-in-New York at the annu- al-banqnet of the -society—of automo-+ bile engineers. “T would be ashamed,”he said,“to| believe:that,with a large portion of} the European workers killed in battle. and more maimed and crippled,Amer-| ican able-bodied men trembled for} fear they would be ruined by such competition when the war ends.And; I would he more ashamed if I did not) believe that the American gover n-| ment could be depended upon sn any | such remote emergency to preserve | American commerce from.any unfair! practices of other nations,following| the war,without the necessity of re-| turning to a tariff.system enacted for| the fat-fryers.” Safety Cans For Gasoline. Commissioner?ofInsurance Young| is taking steps tos impress upon users| of gasoline in North Carolina the im- portance of having safety cans to'con-| tain the fluid.”These cans,he ‘says,| in order to carry lowest insurance; rates.must be-of approved pattern.| The Insurance Department is’in-po-} sition to.supply-a full list of the man-|ufacturers,of safety cans that have.the official ‘approval of the Under-| writers’Laboratories of Chicago.He, i8 anxious for merchants of the State,| hardware—dealers,to}arrange to supply cans of approved | patterns.| |VIRGINIA GIRL Gained 15 Pounds By Taking Vinol Norfolk,Va.—‘‘I buffered from ner-‘vousness,had no apneat and was verythin.Nothing Ltook seemed to helpm until one daya friend told me about inal ve now taken six bottles ikLes “gainedfifteen pounds:haveaEpes oescan hasanee:Art| a,Norfolk | Vinol is adelicious cod liver and iron|tonié withoutoil,a constitutional remedyfoeanappetite,aids eyMakespurehealthy‘blood, is not only.legitimate;but-itvis-neempo-s |fifty-cent ||stomach right. tion officials acted in the interest of |b Uinited States the power to purchas¢/ ieox line; |poles to stake in C.least 220+poles to stake; ito bexinni ng,containing 110 acres mere or; “whose eminence was naturally cal-|tees bethe favored thepyeoe‘undmileydrawpayfromtheFederal,ment,which would requireserveintheregulararmyin tirwar.He also proposed ae PreeorganizationsofhedarmBhiuptowarstrength,which,he.would fornielh the ‘number.ofthoughtnecessarybySecrerisonwithoutanylarge,nda on”erofficersorincrease’of,overhead!char :iWhiletheoppositio::of the chair-|man of the committee is disquieting,|it is intimated that the friends of theadministrationmeasurewillcontend| for it,on the ground that no partisan: question is involved.|tend for.it,on the erpund:‘that no’!partisan question is war!nidd.ae Germs:Wouldn’t Stay. amen oat eseeaEEverything. They say raw.onions make,3 Hine’i tonic.Well,why not?If it is true’that germs beset us,where is there alself-respecting germ that would”stay,on.the job amid the fumes gf raw on-! ions if.he could get away? NC INDIGESTION,GAS,OR & STOMACH MISERY IN’ FIVE MINUTES!. “Pape’s Diapepsin”.For Sour, Acid Stomach, Dyspepsia. Time it!In:five minutes ach distress will go.No indigestion, heartburn,sourness or belching”of gas,acid,or eructations of undigest-§ ed-food,no.dizziness,bloating,foul breath or headache.Pape’s Diapepsin is noted-fox: speed in regulating upset stommele:It is the surest,quickest and most:cer- tain indigestion remedy in-the whole world,’and besides it is harmless. Millicns of men and women now eat: their favorite foods without |fear— they know Pape’s Diapepsin will’gave them from any stomach misery-—..... Please,for your sake,get a largeeaseofPape’s _Digpepsin from any drug store and put your Don’t keep on being |miserable—life is too short—you are not here long,so make your stay agreeable.Eat what you like and di- Henin the stomach. Pape’s Diapepsin belongs in “your home anyway.Should one of the fam- ily cat something which don’t agree iwith them,or-in case of an attack of indigestion,dyspepsia, gastr itis or stomach derangement at “daytinte or during the night,it is handy to give ithe quickest,surest relief known. SALE OF of Iredell county,rendered in the proceeding entitled R.B.-McbLaughlin,gdministrator of A.J.Bass vs.C.S.Bass and others,I will sell at publig auction_to the highest bicders, jat the court “house dgor in Statesville,N.C., on SATURDAY,JANUARY 22,1916, at 12 o'clock,-m.,the following lands ine Chambersburg tow aship.towit lst.Beginning at a white oak in the Haith-{ thence west 158 poles-to a dosWOnad C.Barringer’s corner;thencé west 62 potes| ta stake,Bar rringer "s line;thence south 80) Barringer’s line;thence} thence north 80 poles pting 1 1-2 acres conveyed to trus-) h M.E.chureh,South.sinning at white oak,Hoover's line,|pf Lot Ko.3,it being Bass cor-} t S.§8 1-2 degrees east 160 poles| ke,Lentz line;thence S.39 1-2 poles to p,corner of Lat_No.6;thence north 38 degrees west,118 poles to stake,S.Hoov-!}ers torner;thence —with—his—tine—north “45 degrees west to the beginning,containing ba xeres more or less. 3d.Beginning at black oak,near ernearesan \ vu corner,thence south 29 poles toFreeze’s corner;thence south 88 1-2 degjeast194—poles—to—pine;—Lentz's tine;theiiee | inorth 29 poles to stake,Hoover's corner;; ;thence north 88 1-2.degrees yest 194 poles to! |bexinninn,containing 35 acres:more or less!4th..Beginning at a hickory,S.Hoover's|corner in Bass line;thence south 45 degreeseast46—potes—to—white—onk;corner Lot No. 4 and Eidson lot;thence south 88 12 dee! grees cast 160 poles,fo stake;thence.noyth;131 poles to stake,corner lot No.2;thenee!north 88 1-2 degrees west 194°poles fo be-/ sinning,containing 34 acres more or less,’=Beginning ‘at a stone in’Hugh:‘Pler’s line;thehee east 130 7 5 ‘thence south 836 1-2 poles to stone; west 130 poles to stone;thence north ¢ poles to beginning,containing 387 1-2 ner,|more or less.6th.Beginning at a stone,W..BP.Morton's |corner;thence with his and Bass’‘line north|5 degrees east 20 poles to stone,J.C.Plyler's!corner;thence with Plyler’s line north 87 de-} aeeee west 60 poles to stene in his_line and W.D.Plyler’s corner;thence with line be-; (tween J.C.and W.D.Plyler south 35 poles;to stone;thence with W.D.Plyler’s line! south 86 degrees -east.5 3-4 poles to stone,his corner;thence with-W.P.Morton's line north | 28 degrees east 6 poles to stump,Morton's|corner;thence with his line north 84 de-| grees east,60 poles to beginning,containing |10 acres mere or less. Terms—One-third cash;one-thirdandone-third in twelve months. R.B.McLAUGHLIN, Commissioner.| EXECUTOR’S NOTICE. Having qualified xs exeeutor of Phyllis |Trexler,decéxsed,this is to notify all ners |sons having ciims azainst the-estate to pre=|tsent-same to me on or “before Detcmber 21, 1916,or this notice will be plead in bar of | their recovery.All persons indebted to said;‘estate-will.please make settlement.J.C.FOWLER,Executor. THE BEST COAL) It is time you‘are ordering.your fuel-for-winter.The best-coat for general use is our celebrated: Genuine Jelico Powhatan Blue Gem Pennsylvania Anthracite ‘Run of Mine Steam Coal, We also handle Oak and PineWood,and do all kinds of hauling: oe household goods a special- Holland Bros, Depot *Phone No.7:Rostdence "Phone No.310Bloc, iLDING? in six. Dee.21,1916; “Dre,21,1915. “6.WATRINA: iS Heartburn, all stom-'f ober i rest it;enjoy-il..without dread of re-g VALUABLE LANDS.§ is By virtue of a deerree of the Superior Caurt | b.ee e ee e ae em e r ar e >For sale’by.all toaltra y Members paying Members paying week,fixed,! Members ing 5c.each w eek for 50 weeks,get If so come in and’join now. week,fixed,5ine $25.00 a Goan pet'$50.00 starting with 5c.and increas-$63.79 You may do so now,and eet an evenstart with those who.have already joined,AM that is necessaryto dois tocomeinandmakethe‘payment due up to this date,|: Tojoin this club shows ‘good judgment,andthat you be.toa to the thrifty dass,who want to save at least a-part of their earnings,instead of spending it all. “Tvs Not What-You-Make--But-W.hat- You Save That Counts. The members of our.Christmas Club saved over $10,000 Jast year,and the indications are that the members of the 1916club will save over twicethis amount, NOW DON'T YOU WANT TO BE AMONG THIS NUMBER? We offer thefollowing classes: Members starting with $2.50 and de- creasing 5c,for 30 woe,get eee $63.15 : Members starting with 2c.-and increas:~920.00 Members \carting sewith ‘$1.00 and de-for6)wach getso DO a0 ing 2c.each week for 50 weeks,get... i “THE MERCHANTS-&FARMERS’BANK Of Statesville.’ SANK FOR YOUR SAVINGS.” DCEO,REE RES5 ‘Dan Valley - DAN VALLEY is-milled from the celebrated wheat grown in the Shenandoah Valley of Vir- ginia.IT HAS NO EQUAL. Makes better bread and more of itto the pound than other flour.It is economy to buy “DAN VALLEY.TRY IT. Carz__C._Boshamer, Local RecentPhone125Black.It.aw. WE buy in car lots: WE sell in anv quantity. WE sell the celebrated Gold Medal Fiour, WEsell Sweet feed for Horses and MulesWEsellSweet Daisy Feed for Cows.-WE sell Hay,Corn,Oats:and Cotton Seed Products.WE SELL FOR LESS. WE pay CASH for courtry Corn and Oats.WE deliver in the city.IREDELL FEED CO., C.D.MOORE,Prop. ’PhoneNo.88.-114 E.Brow St. The Flour of Quality. 3 top!Look!Listen!| Ww ANTED!' SCRAP BRASS—Heavy Brass 74c.per pound,Light Brass 5c.perpound‘Stage ogFORSALE: New and second hand machineryforsaleandallkindsof-boiler C.H.TURNER. Iredell "Phone No.74,Bell No.7. “DANGER”CROUP ani PNEUMONIA| Come like a tiiief in the night and seizeupontheinfaitchild.Be prepared to savethefgofyourlittleonebyhavingabot-"‘tle ofBrame's Vapo-Mentha Sate barwappreape19)\rsensscamna thCroupand.etm ||HasPrice25c.,aie und $1.00, on receipt of “pri meres wae"0!ce,oa MEDICINEiinactorsyN.i room supplies..Ve “Go to Texas via Cotton Belt’|Route—the only line oper- Mating solid trains ithoutchangeMemphistoTexas. ‘Two trains daily:through coaches, chair cars and electric lighted sleep- ers.Diningcar service.No change of cars,either coaches or sleepers. “Trains omthe Southéast connect at Memphis‘with these Cotton Belt _through trains to Texas.. Winter Tourist Fares daily to many —places—in—Texas,_Lo isiana—-and--New| Mexico. Stopovers>Longreturn:limit oo May 31,1916. Il Year Tourist Fares daily to certain bi ints in Texas.90 day limit.Stopovers. \Makeatrip to Texas now! Scc what fine farm dated un rdSendtodayforfreeiustratedbookabout:,_Texas,and get full information about low.“fares from your town ond Texas via Memphis«and the Cotton Belt:Route. Rey:HH.SUTTON,Dict.Passenger Agent.109W.BS.Chatennr Te Ma e r Te e G The farmer sib uses Genuine Oliver ~Chilled Plowsis one who not onlybelieves in Eee STERNER,but backs up his faith rby his work.The continued tickling of Mother Earth with Oliver.Plows has brought big bank accounts to hundreds of Iredell county farmers. ‘them?_If not,now is the ime to get on the band wagon.Buy A us and be |Yours muy Are you one of poisIie pecs familyeh ld nentonthand all thechildrenfeeladose,andodthasanyn ve a spell of sick-ily,tnewe commented anyefor a y eepee muutee.Te.sick 'scolic,eenausea, =plomachcanike been tn constant use for moreadenaoehasbenefitedmoreionpeople, ae oe sells and recommendsPriceonly25c.Get a N.C,128 —’{Don’t Forget To includea can of ourGoldMedalCoffeein your nextorder,You will like it.A fresh shipment just in.We eee 2SsO ZEC Beans,Peas,etc. —’PHONE.89— ‘had_heen..seen..near.his.home......The: From joreville.try rain No,28 ar.10700;leaves 10:40 aTrainNo.15 ar.6:40,leaves 7 ~P.Noa,28 oonts24are not Scared toDeath. More than a year ago W.D.Tyson, na m. m. m. an.aged colored man of Asheville.wasiassaultedand.robbed by one}HicksWhitmire.a negro.itmire:got»ayearontheroadsandafew.days agohistermexpired.Old Man Tyson had’expressed a fear that Whitmirewoulddohimbodilyharmwhenhegotoffthechaingang.Tyson,livedaloneandwassickinbed,last ‘week,when .a woman told him Whitmire old man was badly frightened anddiedinashorttime—doubtless scar-ed to death.It is a pitiable case. SWAMP-ROOT SAVESKIDNEYSUFFERERS. You naturally feel secure when youknowthatDr.Kilmer’s Swamp-Root,the ‘great kidney,liver’and‘‘bladder remedy,is absolutely pure ahd con-tains no harmful or,habit producing drugs. The ‘same standard of .,purity,strength and excellence,prescribed by Dr.Kilmer many.years 2go,is main-tained.in every bottle’of aeamp-Root,Swamp-Root....is,selentifically com- helper -—in-relieving and=.overcomingKidney,liver and bladder troubles. |Eagle i‘.‘Milholland, BLACKSMITHING : SEE LINEBERGER for anythinginBlacksmithline.Horse shoeing(No.{3 and smaller)60c.;No.4 70c. is Shoprear of McElwee's Planters’q ouse.er ——!|CANNED GOODS. a Subscriptio ns ‘String Beans.ee EG ee Corn.{fe ADakensto-all.Pub»:fil}Tomatoes, __lications.Club .gas Rates.Apricots. So ement a ;White:Cherries.R.P.ALLISON'S Peaches.Book STORE.Pineapples.i Raspberries. 4d FRE Paine View Dairy Has just-bad its cows tested| and they were.found in good—condition —.another _.teason why the Dairy with._ _the Dacro System should .[Statesville Brick Co. Ssa se be patronized. —'PHONE 347 BLACK.— DRAIN YOUR FARM. Any quantity 4-inch and +f 6-inch DRAIN™TILE on |hand. yoommon Bricks,Face-mbricks,always ready fordelivery. [—S\WATKINS fora3 January 4,1917,or this notice will be pleadu“Everything to Build With.7 in bar of their recovery.All persons indebtedaFULLSTK--LOW TP ICES to said estate will please make immediate :OCK-.ES R settlement.Ales,Doors,Windows,Ceiling,J.B.PARKS,Statesville R-7,Ftin ,Siding,Boxing,:Mould-Jan.4,1916-—*Executor of Sarah Smith. ¢ement,etc.,“41 OLD-NEWSPAPERS-———All-you”want ateePlanters’Wh.Statesville.’ Si N a Coite L.Sherrill,M.D., Will answer ’phone calls left_at Dr.Long’s Sanatorium.or._Geo,M.Foard’s residence. i Butter Wrappers! "We have the very”best Parchment:Butter Paper, and can print your nameandbrandonsame.Let ushave),your order for aoy>.quantity you want.See us,Pri a reasonable.i 4 place of carpets...See meor write. now-and get a bottle.All-drug storesScll_it,in two,sizes—fifty cents and one dollar. this great preparation,send ten cents to Dr.Kilmer &Co.,Binghamton,N.Y.,for.a sample bottle.When -writ-ing be sure and mention the.States- ville .SSemi-Weekly Landmark. SH R R R E B E fied testimony itis,nature’s ~great you.suffer,don’tdelay anotherHaye”"Goto your nearest druggist|* However,if you wish first to try saved them. ia.. ‘To the Béitor.ot ‘The Landmark:Elmwood,Jan,28 —It seems toagreatmistakethat.such antorialasthatpublishedinThemark.under...»January...7headed.“Not.a “Good Record,”8havebeenwritten,when you evidént-ly did not;fully realize what :were writing about.That the fig-ures you give are correct I dodoubtandtheyaregreatlyto/be de-plored,but your insinuations of cow-ardice among the crew are,to say the~|least,unjust,In the same issue you pablienedseastatementmadebyMr.only American survivor.In that f .ment there is no hint of cowardiInhiswords,“they reported asdrill”;which shows there was no gn-‘seenily haste on the part of the ¢to get:away from the doomed sMr.Grant,a man with only himselftolookafter,just managed to y tape with his life.It is safe to say thatatthathourofthedaythosewhowerenotinthediningsaloonwereintheircabinspreparingfor,lunch.Mr,‘Grant says that Consul McNeely wasnotseen,and that it was no doubtduetothefactthathis“tabin was ontheportsideandhewasprobablytherewhentheexplosionoccurrCannotthesamebesaidof‘the other passengers whose cabins wereontheportside?Such a_terri-ble explosion as that which took placeonboardthePersiawouldcause‘anrawfullossof:life;for those who enotkilledoutrightwould.have‘ the inrush of water. have a better chance to escape from death would be that at meal times, while passengers are below decks,«it is the duty of the men to go around and see that all is in working order in ,case of accident. 1 think that if Mr.Grant does not‘have a complete line ‘pounded:from:vegetable herbs.It is|,.:aeheapecetionSUCH2poteApimmatantndieekenle.tae mithoeete teoar Be at aeoiattrecommend-A ae ,as otatoes,_dried oT ee adesiming:“Kosataiewto waa.have no business to insinuate eoward-ice:because the figures are not what they ‘should be,and I feel safe in say-ing what they would have been,had.the crew had _half a chance”‘to save—the-—passengers.——-Five minutesis-not a very long time “in which:to get_boats lowered and Eeseeeneeawayin-them,and-I think that if ever get to.know the truth,those w were saved,were saved.by.being araée ged from:the water. The law of the sea is women andchildrenfirst,but no law demands.amantodrownwhenhecanswim. It seems to me,Mr,Editor,your printers’ink would be .better .spent in.denouncing the cowards who.did this brutal,ungodly act,than.scor- ing the men who lived through it be-cause.chance.and the ability to swimADAM.BYFORD, THE FREIGHT BLOCKADE Delay...in...Freight....Shipmerits Came Near Putting The Land- mark Out of Business.=: The Landmark has ‘had some expe- rience’with delayed freight shipments that would indicate that the railroadsareoverwhelmed.and.the public issufferingseriousinconvenienceonac- folks have the #ame-experiénce,—and mark’s case is an exception.Paper shipped this office from the mill at Miller-McLain Supply Co. Long Loaf Kiln Dried Pine Flooring,Ceiling, and cheapest,because they stay where they are-nailed-and cost you less mon-ey.-WATKINS,Next to McElIwee's Planters’;Warehouse,Statesville,N.C. TRUSTEE’S SALE OF LAND. BY VIRTUE of the powers contained in a deed of trust executed by J.wife,M.J.and He:indebt Young,to David J.Craig,trustee, debtedness thereby secured,trustee will,on SATURDAY,FEBRUARY 65,1916, at 12 o'clock,m.,highest —bidder,“at—the-court house “door inStatesville,N.C.,scribed tract.of land: lyn street, 265 fect to a stake in~center of less,‘DAVID J.CRAIG,Jan.4,1916.Trustee. EXECUTOR’S NOTICE. Smith, 10c.a hundred.Worth thiswith, paper the walls.MARK>for them. Boxing, Weatherboarding and Casing are best A.Young and el-Craig_Live-Steck-Go.,to secure-theessthereinmentioned,said deed of trust being recorded in Book 85,page 443,:oftherecordsof‘deeds in the office of the Reg-ister of ‘Deeds of Iredell.county,..N.-C.)-defaulthavingbeenmadeinthepaymentsofthein-the undersigned sell at public auction,to the for cash,the following de- Beginning at a stake in the center of.Brook-Bruce Fleming's corner—thencesouth22degreeseast265feettoastake,said Fleming's corner,thence north 22 degrees westBrooklynstreet,Mrs...Mills’corner,thence with centerof-said street.N.-62 degrees east 186 feet tothebeginning,containing one acre,more or Having qualified as executor of Miss Saraitthisistonotifyallpersonswho.have”claims against.said —estate to pre-sent them to the undersigned.on vor before to start firesAlsogoodtoputundercarpetsand Come to THE LAND- Glenn Falls,N.'Y.,has been delayed. A November shipment got in the first of December,just in-time to prevent serious inconvenience and delay in is- suing The Landmark.Another ship-ment that should have been sent for- ward promptly was delayed at themill.It’was shipped December 24thandreachedhereon.Wednesday,the+2th.—Another-shipment sent “out ten days ago is.somewhere on the road, The Landmark ‘didn’t have enough paper in the house to print all the is- sue of Friday,the 7th.Richmond didn’t have in stock papér for a per- fecting——press-the size ~The —Land- mark uses.Fortunately:the WinstonRepublicanhadsomeofthatkind,which-it-kindly-furnished,but a bun- dle.shipped _from-Winston--by-freight, Tuesday,4th,reached The -Landmark Saturday,the 8th.An auto trucksentfromStatesvilletoWinston-Sa-tem-the 6th=the-day before The Land- mark was to be issued,for paper,got hungup en route home ‘and the paper reached The Landmark on Friday at2p.m.Fortunately The Landmark had enough paper to make’local mails. Patrons at a distance who_received the paper a day late will now under-stand the cause.And paper isn’t all.We happen to know of:a car of coal,ordered from Norfolk dealers December 14th—a month ago—has not yet been heard of.-Inquiry from the dealers said the coal would be shipped from the mine as soon as they caufd get cars—andthat.was all the ‘satisfaction obtained.| Bill Passed For Water.Power __Leases. The House of Congress has passedtheFerrisbill;which would throw open to 50-year leases public landscontainingmorethanthreetimesas HARDWOOD-FLOORS ‘Are parfectlysanitary,clean andeasytocarefor.Plans for a new house“are not complete withoutprovisionbeingmadeforthem.In old houses the work:is readilylaidoveroriginalflocrs,taking the U.A.OSTWALT, STAT EON eer N.C. Jan.4 Box 143, ae —-a much water power as now is under development in ‘the United States.Itlisestimatedthatthe11Stateswhich‘it is proposed to enter there are about;19 million undeveloped horse power.The bill is the result of a.carefulistudybywaterpowerexperts.of allparties.The’50-year lease featurehasthesupportofSecretaryofthe.In-terior Franklin K.Lane,his predeceg-lsor,Walter L.Fisher,and of Gifford||Pinchot,former chief forester of the(United States.Republicans ‘as well Mann,the Republican one of its strongest supporters,© STERNER NSTI ADAIR Women of Sedentary Habits, RG.ROSSER,M.D. GENERAL PRACTITIONER, HARMONY,-.--N.C, ito be troubled with constipation and indiwes- ly beneficial,‘Not so good asmilewalkeveryday,)but ver,three or. stipated condition, *PhoneHarmony.Dec.21—-8t*_ jtainable everywhere.:BUILDING?CG,WATKINS.!3 BUILDINGS,«Gy WATKINS.© teats OUR SHAMMEFUL, ple that the most.effective remedyidjfora:public evil is to- .|of the Superior Court hench is doing ed,|outsiders, chance of escape at all onaccount of Another reason that the crew would “war.” of maudlin public more often than not:wastes:sympathyonthedefendant_in_a homicide case,|®:.but thinks nothing about the offense|the most|% dangerous feature of the case,not to!4mentiontheman.who was killed ~and|¥%‘is family.”there is no reason to think The Land-|, count of delayed freight—if .other yaN eeeet stately Lin bes ULRECORD. Judge CarterRenders_Public Service.in ‘Emphasizing the-Enormity -of-the HomicideRecordinOurStati~Coun-try—Due to Maud blic ~Sentiment.. “It will be admitted by thinkingpeo- keep it beforethepublic;continue:to call attentiontoit,point out..its,hidedusness andtheshortcomingsofthecitizenshipthatpermitsittoexist,and by andbythepeople,becoming educated tothefullrealizationofitsenormity,will inaugurate a reform that will beeffective.So.long as we cover up anevilorapublicabuse,or ignore it,so long will-it continue to grow andthrive,The first and most importantworkistogetthepeopletorealizetheseriousnessofthewrongandtheT|fact that it can be corrected.On this point Judge Frank:Carter a great public service in stressing,in every charge to a grand jury,thehomiciderecordinNorthCarolina.The Landmark recently printed somefactsabouthomicidesinthisState papers printed the story.They evi-dently ‘were ashamed of it and afraiditwoulddamagebusiness.But we can’t keep such things concealed from They will be known to ourshameandourhurtandmoretoourshameandourhurtifwetrytocon-ceal the facts and make no effort to apvly the remedy. Talking to the Mecklenburg.grand jury,Judge .Carter cited the well‘|known fact that the number of homi-cides in the United ¥tates is from 10 to 11 times as many as in GermanyandEnglandcombined,and the record of approximately 8,0¢0 homicides in the country last year aggregates,by a considerable margin,more peoplekilledthanwerekilledinaction.ontheAmericansidein.the American Revolution,the War of 1812,the Mexi-can warm and the Spanish-American Continuing Judge Carter iis thus re-ported by the Charlotte.News: In 1909 and 1910 the indictmentsfor.homicide in North Carolina amounted _to 329-in‘Carter said,while in the last twoyearstheyamountedto.522..Thisdoes*not”take“into~account’the great number.of homicides that were com- 5|mitted wherein the perpetratorthedeedescapesbeforethelaw’s rep-resentatives can lay its hands on him; nor does it take into considerationthegreatnumberofinstanceswhereacoroner’s jury exonerates a prison-er on the ground thatthe defendant was protecting his own life. “The alarming fact about the situ-ation,”Judge Carter said,“is that of all the basic tests,of civilization.themostreliableone~{s rpe.security:of life provided for those ‘who live underitsregime.-Something is-.radically wrong.somewhere.The causes for them cannot be summed up in a word.The’courts are to blame to some 'ex- tent,I think,for their failure to pun- ish the guilty,largely through tech- niealities,of the law.and by.pressure sentiment, against society,which-is Judge Carter stringent--law in-New York nally inclined could go across the riv- er.into New Jersey and buy.firearms without restriction. carrying of firearms.he named as twoofthemostimmediatecontributing causes to the high prevalence of hom- icides in this country,although in the other-countries--of—Europe,where thesaleofintoxicantswas,unrestricted before the war and no prohibition ex- isted against carrying arms,the hom- ieide record is infinitely below that ofthis.country.In Canada only—one- fourth as manv homicides occur an- xually as in this country.~ At one point in his charge to the jury;-when-he -was-discussing-the-few- ness of the homicides punished -cap- ‘tallyin this country,he said,dramat- ically.“JT challenge vou to cite-me.a man in Nerth Carolina who was’of very great prominence .who thas been~unished capitally since the Civil War.”He -further observed that the ten- dency’to consider a man ’s position in society in passing unon the justice of voisons all’public opinion and leaves its taint.on the entire court,must be eliminated from the life of our coun- try.He admitted it must be a slow and painful process,but said a begin- ning must be made. TTS as Democrats supported the bill,Mr.. leader,being Women who get’but little exercise are likely tion and will find Chamberlain’s aroranaeel hour“much.better‘than to allow:the-bowels to remain.in_a con-They are easy ahd pleas-sant to take and most agreeable in effect,Ob- Mr.‘Baity For County Commis- sioner.. correspondence of The Lanamark. I have been informed that Mr. |Gi W.-Baity of the Harmony com-|munity will announce as a ‘candidate for the office of county -commis-sioner.Mr.Baity is well qualified fortheofficeandwehopetheDemocratsofthe...county will support him.Mr.Baity took it upon.himself to makethe:first.road drag that was put on the good roads in this part of the county.He never asked a cent for the drag but gave it to the county.He alsowasinfavorofgyvodroadsandvotedfor\them,\\VOTER. $100,cs $100-REWARD.|The readers of this paper.qillpleasadtolearnthatthereisat leastonedreadeddiseasethatsciencéhas “Be been able to cure in all ite steges,and a\s Catarrh.Hall's Catarrh Cure ia tmlypositivecurenow.known to themedifraternity,Catarrh being a constitutionaldisease,requires a consti-tuttonal treatment.Hall's Catarrh Cureta“taken internally,acting directly uponueod.and muccus surfaces of theaystem,thereby destroeae the founda-tlon.of.the disease,and giving.the pa-‘ar atrength®by.building up.the con-atae ADA A ting nature i doftseh|hesprontletors have #0 muc 4 eee Soars t st cunt that it falls to cure,neend.for. When Vick'sry.aa Seivesereiertotheheat.of body,soothing,m:catedvaporsare rel that areinhaledVICK'S® umn to relax to tt eS‘* his case,the maudlin sentiment'ithat | brought before the Superior Courts):>:number,Judgel of| that were amazing.Few of the news-| stig imod WASP db gas”4Qt Bs iC Bae | 43 deel Rey Saat ye Srndon |) It is literallly true—as you have ==,2)» probably discovered in your own e locality—that the owners of the’ car are its most enthurineets sales- men, ne ree Wy “taests yh sy $6 ‘y Dodge Brothers denier:frankly ads mit that their task.has been made’.. easy for them by the performance of the car and the things owners hayesaid aboutit, The mle is 80-35 horsepower’ The price of the Touring Car or Roadster.complete’‘is "$785" .=(f,0,b.Detroit)-ei ue “Canadian price $1100 (add freight from.Detroit)— \ which|= pointed out that al® city|§ against traffic in firearms’and the car-|% rying of them had cut down the hom-|% icide rate in the metropolis 37.ner|} rent,in one year,:-notwithstanding that|% for a 5-cent street car fare the crimi-! Liquor:and the|$ rene 3.CHENEY:&00.,)stole; ad PalBh ean % _-er it has thus far fulfilled the purpose for:which 3°Association.—/ THE FIRST BUILDING &LOANASSOCLrath OF STATESVILLE WAS ESTABLISHED:and'-op its-first-series Saturday,-February 5,1887...It will brate its.30th birthday~by opening its 59th.’series,Satyres day,February.5,1916.’Sa SW oe The.purpose for which thisAssociation.was organ-‘ ized was “to.enable.its members,in-an-easy and:sure, way,to accumulate capital wherewith to build‘or-buy-a home,”fIfyouwilllookaroundtownatthenumberofnice ~~homes that have been:built -by-the-aid-of the-FirstBuild-is ing &Loan Association of Statesville;you willsee whet organized.Many of our citizens have homes : them paid foof that would probablynot have had:not taken advantage of the ‘opportunitiesofferedby There are others.who nave used the First’‘Building &Loan Association as a means through which to’sa and accumulate and who have not-built homes.have found it a most safe and practical means for’doing, this.i But to build:homesis the primary object of this in- stitution:The plan is easy and practical.Come in.now: and have the plan explained to you so that Saturday,Feb-. ruary.5,you will have nothing to ap.but ne and:‘tak " out the shares.;First Building and.Loan Associa OF STATESVILLE.Cae es Hi.V.FURCHES,Secretary:and Treasurer. 3 “vl ood NAFA TMBae tah rs “Hardman st noted for their musical dualsforties,includi g purity,delicacy and singing char-acter oftone t e artistic beauty of their:cases,’*and for their remarkable durability.SioeeeeKetheHardmanhasbeen,in the FROofAmericanPianos.For those “who.have nomusicaleducation,the Hardman Astoniae Pe-PlayerPiano-admirably serves every .satisfies ever taste for every class 0 "ot THE PIANOS ALL CAN PLAY.: Own one for yourself,It iseasy,you catthesewenn)instruments on sen terms, iF |PRICE:: Serre eaten tee aadaeansnesancse rete Loo vahaseneesees avereny “60 January.14,1916,————————TH MYSTIFYING RATES. The ‘freight rate proposition is the ‘moat intricate problem of which The -Landmark has any knowledge —and this is not:saying that The Land- mark has any knowledge of freight rates.On the contrary it doesn’t pro- fess to understand them and some- times it doubts ifanybody does ex- cept the railroad people;and we have a private opinion that _their understanding —extends only to’the point of seeing that they get enough and possibly a trifle more than enough.on.occasion—for.hauling the | :ar A Washington correspondent _of-some of the daily papers has _fig- ured that the recent change in freight :“THR.-PERSIA'S CREW. |If our Elmwood correspondent will)’ turn again to the editorial in The -|Landmark a week ago,of which’she complains,shewill’see that The Land- mark merely.contrasted the number of the crew saved with the number of passengers saved.(the.figures are from the New York Sun,which of” course had the best inforfmation ob- tainable at.the time they were print- ed),recited the law of the sea and said that the /greatest,test which comes to mortals_is _/to’surrender a chance of life to another—a test.in which many fail.This was intended as an extenuation of ‘the light in which the figures placed the crew. The only criticism aside from the rec- itation of the-bare facts as publish-| trast in,the number of the crew and sja was “not creditable to the crew. And it wag not.There may be.a makes,which’will place the crew in a more favorable light,-We_sincere- ly hope that her theories will prove rates is to the advantage of ‘our folks;and if we read the Observer| aright that paper.thinks Charlotte is| advantaged by the change.Gov.| Craig,however,finds that under the|}change we have to pay the same| rate,except to a.limited territory,for freight shipped to southern points as Virginia cities,notwithstanding the haul from Virginia is near 200 miles further;while on freight shipped from the other direction,through the State to Virginia,we pay the same!>vate as Virginia,notwithstanding the haul to us is near 200-miles-less than to Virginia points.That is to say, Virginia is given the advantage of geographical’position in both direc- tions while we suffer a disadvantage in both cases." :Anyobdy can understand that ae |we wonder.how anybody caf contend that the discrimination is warranted. Gov.Craig does well to say that the question is not settled.It should not he allowed to-rest on.that basis. All good.Americans.naturally feel indignant when their countrymen are murdered by foreigners in a foreign land.But Americans are natural ad- the earth,for gain or the novelty of the trip,and take chances in all lands. It is not to be expected that we can send an army or navy with every American who goes abroad,and it is}} not the fault of this government or any other government.every,-time Americans are murdered abroad.We! =sometimes murder foreigners in ‘this|; country.Therefore,while the masésa-| cre of the:Americans in Mexico nat- “-urally arouses much indignation,we must:remember that,despite all as ‘warnings,Americans continue to stay| ‘in Mexico and to ‘go there—in the| --main for-gain:Therefore,this Iwex- ican murder,unless it can be shown that:the Carranza government did not give the protection it could have giv- _fen,is another case of taking chances in a lawless country—and losing. The Wayne county mob-folliowed the usual rule—lynched a negro whose punishment at the hands of thé law| _‘Was as certain as anything in the fu- =‘ture,can.be.The crinie was brutal .and.the indignation was natural,but if we—are—to—have—law--and—order- rather than government by ‘mob,no “excuse;can_be offered for the Wayne mehing.If the reports”are to be .--relied on:the local authorities were ivery negligent.There was much talk| of lynching when the allegedmurder- cr@pwere arrested,but they were not) removed to another jail,which could , ‘have been done,and outside aid was not asked.The jail was guarded one night but left unguarded the next; and the‘mob found easy sailing.This is.the first lynching.in the State for ow and the good name of the State dam-| aged,apparently as the result of neg- ‘ligence. The Winston-Salem Journal ex presses surprise over the fact that | formet’Governor Kitchin would op-pose the child Jabor bill pending inCongress.He was one of-the last men} ve would have picked—Hickory Rec-|,ord, :Gov.Kitchin is)appearing as the | attorney for.the Southern cotton man- ufacturers..An attorney who is out! for business—and all-of them are out for “business —doesn’t consider is “personal views,as a rule,when he is ‘employed in a case.What \Gov. ‘Kitchin might have done as a mem- er of Congressis-foreign to roposition. has no idea as to Gov.Kitchin’s 1 views on child labor.j itjis a.-matter for repret that edicalinspection of Iredell| could not be undertaken to.begin the work until near, ldeck as though ‘we ithere was no panic but says nothing -venturers and.they~go to all parts of | \for reply. 41916. tais | The Landmark,howev-. State Board_of.Health was | 4 of the public school term and.| ne it was best | ne until,next fall,It is correct.This paper has no disposi- tion to unjustly ¢riticise anybody, even when they are ‘miles away. Our correspondent,however,is_in- correct in quoting Mr.Grant as say- ing’“they reported as-for drill,3 which she|interprets as crew.‘Mr.Grant said,“We went ‘on were at drill,” which may have meant the passengers or both passengers and crew.He says | thedirectlyaboutthece: crew. scuct of BAD FOR MO? tk Wis etsAustrian’S try—News. French troops.the Greek Island of:ContaraisedtheFrench:flagmanEmperor's Villa Achille imerous.warships arecruisingin,waters around u-and pre}are reported tobe vuhder-way:fo)arrival of a portion of theSerbianmy.General Putnick,thecommander-in-chief,“the some ofigherSerbianofficersaresaidtoalreadyreaachedCorfu,An Athéns —dispatch says: Greek-gevernment..is—to fore an early date a strongly -edprotesttotheEntentepowersaainst the French occupation, Bitter fighting has broken!‘out along.the.Bessarabian front of the explanation,such as-our-eorrespondent+ tiating gas contrivances.Yeferring-to #the lraging on the whole of-the northernjandeasternfrontiersofMontenegro.have f: However,it is useless to quibble about Mr, Grant’s statement.The} Landmark based its remarks on the| great difference in the number of the| crew.and:.passengers saved.While | our ‘correspondent insists that the ed- itor,‘SHE miles away.from this awful scene,”had no business gest that the ‘figures show, admits they do,a bad case for.the crew,she nevertheless,while thiles away,assumes the right to ar-| to s up.| as.she| also | gue,on evidence thatis not as strong,|| that the crew was not -atfault at all, And,as Mr.Dooley would say,“There | ye -are.” We répeat the hope,however;that our correspondent’s theory is the cor- rect one and we thank her for the criticism.Whenever anybody =sec anything in this paper to which they object,its columns are open to them | The decision of the national Pr gressive party to hold its convention| at.Chicago at the «same time the Re-| publican convention is held means that. a determined effort wil be made to, unite the regular Republicans and Progressives with.Roosevelt_as the | candidate for President.While Col. Reosevelt «is cordially hated by the! stand-pat clement in the Republican| party,to say that this element w ill} not support Hint ifthe is nominated is! another matter.While”he haspele-| ments of weakness,it is The Land-! mark’s opinion that the ex-President| would be a strong and dangerous can-| didate,| MrWilson-and ac Single Terni Plan | “A letter fr om ee Wilson to| written in|February,1913,before Mr-Wilson was| with reference to the | Hon.A.Mitchell Palmer, ‘inaugurated, single term plank in.the Baltimore platform,'was made publie a few days ago,In the letter the President_says: “T éan-approach the question fr om | a perfect impersonal point of \to decide that question.” That is to say,if his party wants |him,the President will be a candidate ingain—-and it is settled that he will ihe.The plank in the Baltimore plat-, _gome years.A good record is broken form was suggestive,not mandatory.| pact As to “Misbranded Drugs is | Sustained. The Sherley amendment of 1902 to: _|the Federal pure food law,declaringidrugstobemisbrandedifthepack-| lage or label bears or contains Miles ‘and fraudulent statements regarding | effects —- thereof,¥s unheld as constitutional by| ithe .curative-or —therapeutie ithe United States Supreme Court. i Justice Hughes.follows 10 years of i We will pay ||$l00 for the ie‘son or persons view,| {because I shall most cheerfully abide: by the judgment of my party and the! |public as.to whether I shall be a)candidate for the presidency again in| I absolutely:pledge myself to.) resort to nothing but public opinion| The decision,which was rendered by | Austro-Russian line.|Six attacks by the Russians,according to the Vienna ed,was the statement that the con-Isstatement,were repulsed with heavyjlossestotheattackingforces. Montenegro is being treated to,ajthepassengerssavedfromthePer-/}steam roller"|which crumpled “up mts rneighbor,Serbia. attack similar’-to that slaught which has beena long time in‘preparation;isnow~being~prosecuted’t with great violence,menacing séver- al important positions close to«the’Adriatic’coast,wy ‘The great Montenegrin stronghold;|Mount Lovecen,has.fallen,accordingtoAustrianofficialcommunication. The attack here has been largely ‘as-sisted by Austrian warships and’the guns of the Cattaro forts.In addi- tion-the Montenegrins say the Aus.trians made abundant use of asphyx-A battle is On the east been compelled the Montenegrins to evacuate Berane. The Gist “of.It. “Last December cL was nearly downbottlesofChamber it was only &very completely restored to health,”writes Q.°S, Metcalf,Weatherby,Mo.If you would know the value of this remedy,ask any ene.who has‘ised it,Obtainable everywhere. ry .N¢y i ICE! DR.RR.A.BASS,.Veterinary Surgeon,has moved to Harmony for the practice of his profession, All-calls will receive prompt.at- 7“bought twolain’s Cough Remedy -and few.days until 1+ friend and;The Austrian on-! MON AMOUR—"TheSweetheart af Pacfames.”You Have Another Chance The success Jast Saturday of ourdistributionthroughthestoresnamedbelowofourregulat2benoveltyTrialBottlesofRieger’s new Flower Draps perfume for 1centswassensational.On accownt of the re~merkableintereat shown by the ladies,we havo{extended our.special iitroductory |offer,{bin Pg ve another ee tomorrow to get of these 950 Trial Special Nes,this is the new,superior kind of perfurne th tail your filendsaretetsing about,the perfume that is nesrent.GW onderfullylasting-ret Mg all Ahe sweet,delicate fra-grance of t very.Subile,seductive@odappeating.‘Not Mike the ordinary per-fumes you are furmifiar wilh but differentfromanythingynfeverhaveseenbefore, Perfume $100 per ounceAnyquantitydesired Remember,this special offer of abottlefor-only 10 cents haeadebefereandisconfinedto)ioieits,Take advantagerowatanyoftheseslores; Statesville Drug Co. HORSES,-MARES AND MULES!—-Just ceived seven cay-loads,WAd WAS the’bestsorteditetoondmoregood“Mares than we hav¢hud at any one |time. Come to sce lus at onee,as the prices will certainly xo Pirher later.HENKEL-CRAIG ever th ‘and Mules} Atter taking stock we find.ye." ‘some Great Bargains ‘in odd straight Chairs,Rockers,Tables;Dressers, Pictures,Lamps,Dishes,short lengths Matting and 100 window Shades at half Price.—. --Now.is.the time for..you.to.furnish ihe your home at verylittle expense. Come i in and make yourself at home, we are always glad to see you ‘whether you buy or not. ennesesiited Ie Sa cietieeeeioneee READ ay HAT STATESVILLE BUSINESS MENOFFER. tention.’Phone Harmony.LIVE STOCK CO.Tanta Jan,14—2t*.eae ee ee aaeaioeaantte soemmecereeneemmisitenes $100 REWARD! Be I a reward of apprehension and conviction of the ‘per- setting fire ||to our property—the St. Charles hotel. R.V.Brawley, L.C.Wagner. Jan.ii=2t: |lai (Raeene uNnenwa Aa ATO RE A OR IANDSOME “FLORODORO"WAISTS! ye i A bigig express shipment of the poouile FLORODORO SHIRT /WAISTS FOR LADIES has just arrived, /NWOILES,CREPE DE CHENES.JAP.AND PUSSY WIL-" !OW SILKS,up to the minute in style and fabric,,at $1.00, |“2.90 and $3.00.Delivered to your door or nearest postoffice — sizes 36 to 44, without extra charge.a Las A few more Ladies’all wool fine Suits one-third to one-halfoff. MILLS &POST ON.= 119 West Broad Street. ‘to be closed out at Yours truly, Rava an A revira aviravia OnTOCN Je c¥ a S eR Nn ws Or e Et IO Wc SE E Famous Players Film Co,.ue Be sure to see her Today LYRIC THEATRE A °aL .Lo;YELLELEEGEECLGMEAOIE LLG LOD OGL:CLEDODIL Hogislation and litigation in an attempt 9toregulatestatementa.as to the cur-|4 tay(ative effect of medicines in ‘inter-|/,“yiStatecommerce.....Numerous_actions|4 7 IN eK against drug concerns are expected to |4 °;.[follow it.ais “iy 6 :.eet GFeeirlofYesterday:Most Powerfuland Penetrating |YUL}' Thereore Cowaas relieves 25c Yieup/FP quickly.Goes straight vy 7itetlagernssoc|,7 A Novel Romance of the Past|sis oh sunset aed \&|‘Wily ve|jucing lever.2 |CG4,BA at:PPonergoAS!|ZU and the Present.|lt promptly absorbs:{YG apna cg as Lew an ey 1 \ine aaa as yg OM ee5C-AND 100. tPevegene le 2,|Yteater|bY orporalion-Gowansismote penctr.iing-’|CS /0 %ONEHUNDWEDandTER icliures.»eee [|sesteoranes My HE NEW YORK,NK?Zoncord,N,C,i 7,4GLithYiUY“tyYYY Gy:Seg Oh lo’“yeVibeTyGILGG:LadTU4GLYVgYt thyegeie,-Uyi Uy,Higggs:Aa 4Uihabileiiiets iapbtitCe Ms ee ALLELE ee, 7COLLLL S24 ae ae es Rebekah and Hassie Miller,n,Yount,Bertha Cooper,Cor-he Morrison and Martha McLaugh-composed a theater party which‘to’Charlotte Tuesday.to see a ,Frank Hall,who was at home »the holiday vacation,returnedweektotheMcCallieSchoolat Chattanooga.:, -Mrs.L.R.Connelly of Winston-Sa- lem.spent yesterdayin town.»-Mr.C.8.Tomlin,a.member of the“board of directors of the North Car-‘olina railroad,attended a meeting of“board in Charlotte Wednesday.-s Mr,.J.H..McLain,a Charlotte law-ver and_a nephew of Mr.W.P.Me- ~Igainyof Statesville;‘spent-yesterday in “Di\y vy e“|sociation. \ se town on-business.--~}Mrs.Annie Foard of Cleveland’istheguestofher”sisters.the Mes-dames Kincaid,,on Davie avenue.Mrg.W.F.Thompson,who was here,returned yesterday to her home atCleveland.—Cant.W.M.Westmoreland went toCharlotteyesterdaytospendacouple of days.X :Mrs,,P.F.Gilder,who visited her parents,Mr.and Mrs.J.G Gillespie, yeturned yesterday vo her home inCharlotte|é : Notice of New Advertisements. Great bargains in furniture—Wil-liams Furniture House.A live topic surrounded by facts.— J.M.McKee &Co.At the Lyric.: >Another.chance.—Statesville Drug Co...“Listen,to L.B.Bristol. .Dr.R.A.*Bass has moved to Har- mony.: ~“At the Crescent today and Monday. oo houndaries—Boyce Lumber -Pandsome waists—Mills &Poston. resh oysters.and mackerel—Tho --Robert Bunch Cash Grocery.Girls wanted to'work in__office .Piedmont Red .Cedar Chest Co. Wood,cut or in lengths—Turner El- liott.s “Show cAses,at a bargain—Thos.M. Phifer.|-iMt,Watkins for everything to build with.: Something “dging next week—-Ram- sey-Bowles-Morrison Co.: ‘Fresh groceries—Sherrill &Reece. Report of the condition of the First National.Commercial National, Merchants &Farmers’and People’s Loan &Savings Banks.A Catined goods—Miller-McLain Sup- ply.Co.4 a ' ‘Oak and mahogany pedestal table ~«-Grawford-Bunch Furniture Co. 4¢%Home-—First.Building &Loan As- oe¥.|New Assistant Postmasterat sil Taylorsville and.Change of-Carriers —--A ‘Wedding—|Methodist Meeting—Taylors- .ville News.. Correspondenceof ‘The Landmark Taylorsville,Jan,.18.-—Miss Dona,|Austin,daughter of the late PickensAustin.of.Ellendale township,andMr.John Z.Little were married Wed-yiesday morning at the Presbyterianmanse.Rev.L.L.Moore performedtheceremony.Immediately after theceremonytheydrovetoMr.Little’shome.just south of town,where theywilllive.‘*Mr,R.S.Echerd,who has been as- sistant postmaster since PostmasterJ.L.Gwaltney’s appointment.hasresignedtobecomemailcarrieronruralrouteNo.1.Mr.A.C,Cline,carrier of:this route,wil be transfer-red to rutal.route No.4,which hasbeencarriedbythesubstitutecar-rier,Mr.Carl Watts,since the resig- nation of the-carrier,Mr.Carl Moose., some months -.ago.Mr.Gwaltney has anpointed Mr.R.W.Chatham.who Hves about three miles east of town,—assistant postmaster.These changes will take ¢effoct Monday,the 17th.\ x-The first quarterly meeting of the Alexander ‘circuit of .the Methodist church will be held here Saturday and Sunday.January 224 and 23d.Presid- ing Elder Ware will preach Saturday at 11 o’elock at the Methodist church and communien-services wil be held Sunday morning at 11 o'clock. Mrs,Martha Jane Mitchell.widow of the late John Mitchell,died of of her son,Mr..Reed Mitchell.in Gwaltnev’s townshin.;Deceased was a daughter of the late Thomas Mox- ley and was 79 years of age.She had heen a consistent member of the Rocky Springs’Methodist church for many years and the funeral and burial serviees were conducted there.Two daugliters,.Mesdames Sallie Fortner Jtof-Arkanses and June MeLain of this county.and three sons.Messrs.Frank Mitchell of Hickory,Reid and Arch. Mitchell ‘of this countv.survive. Mr.and Mrs.Ray Hendren~are visiting Mrs.Hendren’s parents,Mr and Mrs.G.CG.Teague.They will move to north Iredell this week,where thev have purchased a farm Mr.H.C.Payne spent Wednesday in Charlotte. MONEY FOR THE SCHOOLS. The Amount Apportioned and the Share of.Counties in This Section. The State Board of Education has approved the per capita apportion- ment of $250.000 for the school chil- dren of the State.which gives each of the 808,257 children of school age in the State a fraction less:than 31 cents.”Under the act of the’ jare inmates of institutions in icounty. pricumonia Friday night at the home} “\iail.The three who escaped are.Wade ''manee added 52 to the county school |"© |population,Cumberland 29,Davidson } ItemsofInterest Gathered PrOvertheState.| Rev.J.D,Harte,pastorof\1Baptistchurchat.Hickory,haclined:a.call to Lexington.’- Judge Cas.M,Cooke of skwho:hasbeen seriously ill for°stime,has been taken to a Philadephiahospitalfortreatment...i.— The Supreme Court announces thateveryapplicantforlawlicensemusthereafter.swear that ‘he has neither fe nor regeived aid in the examina-ion,.;A contract has been let to build a new court house for Durham county to cost $221,000,A jail,to cost $35,-000,is to be built in connection withthecourthouse.%, Dave Bryan,who killed Clarence Kennedy (both colored)at New Berne Christmas,plead guilty of secord de- eree murder and got 30 years in.,.'the State prison,the full limit.‘ The plant of the A.S..Abernethy Tanning.Co.at Hickory,owned by A. S.Abernethy.was burned.Tuesday night.The Record says the loss’is $3,000 to $10,000 and no insurange. Mrs.Susan..Love,,.74 years old,wasburned:to death Saturday morning*at’ the home of her son,Edgar Love,in Lincolnton,when her dress caughtfire.No one heard her or knew.of} the tragedy until her body was found.| George L.Lyon of Durham,(85 years of age,world’s champion ama-teur trap shooter,died Tuesday in a sanatorium at Alberguerque,N,M.,of tuberculosis.»Remains brought toDurhamforinterment..Lyon was a nephew of J.B..and B,N,.Duke. An interesting damage ‘suit involv- ing-$20,000 is on in the United States District Court at Asheville.Mr.and Mrs.‘Herbert Chafin ‘are asking .for that amount on account of the allegedunlawfulejectmentof.the plaintiffs from ‘the Langren hotel several months ago.;: Gov.Craig has fixed February 25 as ‘the date on which-Ernest Lowery. and.George Posten will pay the death penalty for the murder:and robbery of Grant)Davis in Gaston county.February.1)_has beén fixed for thesamedate-has also been fixed for the: execution of Jim Cooper of Salisbury for the murder of Lucinda’Price. Three white prisoner broke jail ‘at Yadkinville Monday night.A-fourth prisoner—a-negro—ramained in.the Bolin,awaiting trial on a charge ~of stealing a bracelet from a dwelling At4inDavidsoh county,“Supday night,|t.Phott’s road construction camp Frank Dayis shot “and killed »Geo:Fhompson,Both colored.Davis:e¢s- caped,}‘ $1.00 Middy Blouses at SMITHEY&FRALEY’S for only 60¢c.—ad.~ MARKET REPORTS.eamesStatesvilleProduce Market,|~Thefollowing -prices”were-paid -yesterday.|for produce on the Total market,Winter Friers,12¢,per Th,Turkeys,16¢c.per.Ib,Hens,10¢.per Ib. Eggs,25.per dozen,Roosters,6o,—per.tb.Butter,Ihe.per th.Beeswax,26c.per Ib.Green Hides,1Le.per Ib,Green Hams,18e.to 15¢.per lb.Old Hams-18-to 20¢,per lb.Sides,12¢,per Tb.Shoulders,12¢,per tb.Red Honey,8c.per pound,Sourwood Honey Comb,16 to 18¢,per lb. Graie.: _The following prices were paid yesterdayforgrainonthelocalmarket; Wheat,1.85°per bushel.Corn,inew),.60¢.per bushel 0 0*Oats,65¢,per bushel. Statesville Cotton Market.On the local market yesterday 12 1-4c,perpoundwaspaidforbest.grade cotton, Seed cotton,6.26;Cotton seed 57.per bushel. L (ADVERTISEMENTS in this column 10 centsper~line....No ad.taken for less than 25cents.Cash must accompany-order.) WANTED—Girls to work in office,PIED-:MONT RED CEDAR CHEST CO.BilasJan.14,.1916,hae 4 WOOD—Ash,oak and dry pine,cut or sold in Aelengths.TURNER ELLIOTT,‘Phone 288.;att Prompt Delivery.Jan,14--1t*, FOR SALE—Iwo good show cases at a bar-again,THOS.M.PHIFER,West Front St.,‘74Statesville,Jan,4—-1t*:’‘ We t ee LOST—Masonic Watch Charm.Liberal re-ward for.return to S.R.BROWN,| Jan,11—2t.a | { i STOCK—$5,000 additional shares of stock in)Star Milling Co.for sale.Apply to STAR MILLING CO;~Jan,11--2t. FOR SALE—Dry oak wood,on.ground or de- Ee e Se Ww e aa—= es livered.J.D.FOARD,R-3.Jan,11-~2t*, WANTED—10,000 bushels of good white shell- ed Corn.Will pay.highest market cash prite~STATESVILLE FLOUR MILLS.~~ Jan.11. FOUND—Vest.Owner may —have-same by!sy calling at The Landmark _oflice,describing property and peying for ad,Jan,V.. WOOD—Cut ‘stove and heater lengths.Prompt delivery.’Phone 393 Blacks.ALEX: _GAITHBR,¢'\.Jan,11-—4t*, FOR RENT—The Nicholson house on Bell strect.DORMAN ‘THOMPSON,executor. FIRST NATIONAL 1 'ree MONCY-and.checking.‘on_it teac SMALL ACCOUNTS. If you have only a few dol- lars it is better,to put it in a Bank,where it will be safe,and, check on it when needed. 5Payingaccountswithcheckis -more business-like and safer.- Then the practice of banking © es economy.Don’t you know — that if you keep your money... where you can_touch it,the touch is a suggestion to spend~ it?On theother hand,if your -money is in a Bank,you are not so apt to spend it unless really.+- needed.Once you have opened.| ‘an account with a Bank your de- sire to keep something there to.- your éfedit all the time and con- stantly add to it will grow .on«YOu.Ma This Bank welcomes small ac-«[f counts and handles them with game care as larger ones. _Statesville,N.C.*BAN Capital $100,000.Four Per Cent Paid on Time Deposits. FOR SALE—Two lots on Park Street.C,5. TOMLIN,dan.4—H#t, house;John Bolin,charged ‘with’ob- ‘taining goods’under:falsé pretense; a young boy about 12 years old by the fname of McCollum,charged-with-the| itheft of a cow.“They got out.by pick-|jing a leck with a wire. |dobn R.Poston,a prominent citizen jof Cleveland county,was called to hisideor»night recently and.firedj|deor one nig t recently and.fired on. The first shot struck the door facing Legisla-|2nd as Mr.Poston jumped back and, |ture the counties this year received ;closed the door a second ball passed lapportionment for the orphans who|through the door and the| Under this arrangement Ala-/Pus. I struck him in the chest.~The wound is not danger-J.R.Smith,a white tenant 6H ‘oston’s place,is j the crime.It is said that SmithLOT The cold truth—Hall’s Drug Store.#99 Porsvth 120,Granville 484.Guil-|was under the influence of liquor on -*Join the Christmas Savings Club.— Merchants &Farmers’Bank. Social Items. ‘The Macdowell Music club meetsthis,afternoon at 4 o’clock with Mrs. R._B.McLaughlin.The Daughters of the Revolution will meet Monday after-| _.noon at 8.30.o’clock with Mrs,Z.V..30 "Long.On account of election of offi-|Ashe,6,958 and $2,152.52;Burke,7-|ter and jurist:of cers and time for payment of dues,it 991 and $2.193.67;Cabarrus,9,492 and |tainments,were is desired that this meeting be large-nnd $2.193.67;Cabarrus, '$2,936.45;Caldwell.7,286 and $2.253.-;tor $3,499.48; number of other guests were enter-'Cleveland,10,528 and $3.256.94;Da-| tained by Miss Corrinne Morrison |yjqson,12,019 and $3,718.20;Davie,4,-;18,601| ~-ly attended,The Bachelor Belles and quite a Wednesday afternoon at her home onwestFrontstreet.Hearts was playedatfourtablesandMrs.D.J. an’ice cream course were served. Mr.J.H.Hoffmann and Mr.:Isi and: ed last night. :New -Buildings—News of the.Correspondence of The™Eandinark. .2-——Misses¢)New Hope Country. Correspondence of The Landmark. New.Hope,R-1,Jan.11 miich farm work being done,but con-|¢d—Miss Banna to Charlotte to being hautled.!work as stenographer,and Miss Alta|| Messrs.Robt.Shoemaker and Naa-|to her.studies in the Harmony High}siderable:lumber__is Craig |920.45; won ane peers prize,.fees of one 4 The “booby,”a comic doll,was award-|powell,5,008-and—$1,573.40;—Meek- ed to Miss Grace Shepherd.A salad |jonhurg,24,762 and $7,660.36;Rowers Stanly,8,077| Isi-|and $2,498.70;Surry 11,267 and $3.- dore Wallace returned yesterday af-|495.56;Union 12,795 and _$3,956.26;| ot -and--the-—remainder—of the watauga;4,407 -and-$1,363.25;Wilkes,| “Statesville party-who attended thei41 629 and $3,600.64;{ marriage of Miss Babette Kaufman!jq-3 = y tr:Herbert.Hoffmann,in Dan-|seclesah.| -ville,‘Vas.Wednesday evening,return-Chasing Foxes—New Desks For'| i S shook ‘tions of men;-women-and-children,-and- 3f tofal population i}ford 80,Henderson |Wake 256—making a i phans.The andschool ities in this section of the State is 5 |follows.r De ae American |Iredell,12,944 children and $4.004- 5:Alexander,4,225 children and $1,-!paid high trigute to Julge Long asa! 7,05;Alleghany.2,752 ‘and $851.35; 9:Catawba,11,312 and 1233 and Forsyth,$840.45:land $5,754.403 i50;T 118,009 and $4,024.45, and $1,689.10. the Leonard School. |.Statesville,R-3,Jan. |Banna and Alta Ostwalt,who spent the -holidays--withtheir—parents,Mr. ot'and Mrs.Davis Ostwalt,have ee fer man Barker are “building new resi-|School.—* =dences and others are having lum-her:firtished preparatory to building.vantage of the moonlight nights to Mr.Coyt Bowles is expecting to build amuse themselves in pursuin on his place purchased of Mr.M. Williams. to occupy.right soon. house ‘is also under ‘way. Mr.-Ross Query.will »move to the |and the chase near Leonard’s school} place he bought of Mr.F.W.Young-|Tuesday night,was abandoned about She sporting cranks are taking ad f the nu -tmerous hounds which chase fan end when Mr.Fox ran in a hole er,the latter having moved to the midnight. Mr.Harrison.Williams is “his:‘first’.appointment “Springs next Saturday und Sunday. Miss Alta Younger is home again. She has’been:teaching in one of the Ly a“western counties..” Items From Scott’s. place he bought near Union Grove,Mr.R.C.Roseman has been on th \sick list for the last few days,but iableto!better. :.dut again.Miss Della Welborn is ;The patrons of Leonard’school ar +.Wheat.and other ‘small grain ilookingfineandthefarmersin‘thi section are feeling good. *Another Reading. Correspondence of The Landmark. 5,Iredell 200, of 1885-or aston 14,289 and .$4;-Guilford.*20,363 and $6,299.- jincoln.6,542 and $2,023.83;Mc-| Yadkin,,5,460) ;(the slyMr.:Thompson’s houseis|gid fox for many miles across the near completion and he is expecting)country.The great chase near Beth- A-new school|jehem school Monday night.came to} a.;Ser ivery.much pleased to have the new Our ‘new‘pastor is expected’to fill)patent single “desks ‘installed in theiatTaylor’;school house.; ithe night of the shooting: “At-a meeting of the Concord bar, held at Concord Monday,Judge B,I. |the|Long of Statesville was unanimously| ‘amount of money apportioned to coun-|endorsed for the position of Associate| as ‘Justice of the United States Supreme |Court to succeed the late Justice La- tmar.Copies of the resolution,which \gentleman of high Christian charac- splendid legalforwardedto.Presi- 9,492 andi dent Wilson,Senator Simmons,Sena- Overman and __Representative|Doughton. is in jail to answoh}" ate} fOr RENT--Seven-room house Race street,one piock from the cotlewe.-Modern con-venicnces.MES.D.A.MILLER,Oct.29. IHORSES,MARES AND MULES—I AM ATfewith35head-good Horses, FRESH OYSTERS 45e. 23c. ‘U.S.Depository,- Mules,Lo of ice oungs|ty a for SAA iwesti load Mulea.Quart Cash or.time.©.BE.DANIELS.Dee.24. 4x20 Dressed Bucket CedarShingles!'}|ping The same Cedar your water bucket | ‘is made of.Government statistics show thut 63 per cent,of the Shingle SOAPS |-osts in the United States are of Ce-| AFTER GRIPPE |Vinoi Restored Mr.Martin's Strength Wapakoneta,Ohio.—‘‘I am a farmer by occupation,and the grippe left ma wigh a bad coughand ina nervous,weak, -down’condition,and I could seem to get anything to do me any good until-L-took Vinol_which built me up, and my cough and nervousness are all avis claimed for it.”—JAMES MARTIN« *Vinol is a constitutional remedy for all weak,nervous and run-down’condi- not || pone,and I-can truly say-Vinol-is_all dar wood.They won't crack nor.split.|}Oetavon.Soz ake gece 4c.|Waggoner’s Barl(WATKINS,Next to Metiwee’s|]]expert:Soap,ber’Ge el Pee;Planters W arehouse,Statesville,N.C.Ivory,Soap,per enko renee rgb -BAKING POWDERS. or OT aia ties0ow eer eee ac.RAN ;|Tapp Cleanser,per box.....4¢.|Snow King Baking Powder .: :acer:iil Grandma Washing .Powdéiy -|Royal Baking Powder,‘I Ib. res 00 S per package ...-eeeeeerene .4c.FOP deere reeceetecennes :e Old Dutch Cleanser,per’—|Royal.Baking Powder,one- package,j.ccereeveres sere DCe half1b.for.see es dane.2OGs 'H)Celluloid Starch,per pack-Rumford Baking Powder,1 Ib._ wee _i {|BBC erenceeeseteeeeae agea ae.uate paldee vn 6 BB Fresh Mackerel.‘si |q|Lump Starch,per,theyre 6c.-p Rumiord—ng-Powder,-oe 'ax a CANNEDMILK.;Ib.for ses teeseees sede eet o LOGe f “vanberries.\~Per Parrot and Monkey~Baking»+| Eagle.Condensed ~Milk,per POWAGl 25755 <Gaees eee \Mince Meat.CAN veces eee,sav ee earee 5c.|Davis’.Baking Powder,1-4 :.Libby’s-Gondensed Milk,pet cb;Can ees ies Ee ee tee he Evaporated Peaches.Gani)cyaaeeeeres 9c.|Davis’Baking.Powder,1-2” ae :Libby’s.Evaporated Milk,.per Ib,can .......-al gigee ate Evaporated Prunes.can,raeneinn .wile gee Davie’Baking:Powder Lib. Tyanorate +3 >Libby’s Evaporate IK,Dp CON peak Mean: Evapc rated Apricots.CAN caves se tera ea clee tte ee -4ce.|Princins Baking Powder,1 :CANNED.VEGETABLES.Ib.CAN eee e envy eee eee a The Season is Now on For Can-ie Baking Powder, t a -|ned Vegetables —I Haye the De COM ses cee thenene—Sherrill &Reece,4.41 eotae tears |CorrEE i 3 r ide ..5 10c.val-i es“Phone 123._108West Broad St |/f|Blue Bide .-corm,20e.vals g White House Coffee ..8 Tb.ean 9 eae Tt Sweet Meadow —Gorn,_per _ca,ee ite ouse OF ee <1 Ib.can, .ge,or 3 for 25c,|eueen Quatity steel-DOORS,WINDOW,MOULDINGS,ff can _Mantels,|Columns,Stairways, ‘Blinds,Lime,aths-and-Cement.-Mr.| ‘Builder,I only &sk that you “Buy Where You Can Buy Cheapest.”+6 WATKINS,Statesville. c} e r AND ‘Velvet Corn... Pocohontas:Peas 20c.value for 17e.. Stikley-Bros.Peas 16c.val.for 12c.- Old-Time Peas 15c;val;42¢;,2 NC ietet Weree ge 8 CANS for 35c. Libby's Gréen*Asparagus DERS. WASHING POW- Elk Head Peas oe 0 cut,put up in1 1b:85c.value for.20...ede ..15e.value for 13¢. Ten Penny Coffee,1-2 Tb.ca’ 23c. No.3 Blackberries,[per ean .. ..¥.8 cans for’ “cans,* Gold Ribbon Coffee,IIb.can:Dandy ‘Cup Coffee,1 Ib.pkg...<1 No.1 Bourbon Santos Coffee ° Ss for chronic coughs,colds and bronchitis.|next to.McElwee’s’Planters’Ware-in bulk.,We grind.thi W.¥.Hall,Druggist,Statesville,N.C,house..:|Libby's ’White ep cveeteag fresh as you need it and — eo Sea TT Tiss ascot 30c,value for '27c.ee ae every pound,based a |Jere »Some E i a OP is OP OR "THE GC “A TH |Here _are Some.Eatree aise No.i Aare Coffee,:25c.~ Hl No.3 7 ;ile value foro.yeeget cae OLD.T RU :|eae Tort ors ee 25c,|No.2 Blended Uoffee,20c. |Ikenberry’s Saur -Kraut;.value.for SCS a ee awe ak i IS i none better .:....3 cans for 25c.Arbuckle’s Coffee,per pack. No.3 Hominy ......3 Ibs.for 25c,J 2BE +++++:tteerenewete .|aoa 4 The Robert Bunch Cash GroceryQUINACETOLCURESA“COLD.{is === eae AT a ‘We are in the market for STANDING TIMBER.| sit +a ‘;Write or "phone us.ae :||_HALL’S DRUG:«STORE,ROYCE LUMBER CO.Geo.H.Myers, i *PHONE:20,0000 ---Prescriptionist,J]PHONES @r'ibtNor'ss Vice Pres,and Manager, =|=eee ==:SE s$ ~[#|FOR. SALE!|#| Co dence:of The Landmark.A ; \Scott’ea ate The Reading School for the Brier ott’s Jan.18 —Community Ser-|creek and.Alexander Association rai :‘eaeNe‘oh ast rail ;vie League met at Scott's High vii be held with Mta Vernon Baptist est railroad station six miles, School Friday afternoon;7th,and|church,Iredell county,10 miles north «farming.Over two hundred elected new..officers—Miss vice:president and Miss Ollie Littlsecretaryand’treasurer.\Miss.her music classhere last week.Mr,Burley:Redmond and .daughter,Mrs.W.G.Ri Cornelia Rufty president,Miss Corra Wagner ry Sharpe of Loray began ‘sister,Naomi,entered the high,school here_Monday.More boarding students arectednextweeMrs.Moore of Wilmington ‘is visit-eyn- @lwill be studied.All’ministers of botAssociationsarerequestedtobeent.N.M.FELTS,Secretary®and Treasurer.Jennings,R-2.as . of the Spencer postoffice.master says they ;got $232.66 f $620.36.| from Statesville,beginning-Monday;January 24th:The Book of Hebrews ree No clue was found to the robbersThe:post- é instamps,$87.70 in cash-and ‘destroyedasafevaluedat$300,making a to- Sat,SMITHEY|only”Boe,sats dwelling;two tenant houses,ba h level and ptoductive,balance.in_hundred thousand feet of tim woodland. located for dairy and truck far ERNESTG.G \F Rie 800-acre Alexander County Farm,near school and churches,hear- road,soil and location well adapted for fruit,grain and stock ed by branches and,springs.150 acrés in cultivation,gene ally :Seventy-eight acres one and one-half miles from Statesville,ad- joining the State Experiment Farm.Forty acres in cultivation, level and productive,five of which is branch.bottom,balance in Three-room.cotiage,small barn,two branches.Well For further information call on or write, ANTHER,LS AND REAL Sree OF 1k NO.1,MILLS BUILDIN fronting on both sides of public fruit:trees...Two-story,8ix-roomrnandout-buildings.Well water- woodland which will cut over one I want to thank’for their trade all who traded with me the year which begins tumorrow when you need anything ‘in.th of jewelry,clock or watch repairing,examining of eyes and.fittis glasses,I want.you'te come to me.OR.F.WENRY, THANKFUL FOR TRADE! is .y ber.Bargain.at.$17.00 per acre. ming, GENERAL INSURANCE,REN'T- GOODSATISEACTI That’s what Lalways try to give.If not satisfi iknde RRL Time is money.‘Why not buy yourself so Jeweler. JOE VEN naeagpe REN SONAR quanennenene oe See ae a? at se Po eee Cac eee Lta apnea TS,SSTNGS VANCE CLUBS. uestions:De- g mesting-o'i Barium Orphans’Home,~in d States,pobated,’Ete.rar!i ; this week,at which Mr.I.T.A the rement.th oau men between |. ’a Ree pondence of ‘The Landmark.sie ‘ i ae ee |Statesville,R-4,.dan...10 —The|?Morganton,representing the}18 and 21b ven a st six)\ Ttemsiof Interest About Various!y"f.¢.club’girls par sday af.|Grandfather Presbyterian orphaneg ening,a aiehbaed seeie hy Matters.~» |ternoon,January 6th,with Mrs,A.J.yes present,it was unanimously.d¢-near committeeof the House of}” The British government has lifted|Beaver,This 1wurked the first meet-|¢ided that both orphanages i ess by Major General Scott, its embargo on the shipmentsof log-ing of the New Year and was also a|Ploy counsel to represent them ..of staff of the army,the contest over the will of H.T,.(v-Scott told the committee thateUnavood¢logwood extracts from Ja-jvery,interesting meeting,consisting|‘Ms maica to the United States.:Tmainly-of the:election of new officers,Kinnon of Charlotte.Mr.A.+ "Mrs.Russell Sage has given $250,-)which were as follows:Misses Rose |Scales of Greensboro,the regular at-|ny of nearly 2,000,000°men “in ©the 900 to found a branch of the Emma Mills president,Ellen ‘ants vice |torney for the»Barium,orphanage;|.vent of war.It developed during ©Willatd School in Troy,N.Y.to teach |president,Lottie Shuford —secretary and.Mr.Avery,-president.of.the}she hearings.that there are morethan domestiesand industrial art.Old Man jand treasurer a d Mae Little corres-|board of trustees of Grandfather or,|4,000,000 mén in the-country between Ryssghh,was a “tight wad”but,his |ponding secretary,New officers were |Phanage,and the attorney for that in-|the ages of 18 and 21:and that 700,- i 3 been,fairly liberal with)not elected because we were tired of |Stitution,were designated to repre,|00 reach the age of 18 annually,' ited States would need an.ar- OC C M h rs Your oe incor fe ‘ot Le ~*ing the sheen teaofthefamilyfromyouthtooldage,are lessenedwhenyouusethisoldandtrust-worthy remedy—. widow}:the i he accumulated.the old ‘ones,but -we think it always|Sent the two orphanages.‘oly Short of a universal military.re- Scargity of potash for fertilizer se-‘best to give every member a chance to!Mr.McKinnon left certain property |quirement,Gen.Scott thought the ad- riousty threatens,the cotton crop,|hold office,in Charlotte to these orphanages,and.ministration’s,.Continental army plan 'Senatoy Smith of South Carolina told|No refreshments were served.The{his heirs are contesting his will,.|.|ffered the.most workable solution of the Sefidte in submitting a resolution |club decided to meet with’Mrs.R.A..epee eee [she mation’s military problems.If the calling,upon the Secretary of Agricul-|Lowery next Thursday afternoon,Jan-||Congressman,Britt.of the Asheville plan failed,he said,there was no.es- tire-giha_report_on the amount of juary 13th,at the usual hour,2.30,district,who was Third Assistant|‘ape from compulsory service.Every potash available in this country.Considering the weather Friday Postmaster General ander the Taft|,:ountry in Europe,he added,realized The strike of tube withers at the {night.the V.P.Cy was largelyattend-administration;has -introduced-a-bit p‘nestrath of this,and England might} lant!'a?the Youngstown (Ohio)led.:The work of the gvening consist-for a flat rate of one cent on ‘all drop|Setter’have’realized it sooner:Peds mene .wo ee were ae ott ee (&4 of.a debate,by six boys and the letters.In towns.and cities.where]Gen.’Scott’s©statement that the currgting week ago,has been’declared ranestion whe,Resolved,that a cow |there is free mail:delivery,postage|:ountry would need an army of nearly| off.The strikers have agreed to ac-is more benefit to nan than a horse.”’}00 drop letters is 2 cents.Mr.Britt}2,000,000 in the event of war was ewok asapans’s.offer of apptoxh Weat negative was awarded the decis-|would cut this in half...He says one}questioned by Representative Antho- 8 aria Rane pion.The question for debate next cent is ample to cover cost of deliv-}uy,who asked if it would not bea phy- J) _Linimenos ely )per cent.“increase In vee lPriday evening is;“Résolved;“Phat coe}PN py ome a s ,-|3ical impossibility for any power’.to Victims of the recent —northeast education is better than non-co-edu-|Capt.F.W.Ahrens,for ~yerasva }and 500;,000-men-in the..United States!_- gale that swept the Atlantic coast,or |cation.”prominent citizen of Charlotte,died|"n a period short of 60 days.Citing at -Bruises——Rheumatism——:j "oat injured by American warships which We especially urge members ‘to Wednesday,aged 82.He was a native}table prepared ‘by the.war college are Wa¥ing extensive maneuvers while|ecome to every meetmg and take an of —Germany.In Reconstruction|jivision of the general staff under Mothers:‘‘Kee i ne” late of August,1914,Gen,Scott said K ee 8 bottle in eave home en route ie Cuban.watersto winter |interest in this work;and we also ask|days he was mayor of:Charlotte -b; prac 0.big black whales \were|that if there are any new members to|appointment of Gov.Holden .|}Austria-Hungary had i ~ 'Sms.)a :yn ..Austria-Hungary had the ships and Price 25c.,50c.: wae afane .at,Cape Hatteras aa to our ne list_we woule ar carne France,his wife and two men to send a force.of 72,000 in a ae and $1.00 ~::Ble o receive the names at any of|children,we i r st first expedition and 108,000 i 7 :cE a eee tmean Te Te TT ae Re SP rie orth Carolina —special \tax/our-meetings.struck fe ay ats wien deel ide ore 60 aoe.France,be:Pet a DaeDa De DD De DD ml hondé,issued by the carpetbag Legis-;"We wish to thank the Twentieth|ing near_Greenwich Ohio ——--fad.could send 160,000 men in-the first SaaS NSO Sa re == lature fand ,afterward repudiated:by |Century club of Statesville for the use SAD Ko sxpedition and German 387,000.FDR TR OT ENERO EAT ZO a ad Cat) ;ai the front.This)of :octi F 1 Card.of Thank i 2xp y 387,000.%; the State,are again to the of a collection of more than fifty good)Ww.esi ,nee j Foe ecpa aren ad py ¥: the Sta areoFcen offered a8 8.0:Qocks,furnished "Vance.community |iwi¢Wpdsca‘teOtatia'the wines Wed]ge,EelCe Een xv ap TPT. nation to the State of missouri.They through Mrs.I.H.Whitting.death of our wife and mother..wv Mrs,Martha Wilcox,Gowanda,No Va BY : probably will not be accepted.Saturday morning a crowd of boys Pp.L.WATT AND CHILDREN,’\writes:“T first used Chamberlain's .Cough|}:VE : Fifty students,members of the Ford and girls gathered at Vance.school Stony Point,N,C.|Remeily =o SE ae eta ‘AS tat tee i t time.It proved to be just.what I needed,It s ¥ peace’expedition,have left the party house for the purpose of preparing = Pon fstterdarn.‘fvom where they will}wood for the use of the club members.|--TWELVE GRADES “lordke up ‘the cold in a few days,and the ‘er "< ~,sail-for New York.About 100 Amer-|The girls provided lunch and several Pine,Cedar,Cypress and Tin,$2 er la ee ee roe aeuin ‘idan mgmbers of the expedition re-|kodak —pictures were taken while on|per M and up.,asing this medicine,and all who have used:it ‘main in-The,Hague.Most of of them|the ground.There was lots of fun SHINGLES!speak of it in the highest terms.”Obtainable er sail for the United States fangs [ene we can ere call it @,regular C.WATKINS,Next to McElwee’s|every where. ye :kold-time wood chopping.“Come on,|Planters’Warehouse,svi -C |RRpoeT-oP..CONDITIO Lainie)Lueas,author of the song,|Vance!”Show the people that we are Statesville,Nag REPORT-OP--CONDITION 3yandfather's—Clock,”andsknown-as,still with them and ready.to.do—our REPORT OF THE CONDITION:mrwe°"Meréhiinits"and--Parmers’-Bank e of the most original entertainers|Miss Henkel at Vance Today..of the 4 nt Statesville,in-the State of North the American stage for nearly half;Today,14th,\at 1.30-pe cnt,~Miss People’s Loan and Savings Bank,‘at Fe ee Mega : 2 ,,Carolina-at:ose Of Business, EV E S if RE E T century,died Monday at his home |Celeste Henkel will visit.Vance school Statesville,in the State of North}December 31,1915 --*ittNew York he’¢f 75 house in the interest of the.Girls’‘)Caroli ;i ?5) :in New York,at the age o years.|house in the interes of the.Girls’.To-arolina,at the Close of Business RESOURCES.EY ane continued an vaudeville until a mato club.Every mother and daugh-Dec,31,1915.Loans-and discounts RY ‘month ago.»:ter—in the community is cordially-in-Pe --RESOURCES.Overdrafts,unsecured By ic Shy nersons whose _homes vited-te attend.3 aan:;ee $132.866.18 All other Stocks,Bonds and Mort By f{business were burned by Mr.C.H.Beaver,who visited,his |9 ees 5 SRA aes .200.00 re “Rast Youngstown,O.,.re-mother,Mrs.J.S.-Edwards,has re-Banking Hoyses,§of are ure and xtur 3,067.7 Ef .7 ’ture ¢ox i o Demand ‘loans 7,374.43 15 “ure and fixture B 16,464.10 ss estimated at more/turned to Fort Valley,Ga.,to resume|Demand Loans sc.cicec sie st *Too1g9|Due from National RY haa ($1,;say they will be un-his position with the Miami Fruit Co,|Ove from National Banks ....-...17,007.88 pseu vette cpt \es | able \te'pcollect,damages.Insurance _Due Tom State banks and bankers 6,5.76 ee ong os RY 5 os ~epmmpanies will not pay,it is held,:eee Sachi liens eens ":-an;a d neither the State nor county can Silver coin,including all minor coin eo or E|Top Diameter 30 inches,6 inch pedestal. Ae i “uorre .-ver coin,€r>+° be held;liable.Nationatibank ‘notes and other U.S afl minor coin cur-BY Polished or dullfinish.: foe request that.he _nOtea ae acs rencyee 1,026.38 {|e . w his name to be placed on the bal-a National Bank notes A ; ..eek : a 3 ite nN tt Ipt in the Minnesota Republican pri-Total)Wea yee es iattahas Sls Soeee 3 PRICE...-.650.-cee eee eens $10.00 maries..as....candidate for _President,LIABILITIES St ore et Col.Roosevelt.said:“I cannot consent Capital.stock paid in ¢..$50,000.00 Thtatee ee eeeee $277,500.38||g -~AT = té*have my name filed in any prima-Surplus fund |:4,000.00 .LIABILITIES,;O-et .oz | 3.What IT am trying to do is to Undivided profits,les Capital stock paid in.........+++-.$25,000.00}ES ‘:Zz 8 is “4 Seana penses and taxes pa Shrplus fund ....---.esese reser 8,000.00 |(Ee TY is r : fieht--fot straight-out Americanism.|Notes ESTE Benentee ae 11 Undivided profits,less current |Ry THE STORE THAT ALWAYS WELCOMES YOU.; m not concerned whatever with any Deposits subject to check ..,.expenses and taxes paid .....---2,150.97|Eg :ro Dividends unpaid.....ceeeee 1,016.00|1}{ Time certificates of deposit . Savings deposits Cashier's checks outstanding Notes and bills rediscounted ......1,000,00 Wis payable ......-.5eeereteeres 35,500.00 Deposits subject toipdividual,myself or any one else.”| ‘A mass meeting,followed by a dem- Crawford-Bunch,Furniture Company.| stration on the State capitol an aoe aa ak $113,780.43 iE i ‘ounds and a parade,was held in State of North Carolin ‘Gounty of Iredell,$8:Time Certificates of .IFS hi ie i »Penver,Gol.,by sevéral hundred peo-I,O.L.,Turner,Cashier of the nbove-named|_Deposit,--..--+-++:63,511.56 \TMCAtN?MATT NENT?IR NE NONI tHe nepresentin persons.unemploy-bank,do solemnly swear that the above state.|S8V'NES eee oe 33,872.84 “|--7 :ncn a as'a resulto *prohibition.Colora-eet true to the best of my knowledge ued Bins eee 2 51R.19 i ee —.w ‘a : -do became a_-prohibition State Janu-ae et ar ee Cashier's Checks out-0 MESS, :j 1 i <4 eet oF ea gtanding ....-.+-:-739.11 i pots S my Ist,and judging by.this demon i Subscribed and sworn to before me,this A Rein go set ,33.31/18 I M y |{Th S M tI bay ration “some of the boys are taking)12th day of January,1916.Christmas Savings CTub 161019 204,860 1g ;n an ns ances ‘e eason S os m a thifte hard;~-They-are wasting}oe R.T.WEATHERMAN,|rpotal oo...2s eee ee eee $277,50 3 P L Th H If t t Sal S t :ee Correct Attest+-——Notary Publie—State of-North Carolina,County of Iredell,4 rices eSS an a por an @ on ul S bea ,YF c eo en eee a pags tn ele dhs ee a me.W.A.THOMAS,i ..s J te eae ,F.B.Bunch,cashier of the above-name : Representative Buchanan of Iili-Like aGas Jet ce La cone Bank,do solemnly swear that the above state- Mis,who unsuccessfully sought the .Peer anaiG TNS CUs a ore ment,is true to the best of say Relate andy i : Adoption of a resolutionto have the ;::A ae a ee .,B.NCH,Wy ae :>q +hE s een e Cashier.4 diciary-committee of the House of fe?]O light the Rayo REPORT OF THE CONDITION| gubscribed and)sworn to before me,this)# mgress begin immediately an in-f lamp you don’t of the \tth day of January,1916.J..CARLTON,8 e Jotary Public. duiry into his impeachment charges -have to remove the Commercial National Bank at States-|Correct—Attest:J.A.KNOX, inst United States District Attor-;Fille.i .7 iv Mars all ofNew York,withdraws shade or the chim-ues ae ~~ape eS E.BR.WATTS,. se resolution with the understanding e t lift tk l-ar Ae eee L.K.LAZENBY, si te °5 7 Nn Ve ust }1 1e ga Dec.31,1915.Jan.14,1916 Directors. t he might<present it later in dif-lery aad toch =a Senoubns an.14,1916._ nt.form...»;a S ,.THE CONDITION | Shipments.of gold into the United match.It is just as.eae i ity ‘escent nee a OL ee seine ONO 5 States during.the calendar—year—of i ory OVECITATIEG Ge lee ene ean inna ee:.ae ' 1915 aggregate in value the enormous easy to light as a gas U.S."bonds deposited io secure cine |Birt National Bank,a Cauchao dam of '$450,204,000,representing,the »burneranditrequires sceafilationtharvaluey”<o---.2 Teniona.0n)in the Se eee eee ~~et rest —P the preci -metal—“hes eo uence ae securpties othe .8.bonds.:the eit siness ne.OY,EOto.: iene aS est_amountofthe precious metal Tittle effort to keep it Jt er sine ete ove msrp act ee time,A ae Ae eae ff iy previous 12,months of i ;istory-|clean.Subscription ‘to “gtock of ae :te Loans and.Discounts fexcept those eee 4 | 1 .Federal Reserve Bank *#,500.00.shown oan b)...----eeeereee $056 NON j Less amount unpatd ....3,75 Value of banking house (if unen- cumbered)tee 28,500,064 0 Furniture and fixtures ~5,000.00 walue)©.---ever scr se:$100;000:00 Net amount due from Fed U:S.Bonds pledged to : normal times,before the European ar broke out,the importations of d-ranged between $50,000,000 and 75,060,000..Saar 0.00 8,750.66 Overdrafts,unsecured poeodouconns 'U.S.Bonds defrositéd:to secure circulation (par ‘Ofall Women’sandChildren’s Coats #An,Itatian~steamship —arrived in}—Se --b cec ag |becvte U.--B..deposits, Naw.York a.few days ‘ago with two!|NECA TROUTCet CHT rt ee fommeSe 1 (par value).---see.30,000,00--130,000.00 Hash-AuHs mounted:The steamship},approved reserve agents Subseription to stock of j ae “ig a passenger vessel and the United’Lamps aad ae fibuw ocr er eng KS gON TSEC;.: roe pe <1 and St.Louis .7....2.4,835.32 4ess amo’ee ee ort eae Ci AS ates:government has notified the!|Net amount hie from ne Value of Banking House (if un-‘and Coat Suits. ;Var.authorities that the gunsmust |are th e mo d ern |approved reserve agents encumbered)os.cece ee reer crete 32,000.00 Hs be .dismounted*before the vessel|1 f Ket wit other reverve cities aactay.t1 1821 dcanand Piste ii ee 3,406.09 |.é ; a1 tise sie nder international law |amps for:e tarm.Net amount due from banks and i.Net amount due from federa Cee P d t g t th 1 ,(Rearend have the ri vht to ern .P .°7 bankers (other than included in werve Bank 2...orp eee ee ee eee 12,847.86|rice re uc 1ons are rea er an y Sa acrertine cies Un Simple in design—i Ca iene nanan in 57.799,93 {Net amount due from ’ 5 E )rposes,D |Other cheeks on banks in the sam o_—approved reserve agents ~\ vernment will not give clearance|yet an ornament to etcT foun as repertiag bank...3,747.52 {.im New York,Chicago 3 ever be ore. ".°ena ost S tside ¢h s re -St,Louis ..-.----:§2,759.37 : Pera passenger steamers carry:|any room 1h the ‘cash ee “ees 2,379.09 Nae ean ive from .¢:: -“eo }Fractional currency,nick-—y approved reserve agents ;. tates eee Court of the United house.|els,and thts 70.58 2,449 63 im other reserve cities .,2148.83 26,4030 ‘e e tates G)rmed the,$4 500 judg-|°.Notes of‘other national banks ....1.750.,{Net amount due from banks and , f .North Cz Pees J g-|UseAladdin Security Federal Reserve notes ......Sethe 1,000.00 bankers (other than ineluded in 1 or :ni 18 ours ment,of the North Carolina courts In ;a Cae Tale TeseT Ne ,OGREtI);' vor af it Horton,an engineer,|Oil or Diamond bank =,Ouiside checks and oth.: gainst |dboatd Air Line,for in-|Whi 1 :|Total coin and certificates ......12,357.10 |cash feems %...sabe.7,908,66 = ries sustained by the breaking of a!b hite om fee [researc Ee ae 1,600.00 ea .e er \.7 -oO |}Redemption fund wt Treas-nickels and cents ...5--326.27 . ater glass on a locomotive.The |est resi ts in |urer (fot more than d per cent on Notes of other National Banks Reduction without thought of value. e ic cart sbas ne peer e ve Stoves,Lamps and:|Sra and dve from.U.S.Laie -ite:ee tes .....+---Nese {“a or Cardlina courts in favor 0 FENSUTEDIN al eee riers 5,000.00,Legal Tender NOLEB eee BO 8,009.00 cee ‘ W.L-Lioyd ine on wat Heaters.|:Pyne Redemption ‘fund with U.S.Treas-‘i ©;t \ i ae an es the Southern rail-.:Wdotal yeees $613,585.01 |urer.(not’more than 5 per cent any re uc ions are ar ess an ,hil or $12,500 for injuries received The Rayo is only one of “~§-LIABILITIES on circulation)and-due from U,8.r iG 2 rine en-x oi *S Treasurer ...-.cece ree pere erent?5,900,06 ,(—is ‘G He sere)ne engine from Spen ,our many products that are Capital stock ald in oo...eee $100,000,00 Teeee daca ;2 100.00 4 er on a trial trip.|I .Surplus fund ..ceseeeeeeee 26,0000 5 f 99,580.37 |! 8 wi;a known _in_the_household |us fund veveserseeeeeseen eens 36000100}|Total veeeeees 599,580.37 e ee “William Barnes,former chairman :2 Undivided profits...2.13,034.90 LIABILITIES.—*mel 3 :|ae f the New York State Republican and on the farm for their ere ane wean 1 stock an i,$100,000 0 |ce }? ‘*4 1 interest,a os Gapital stock paid in ....--,-+++e+-1,000.00 i mmittee,declines to be a delegate quality and economy.eg ees 9,125.98 3,908.22 Buraluis “Tand ees a.ee 38;000.00|:,a fo the national Republican convention|Ta |snotes outstanding .....100,000.00]Undivided profits :|a?3 Because of the possibility of Col.Ask,for pen seein eae to ean ai bankers (others ».Less:current expenses,‘|1 {r SS +)p iA.|ou are sure of satisfaction.than included in 28 or 29)......3.261.07]interest and taxes paid .12,894.95 17,163.33|ne 0 ores a e 0 Ss ‘So aia paia gangidete,Powe y Sndard H hold |Dividens unpaid enc 4,000.00}Cireulating notes outstanding «160,000.00|s “4 | t ‘§2 8 5,he Says,|tandar ouseho ndividue depos bject to check.147,816.69 Dividends unpaid .../...-..r eee ee 700,00 |::a 3) “to bring about the nomination of|:Vobuerat eet f checks outstanding Ramee 126.02 |Individual deposits subject to check 198,093.42 |*~PHON E 912 ' posevelt.It was Mr.Barnes who =Cte oeciena ees Xertificates:of deposit cue in less ;|i .i BA e :: Buc j 5 “7 ;ss Rae aaa a thin 80 days ......6-,eeeeres 5,568. Sued Col,Rodsevelt for $50,000 for Matchless Liquid -37,8 and 39..._'Jeashiers'checks outstanding ....+++4,336.16 |_—"=‘:; axtine F ;y pel pod.dome te suit.iNsturally he Gloss ~,RCE Ot BER +19,558.25|Unfted States Mepoaite...6 fac cot S)28,289.12|SAUSTRES “SAL eT —Ss ;a a5 not went to sit as delegate in a .(eee BE CDOs ILA 262,461.19]Potal |demand deposits,iM |ISTEE’ALE OF j N ! Paige Ne,5 \‘.Total of time dep (6 ¢°9 :\x OTICE TO ONTRA 0 °;se-!::ine \Items 32,33,34,35,,eee |sare ick |:a pnvention’that may nominate Roose Standard Hand Sepa-Items 40,41 and 42...82,0194 36 87,88 and 30)....$246,277.67 BY VIRTUE of,the powers contained:Mint 5]s elt.-i rator Oil pereeeote wn Benen Certifieates-of deposit 57 5146,062.93 |decd of teust,executed by Mi In.Gowan and “conataieton Ot...eT .©.Bulger,‘convicted of the killing :cee ube eat pe,82,448.75 Total of time deposits j wife,Alice Cowan,to Dacia a.Craig and.the!Sealed proposals for the okie of ; 7 ‘aes §§$-42 96%1 'y ;f Lloyd F.Nicotemus,a Daves Parowax {|Notes and bills redis Tiems 40,41 and 42..,.146,962.93 Henkel-Craig Live Stock Co.to secure the.in-drainage improvements in Upper dle Creek Bol i a tha :E dp .counted elsewhere than Rediscounts with Federal Reserve debtednesw ‘therein nentioned,sald deed.of Drainage District for Iredell,Cabarrus and 0 a hote’AN jas been declared *ureka H ness Oil at Federal Reserve BeHR Cl ier ieawer see eeos 118,476.44 \trust being recorded in Book "36,page 566,of Rowan counties,N.C.,will:be received by the.gravy e@ by 4a jury appointed by the Col-|Mica Axle Gre ee frelud cess 41,002.40 123,451515.)Bille payable,including obligations the records of deeds in the office of the Reg-|Board of Drainage Commissioners up (to,2S* ado Supreme ourt inquire into!;£ase Bila -Feynile,teelaog,obiteations bands representing méhey borrowed ...-45,000.00 \ister of Deeds of.Iredell county,N.©.,de-wegen ii ee on ai ae ony,of Janvaryy,‘ ht ition.The verdict.;-&money borrowed..24,000.00}:°":cremate |PAUlE having been made,in the payments of the|1916,at the office of %V.Turlington,Moores= mental il ie Rants tant ;i your dealer does not.Total seiksenat Total oie.s..etateegvesSigal $790,580.37|indebtednoss thereby secured,the undersigned!ville,N.C.‘This work consists of about 11 / u rp wt :ne ave them,,write to our rel eae ea aa ad as ae 613,583.01 |State of North Carolina,‘county:of,Iredell,ss*|trustee will,on P miles .of..diteh..Plans and specifications are’ the”Governor Anter-|nearest station ees oe haath,me County af Iredell,ss‘|°—I,Fe A.Cooper,president of the above SATURDAY,FEBRUARY 5,,1916,on file at the-office of the clerk of the Superfor pag Sh *\ mit jury handed in the |a Re oe samed bank Piensa eR aN gee ere weeerat’we teas Te baat ot a a 2 oles:Ms welt ak wablie eee a a“Court.nt.Statesville,Ne G.ey x 8 :ey ”a ne ank,H §e is i oO .af,at oor.in}(“payable to 2 li 2 it read insane.Bul |Ss ANDARD Ol.COMPANY above statement is true to the best of my|kirtowledge and belief.R A.COOPER,-FEA eit coming,fir Tak thePh ig Acheter cone)By,pate ae %4 led and his attorneys hurried |(New Jersey)knowledge and belief.D.M.AUSLEY,4 President.|jowing described lots,towit:ven ,aes ie ‘eine’terete iat mosomipee ‘the bid he tulate him when the foreman|”BALTIMORE ::Meld Cashict,|Subseribedand swotn to before me this |)Two lots,Nos.47 and 14,Block C,of the the Board vasaroes:the vate’to fet the eke ‘gald ‘the wrong slip had|.“Subscribed and sworn to before me,thie |tith day of January,1916.J.F.CARLTON,|Cowles.property in —southeast Statesville,50 nih All.bids.vy “aii rs L t in the envelope—that their Washington,D.C.Charlotte,N,C,10th day.of January,1916,J.F;CARLTON,,|Notary.Publics!feet on Reynolds treet,and 60 feet on Harri-)*°°"ite “JL AL ORAVEN,\ p Norfolk,W'Va,Charleston,W.Va i Correct-Attest:Notary:“Public.|)Gorrect=-Attest wshieys <scn pon street,Fi ribetter description.of ithe,above!j..,”ciate i fie we "Rp amt 4 After.some,/Ridhmon’,Va.Charleata:SC.BL RRE.|,FREONG W.DE TURNER;*);ea A,1.)BA 4 .eo map of the Cowles property,registered in Sy WES SMITH 5 .sent ‘outanid}:,v Hite opanids oF,Ws B.MILLS,t wah g Wwipdrg 4 Ati Hit as aA of Iredell courty,y A.Ly DEAL,J 7 “ de gi ta tinten cep aoe AMRMIRODLUD)cc gamer on sau WwW.T.Bio’i 4 165,7 Rayneyap ernceni owning atspean “yendict.leaidhc ,,,'Jan,14,1916,"\Dirdstorst’#ofans 14,1918)edd ae aDireetaries an,4;Y9TB,yy So a ei traatee.-1--Mooresville)Nr-Oy 0-3 ‘nc : wie snc es genetic ':ccd 4 w Be a Re ES omy wie ero Ft katte bk Se =Tea i i j te iN 6 TUE Hk 2 BRS AAT UOT HOU BAe aes 4h BWR Se eh A vt a ae |RTEiliovs!Your liver is You feel’lazy,dizzy and: ‘out.Your head-i3 dull,»is coated;breath bad: gour and.bowels constipat t don’t take salivating.calo-t makes ‘you sick,you may"3 work.”:nel is mercury or quicksilvercausesnecrosisofthebones. fe}crashes into sour bile likemite,breaking it up.That's‘ou fee)that awful nausea and you sick. medicine.| ing fine,your liver will be Eowall regular,You will vigor and ambition,Dodson’s Liver Tonevegetable,thereforecannot.-salivate..-Give-—it children, is mp ee ee If you want to enjoy the nicest, gentlest liver and bowel cleansing “you everexperienced,just take A joonful.of harmless Dodson’s.Liver ‘one.tonight.Your druggist or dealer sells you a 50 cent bottle of Dodson’s Liver Tone under my:per- dangerous calomel now. 4 Ww your headache and dizzinessourstomachwillbesweetand yourfee} working;you'll be cheerful;ful of entirely harmless,and to~-yourMillionsofpeopleare1s; ing Dodson’s Liver Tone instead ofYeurdrvg- gist will tell you-that the sale of cal- omel is almost stopped.entively here. ELS GENTLY;Oe FRIDAY,-+January 14,1916. ‘Liver is Sluggish or —son’s Liver Tone.” énal.monéy.-back guaranteo thateach8falwillcleanyourstug-gish liver better than a dose of nas-ty calomel ‘and that it won't make Dodson’s Liver Tone-is real hverYou'll know it next,morn: ing,because you will weke up feel-ing,gone, like \PHELANDMARK THE STATE WILL BE HEARD Gov.Craig Discusses the Injus- tice of the Recent Change in'Freight Rates —The ©Case-Not.Settled and,the.State Will Be Heard.In a further statement about’thefreightrate,Gov.Craig says:“T have seen it stated in some of thepapersthatNorthCarolinagetsafa-vorable differential of 7 cents overVirginiaonfreightgoingsouth.Thisisamistake.We get this 7 cents dif-ferential on first class freight.undertherateframVirginiacitiesonlyto :limited territory,.which includes At- entie Noc2 oe as,fone aerate “Tf.we are entitled to an advan- tage over,Virginiaon freight going to ‘a Kmited territory which includes Atlanta.’by the same principle we are entitled to an advantage ~over Virginia on freight going to‘all pointssouthofus.This differential of ‘7 -Ys all that could be desired.“We have it in _Knives,Forks and Spoons of all sizes and-in.sev- eral different designs,at the right prices.We have Catalogues and price lists we will be glad to give you. R.JEWELERS. Gorham’s Sterling.Silver H.RICKERT &SON, 7 cents to ‘a limited territory which in- eludes,Atlanta’is insignificant.Is it a son to Cerebus?*“These cities in Virginia:that havetthesanieratethatwehaveonfreight ;going south,are on an average 189|miles farther from,the southern mar--kets-than-we are.The rate on firstclassfreightgoingtothesemarkets “rom Virginia—is,I believe,about 20feontsahundred’miles,‘On the.ratio of the mileage,this would give us a rate to these southern points of about40centslessthanVirginia;that is, if they have a rate of one dollar,on this-basis we,should have a rate of &9 cents.’But we recognize the prin-riple that the rate-of the longest haul Progressives ‘to Meet -in Chicago} \==Hope to Unite With “Reps.” ‘Lhe action of the committee was tak- Bg The Statesville Realty &Investment Co. “ae ==INSURANCE!2= contract of the policy which they buy. -valueless,.viz: _As a great many policyholders do.not seem-to know that their insurance will be void under certain corditions named-in theWe.deenrit-advisable to mention some of the causes under which the same will be rendered 1—Vacant or idle property for longer than 30 days—apply to is somewhat less.than the rate of the];shorter haul.Conceding all that can be claimed in favor of the longer haul,we would certainly be entitled to a rate as)much as 20 cents |less than the Virginia cities on all freightsgoingtothesemarketssouthofus—|teortainly an averagelof 20 cénts less--some cases more;some cases less, Insteed of this our rate on freight tcoing:south_has -been raised alongwiththeVirginia-cHies-16-cents and kmore on the htndradexcépt to:that |dimited:-tenritery which ireludes>At- [Ionta,!where we get the insignificant differential _of-T—cont;———: |“The fact that North Carolina has United States to help end the Euro- pean war.* all Europe was ready for peace,L belligerent nations most of all,if it lrifice of dignity and standing.Five The national committee of the Pro-gressive party:(Bull Moose),in ses-sion in Chicago this.week,decided toholdthenationalconventionofthe]party in Chicago June 7—the week of |’the national Republican —convention: en in the hope that the Republicans 4nd-Progressives’can agree ~on they same candidate,>...Forty-seven of the 48 States wererepresentedatthemeeting,The com- mittee adopted a declaration of -prin- siples in which the administration ofPresident’Wilson was criticised foritsallegedfailuretodealadequatelywithnationalhonorand_industrial welfare,and the Progressive party went on récord as favoring a complete preparedness programme,consisting of military’armament as well-as a nobilization of all the country’s ©re- sourees with a view of the unification ‘of American citizens.A message from Col.Roosevelt urging the neces isityforadequatepreparedness;*"Wap4’ onthusiastically applauded.Progressive leaders declared that there would be no amalgamation with the Republican party,even!in the event of both parties.choosing the same_presidential candidate.Many of Republicans will nominate Roosevelt “nobjectionable,and will put in their “latform the salient-features-of the Progressive principles,both parties will unite on.the same candidates in Chigago next June. ~Women PleadFor Peace. a Speakers..for_the woman's peace party,headed.by Miss Jane Addams of Chicago,pleaded with the Senate ond House ‘committee on foreign rela- ions’to enlist the strength of the committee theMissAddamstold‘the could.be gained for them without sac- European -neutrals.—Holland,Swit- zerland,Norway,Sweden and Den- mark —had assured her,sae.said, they would participate in,a peace eonference..of neutral nations if -call-ed by the United States,and two ofthempromisedtocallsuchaconfer- ence $f assured that the United States would ‘participate...The-speakers:urg- the party leaders.declaredthatif they) or_any-other-man-who-is regarded=as}"~ “ THE UNIVERSAL CAR 2 Carloads of Fords Just received two carloads of Ford Touring Cars,Start the New Year right by buying a Ford." 4 4 Sic‘Carolina Motor Com’y,ffStatesville,Mooresville andNewton.A a Practice Economy This Year!° Feed Fdgar-Morgan Co's Mixed Feeds Not screenings or offal,or Old Beck-Sweet Feed.worthless by aetna but se4410Ntoed.lected feed:scien-Little —ane pet ——fifieally blended Manna-Rice Chick Feed.~~“for results.te;4 ‘by a house with}; Semcdctatsh nee A reputation forGemSweetDairyFeed.integrity. CW.BOSHAMER,-Local Representative, ’*Phone 125 Black.- if|ay tea-|8 SSG Bias,at ORoemane |Men’s &Women’s Hosier’ — Men's Shaw Knit 25e.Lisles,all shades, SALE PRICE ~~190: t|%WT a. Women’s 50¢.Silks,White only, SALE PRICE Women’s 25c.Lisles,Tan and Black, SALE PRICE WC SALE PRICES ARE CASH.| _SEE "WINDOW DISPLAY- ——'PHONE NO.83.a 190. 4 ° their wonderful bargains.—ad. |SHERRILL-WHITESHOEC peers; OF STATESVILLE,N.©. Capital Stock Paid in -«$100,000.00 Surplus and Profits $1,500.00 Members of Federal Reserve System. e220 wees Your Banking business solicited and every accommodation extended to de-. positors consistent with prudent bank- ing methods..*| Four per cent.paidontime and Savings « Deposits remaining on deposit three , months or longer.Lie e ‘OFFICERS:_W.D.‘TURNER,KE,MORRISON,D.M.AUSLEY,|-@.E.HUGHEY,—"Assist ro . WELL BUCKETS,STOVE mm your agent for permit.ie lheratofore paid on this freight goi ‘o 7 cm -"2—“Mechanics making additions to,or_extraordinary altera-ae ee Bia ee ater a viogiie ed the adoption of a joint resolution i a wal :‘fEAeE Een aE UI ea ec Metre ae introduced by Representative Curry, us tions_in_or on _property—always get permits from agents.ia_is no reason for the injustice to|:oe 8—Property upon which there is a mortgage unless notice of Sana Vi On Lok Les saan epee we hick would empower the President to *~samé is given—apply to your agent.::fpontinue.eye batebied aiead Statat |invite all nations to send delegates to 4—Any change in the title or ownership,or interest in proper-ee Beene sarin Be the|1 Convention to provide for disarma- Bar rates y is ment,create an international Legisla-ty insured other than by death..eels he ahd per nein eet!Y Roe t t ternational Legis! 5—Assignment or transfer of property to another.Fed.Pee ete Seon RE ture;court,army and “police. Rehee or etka dasmancerwithontnotices ¢"nvr geographical location on freieht|MOTHER!GIVE CHILD a $Keeping,explosives on the premises without permit ather pide ees of her.We “SYRUP OF FIGS”IF an kerosene oil.LOY otk oog ae i.|1 ‘.' pe Exoperty encumbered.by chattle mortgage.ee ie oteami cae on TONGUE 1S COATED! olicyholders should read lings.7 to 30 of the-printed contract eneaaente sae oe Tale Te ne Br |.Ravariah.Sie ant ;of their policies.It is impossible for agents to know of these de-o&;and ee pe or,need if Cross,Feverish,Sick,Bilious, i ficiencies unless notified.Call an us.for any INSURANCE infor-Te are entitled to that market,and}(lean Little Liver and .Bow-|amation,ee feats entited 20 tho,sdvantageaIh|ole,cl FE “CARLTON INSURABLE.|situation.é st ‘Children oe ae “ara Tastee i Ri?]N M ;}“The railroads inthe past have hy|Aand no ing else.cleanses the tender J.ee A O 9.anager,ithe arbitrary fixing of freight nate ztomach,liver and bowels so nicely.| :PHONE 64.STATESVILLE,N C.seated and destroyed the -busines#}A child,simply will not stop play-j g |~rosperity of cities and communities.|ing to empty the bowels,and the re- =95 ————____—-—a Tie Inter-State Commerce Commis-+sult is,they become tightly clogged LR ORAS f ceepececocecroacacconmecsasatre,|6/0"our corporation commission.arid}with waste,liver gets sluggish, a an ;a qq |like tribunals have been established stomegch sours,then your little one ;a ito guarantee.to the neople fair deal-|becomes cross,half-sick,feverish, ling and equity according to their nat-}doesn’t eat,-sleep or act naturally, ey Ree 8 er ]Ca @S ()@ OSI]jvral advantages,If,the cities of Vir-:breath is bad,system full of cold,| c 7 e aay cs “Ay joinia get an advantagebyreason of|pas sore throat,stomachsache or!4 \:itheir-tocality,and we do not get an)diarrhoca.Listen,Mother!See ss :Heeiee ce iceeeas co a re tongue is coated,then give a s‘.|thenwe eannof competeon fait terms epoontul ot “California Serup off :E -ithrive and our-people—will not pros-Pe i poi ee Le a merere ae i Issued by this bank bear interest from H |ner ag they -would under equitable con-patie ewebd of the eet :Hi ditions,:araat =:rate date at the rate of 4 per cent per an-3 |“There is a @reat deal of freight—and you have a well,playful child) i eaany oimen linea shipped to voints Tons of mothers’give.“Califor-|# .‘at lsopth of us.That section would nat-|.,*ns AO Ue TEAS.mye |8-nhum.Savings Deposits 4 per cent,ioral leok to,us as the source of sup-ie Syrup F eee it e pare 5 .5 :Bly,for furniture.cotton—goods,-bae-[rectly harm ess;children love it,and|& ‘creditedquarterly.=Hing,tobacco,fruit.cabbages,etc.We|it never fails to act on the stomach,|g 2 ee :-:yi nre antes on all of these articles ae Ri beasts ee 50 |Z ie pic Blea 8 fN ee sea =se :i B te-a-much-lewer-_rate-than the Virgin-|Ask your druggis or a_ov-cen we ."rn es Ee a }&woo png eg :3 Checking Accounts Hiacities.fone ______Ngottle-of “California Syrup of Figs,”|® ::H!“Ror the last few years it has been|wWWich has full directions for babies,|/% y ::7 ee se should —produce a}children of all ages and for _grown-|@ f .=:ce 8 isurplus of corn,hay.cattle,meat.Our|ups plainly printed on the bottle.Be-| a =_either large or small cordially invited.ee as au Ls ann and sara ware of counterfeits sold here.Get|# .erecta!-#Department of Agriculture,the State|the genuine,-made by “California Fig:2 ‘iph 2 We want your business.pi oret and all of us pave been trying;Syrup Company.”.Refuse any other|‘ he me :sito induce our farmrrs to pay,more|yj rf >: q ope eo genige eae Ve a ee Hiattention to the.diversification of’Mpg.with:contempt -ie i Hlcrops,and to the cultivation and the “9 ,oe Ne :Hinroduction of such.things.We have ’"i cop é S oan ahi aVINgS an +e begun jit.-North ‘Carolina is develop-] :ee 3 inc rapidly along these linés,and in a }oni =—eee s te years she will come to be a State.fF.: /Bye x q e Bi under propér.conditions,that will - a a 'OF FICE US::8 largely exnort meat,hay,grain,and ‘.as ae :Hien increasing quantity of apples.The |4_‘‘ a GEO..H.BROWN -President.cities to the south of us are our nat-ae _..0O.Ly TURNER Cashier.Bivval markets.We should have for H \ihese products an equitable rate,oth- i ae erwise our farmers will not have the :: saath tat praper encouragement and that de-8 enema -a|velopment and growth and prosperity e Hib nay ae a..tae will not result which is ours by right.|] .7 “Nothing should be left undone,and %fos nothing will be left undone to guar- Cc;,[8 [\I N |(iS ile ie our eons an equitable tate ay ;on that large bodv~of freight produc-:21 :2 :ed e North Carolina moving to the We have provided well ;:oe 2 south.sv “LL By en ee ::pe ane ee “TY wish ad Virmnia the greatest with Flowers for all New :vrosperity,but I do not desire Vir-:- &4 rinia to profit over North Carolina by Year functions,and for bs :9 this arbitrary and ywnjust~arrange-/4-*4 HO W “~?ment.The advantages which they New Year Gifts for the Seder sy Sra TU CrHAuee havé by geographical position I would :2%)not deny.But I contend that North young ladies who are:al- ne a Carolina abou enjoy the natural ad-f %.‘:vantages’which she has by her geo-iative oO our Because we bought:before the big graphical “position.This right -is ways appreciative ot y Se ;«nlain.It cannot be denied.I do“not ;i yi y ADVANGE is the reason we are i believe that if will be denied by any thoughtfulness in sending !j creas 5 court that will pass upon it.fl>)°‘-;;wers.a \\EK “J.desire no contest with the rail-0goingtosellyouthiscarofWIRroads,believe that they are man i ..‘aged by men that wish to do the! }‘FENCE,which has just arrived,Soith justice.Their prosperity means ‘;AT our prosperity;,and our prosperity mr teeshy yoly means their increasing prosperity. (team ;On clear presentation of this question ° Reem.:e a clear presentation of this auéstion L dl Co of r 1 ‘he Old Price cnicenil it.seems to me that the men who con-an in ey 9 =4 ©trol these carriers must agree with us. “i en:I believe that they will.,No man canj{”GEEENSBORO,B.OG. aw eg ::;a lentes ‘of ey rnaciabiag ; eo Be .;f “The Inter-State ommerce Com-; ‘mission has put these rates into ef+Polk Gray Drug Co., }:ee :(pass =«fect,but has declares that the adjudi-Local Agents. oe Dama eS 9...]jcation..isnot -final...North ‘CarolinaIredellHardwareCom’y.|"ie2 ee et atin ark tgs ~*Hl 50c.worth of Coffee at SMITHEY|ADVERTISERS |will please:bring &FRALEY’S for only 25c..Other|change of copy early.No change of ee goods”just as cheap.Come and sec|ad.guaran‘e after 12 o'clock..to-morrow. We havein stock Well Buckets made up in any size. used about bucket.Any size or weight Stove Pipe +4 Also full line in stock,90 TIN CO.,A. ieie STATESVILLEVou"PHONEBS.Ae SR etiESMM Ne i aDa $6.00,"no a -;Men’s and ~One lot of Children’s Shoes,.ex- tra quality,now 49¢.up, Silk Poplins, BI.yd. $25 Ladies’Coat Suits,cut to -$12.50. i Regular 10c.and 12 1-2c.yard- wide Percales and Suitings,cut to 7 1-2c. One lot of.Childten’s Woolen Sweaters,regular $1.50,cut.to 79¢.:1 Men’s Linen Collars,15c.quali- ty,now 2 for 15c. ~Men’s $1 Dress Shirts cut to 69¢. 4 Seer _Ladies’Coat Suits,latest styles, values up to $14,cutto $4.98 up. ms Ladies’and Children’s Rain-. coats,value up to $6,now-98er-——F up.: 2 RW EURAMIE Oo Men’s Hose,10c¢.quality,now 5c. Ladies’Shoes,values up to $3.- _50,cut to 98c.and $1.48. Men’s Wool Shirts,values up | to $1.50,now 79c. a Ladies’Hose,10c.quality,cut to ale of Telephone Stock. The Landmark mentioned recently !POEaa en 7 ;HE LANDMARK “RRIDAY, --|January 14,1916. =—=-‘outside interests to buy the Iredell Mr.W Dunn,._secretary of he|8itions have been made ‘about this zat VY.3 ee eeeAgriculturalandCommercialsgciationofReidsville;Mr.F.| er,Argicultural demonstration agent. ¥Rockingham county;Messrs. McCollum,J.T.Amos,J.A.Gar- tt,“A.A.Walker,J.E.‘Newman| ‘J.W.Dameron,of ‘the vicinity of sville,and Col.T.pond pe “Asheville,agricultural agent of the-~;ty aithern aliway,composed the party;Ba into hostile h visited the Iredell Test Farm’);|. sday.The party-was-met-—at the,: way station by Secretary Gilbert, he Commercial Club and.Supt.Meacham of the Test Farman jat the annual meeting. hands—either the} = Goats,valliesup to. Boys’Cotton Sweat- ‘ers,regular 75c.,cut to 39e, fine quality,cut to of Wilkes is in very feeble health.Dr.|i :‘York was prominent in the polities|fthatanattemptwasbeingmade:by of the State 30 years ‘ago,| Visit of Rockingham Farmers.|Telephone Company.For a Yeap,Pro-1885 ty 1885 -ang wns the Wemiblican| <iMatter -which—were—ignored>Finatty—Candidate for Gavernor_in-1884,se S.Wak|2 proposition was made to the direc-|-‘noant(tors,which will probably be~brought §;; j.ito the attention ‘of the stockholders|cotton mill at Davidson,has volunta-|:The directors!rily refired.have taken no action and were not high appreciation of his service,say-disposed to take action until they hadiing that largely through his —ability|further light,as they wish to avoid;the m4ll maintained a fine any possibility of the companyfall-,cig]rating,and success. ell company or the “ell’s subsidia-;Governor until next year—1917—two| This is preliminary to saying that They are Lieut.Gov. Pr,|some of the stockholders of the Ire-;Westmoreland Davis of London coun-!d dell company—only a few—havesold ty. rtions and Laces,‘10c.-yd,cut to of Men’s and Ladies’Underwear, two-piece and Union,26¢.value,now 19c,ahd J.M.McKEE &CO.Opens the most sweeping sacrifice sale in the history of this community to- day.Money saving will be here a-plenty.Noth- ing reserved.Nothing held back.Everything, is marked in plain figures and at a price to assure RAPID CLEARANCE.Weare prepared to han- dlea big crowd.Plenty of polite sales-people will be on hand to wait on you and show you through the store.| ON TIME , BE DOUBLY.REPAID.. DOORS OPEN AT 9 A.M.. CXR ot ~50e.value,now 39,” 7 $1 value,how 79, _Fine Cotton Blankets, $1.25,cut to 89c. “AND YOU-WILL regular: a “"|)J.Mi.McKee '&Company, poe.WEST BROAD STREET,__-:_STATESVILLE,N.C. F.D.RICHARDSON Sales Manager. j a ‘Father George y: a 7% resacesvenceesnses eepeerin now 7 1-2¢, iig ent tor$1.98,| ® 8 50c.and 5e: Waists,cut to 89ec., ty,cut to 89e. “repuler-fesorett Re Men’s $3 Dress f ard widebmenilesOutsy828th -Ladies’Coats,only.four ne, Fine ners (eetseer Shoes, Quality,cut to $2.19. a4 .Sb ile Wool-nap Blankets,full sige,/ gular $2 value,cut to $1,839, Children’s Hose,extra quality, é 2Sit ameareecna glemannens olsen a: Men’s Work Shoes,regular’$2,- 50 quality,cut to $1.75. Men’s Work Gloves,Fine Quali- Ladies’Cotton ‘Handkerchiefs, Men’s Cotton Handkerchiefs, 10c.quality;eubtodercngsio 4 ‘ Fine left, Ladies’Oe mm Men’s Rubber Boots,regular $4 _ Quality,cut to $2.98. It is reported that Dr.Tyre York,- The Crescent TODAY .FLORENCE REED He repre-!ehted this district in Congress—! Mr.Frank J.Knox,for 23 years) ‘retary and treasurer of the Linden The direetors expressed| Si ‘commer- While Virginia wili not elect a vowed candidates are in—the field.; Ellyson and+ } to the outside interests mentioned.All;1.OW Shareholders have a rigat to sell and] men ii a ee ee rebPto whom they please,of course.But} aye apenit th ‘ooking over the it ee be well,if they care ee e..:;_‘for the effect which the sale might!ate farm,observing and investi-farm observing and and investi-|have-on_the for tunes.of the.local_com--i ‘ya.Dany and the community,to have a i ea eatosville ek te are.in making ‘the sale.If the com- Wternoon train for a visit to the munity doesn’t mind paying a dollar Sata wha Co-operative ‘Creamery at 2 month-mere-for:~“phones-and-toll-on- Hickory,Mr.E.S.Millsaps,district country lines,with no better,service, monstration agent,accompanied the if as good,why the passing of the telc- irty to Hickory.r The ‘visiting~delegation “apveared e-taken-to the farm-in-automobiels- ests subsidiary to the Bell is not a} matter of concern.If they do care.much.interested in and pleased er hae :nSythatitmight»e well to—thinkwithwhattheysawandlearnedatthe“about it.8 ten,Farm,ard expressed apprecia-|‘Personally The Landmark can take Bee ape manner in which they care of itself and-it has no interest inofmoretimehadbeenavailablethethismatterasidefromcommunityin- larty would have been taken foran terest.nded.‘ride over some of the-@ ‘Mr.Pou Acting Chairman.|junty’s improved roads. Ae as,.is chairmafr of the House rules com- ath Sentence of Christy and mitice.will go to Texas next month Mrs.Warren Affirmed.to make a campaign for Senator.and’Inec.Mr.E.W.Pou of North Carolina, eres este supreme Conrt mene who is next on the rules committee,the judgment.of the court below in will.become acting chairman in Hen- Gy sige ‘of Samuel Preston Christy |"¥’S absence,and should the Texan a Yda Bell ‘Warren,Forsyth county,|"etire from the House Mr.Pou would fi which the defendants are under Pocome chairman of the committee.Gikes 45 ~cloetrocution forthe Thus three North Carolinians—Kitch- hi ane in of the ways and means,Webb ofeeerso8.G.a Pariny huehand OL the judicary and Pou on rules—would Chief Justice Walter Clark,writ-'head three of the big committees oftheopinionforthecourt,says,|the House.With Simmons chairman reviewing the various excep-10f the Senate finance committee andahaGn!which “the case.was appeal-*the Important assifynments held by Be Mys Warren ‘seems’:to have |Overman and others members of the n the moving spirit in this mur-|North Carclina delegation in Con-the veritable Lady Macbeth of #'ess,the Old North’State bears atragedy.Upon the whole record|™0St important part in legislation.usband of the prisoner,Warren,ppc ee ‘auieti BaTeydeathbyhiswifeandherjEostmasteratMoravianFalls: our bya pre-concerted,—pre-|Removed.mined ‘murder,‘cold-blooded and!Postmaster General Burleson hasntless,without any mitigating or|issu@d an order-removing Postmasterwatingcircumsrances.We find/John B.Greer,at Moravian Falls,or in the conduct of the case from office.While the department’slearnedjudgeandthe12ju-|order did not state why Greer is re-| ve found their verdict upon|moved,it is understood that he wasstentevidencewhichjustifiesnot.giving as much time ta his office!cree.”duties as the department desired.| b time the court:filed Charges of simple trespass p of;;‘§ass prefer-|20 cases ‘and edjourned red against LaFayette Lynch by ©.|S$.-Milholland were sustained in Jus-| \tice Lazenby’s court Wednesday and|Jiynch was taxed -with the \cos}‘in theydase,ae PRA-| and.Indigestion.berlain’s,Tablets andtThaveeversuedfor!wi 8,Kaight,Wileverywhere, PRE SGRP RAMONE Oehe.Lace at SMITHEY & LEYS ‘fore?1-2¢.yard—ad; gist_to sell medicine under a guaran-'tee to refund the moneyif it does not.jcure,Yet this-is the way the States ville Drug Co.,the popular dfuggists, 5 arephoneexchangetotheBellorinter-|,,, large a jcessful as with Mi-o-na. a few months_ago looked like ‘walk-' ing skeletons have put on flesh and ‘petfeet digestion and good health.|ee Gongretsman-Henry_of.Texas,who One suffering or making their friends;|‘uffer on aceount of dyspepsia.:o-na can always be relied upon. per centage of cures is so gréat that, antecing to return the money if the medicine does not relieve. stand ready to do so ings,and-all forms of liver trouble:are} helped by Mi-o-na.A few days’treat-| ment should show considerable gain in health while a complete cure often foliows rapidly.\ ===]ares DO YOU EEL HEADACHY?ee :eeeLOOKTO YOUR STOMACH|'|GREAT BROADWAY SULCESS “AT BAY”| Supported by a Brilliant “in the” Tt is an unusual thing for a drug- selling Mi-o-na,the standard dys-psia remedy. Never before have had so number of customers:tell} hem that a medicine has heen suc- People who they Prices 10 and 15 Cents. oday are ruddy and*Vigorous with 4+ There is no longer any need for.any-Feat pa ie Mi-'The!Monday .here is little risk to them in guar-!= And they)j without any!mestions.Headaches,all forms of indigestion,| specks before the eyes,dizzy féel-| King Baggot in “Mian or Money.”LISTEN! Bristol will continue to buy or gin your cotton every. day in the week until ‘fur- ther notice,|Come,Any friends,any time it suits your convenience,We’will be at the old reliable,stand ready to patve yous if A great three reel drama of the Northwest.An ap- pealing story of adventure and self sacrifice.King Baggot never had a better part than in this great play. -Prices 5 and 10 Cents. ~L:'BeBristol._ ge n e t ea t s ee a t g n i n e r pa r e ap e s ep e e i Cast.aw “TUESDAY'S AD.WILL pnones |Ramsey-Bowles- Morrison Co. The store with the Quick Pa Be on a ~'THERELLB "PHONES84—137 TELL YOU ALLABOUTIT. In the meantime come and-see these coats and suits we'are selling | Aat$5.95,$9.95 and $13.95. "PHONES $4 —137 The Store That Pays the |Postage.on Mail Orders.. .THEY ARE GREAT. e rcel Post Service Ramsey-Bowles-Morrison Co., te RR S ra p e i ee e ee we i pe a l t et be n ee N THE YOUNG WIFE uston Overcash Proba-atally Wounded —Hus-Stspected—Tragedy inCommunity. fy.deplorable .tragedy occur- Amity,neighborhood Sun- ‘when Mrs.Houston Over- ;“bride ‘of five months,was shotProbablyfatallywounded,Mrs. Qvercash was in the dining room of the home.of her parents,Mr.and Mrs.Robt.Winecoff,when a persononthe“outside “fired-on~her~through} ‘the -window with a ‘shotgun..More than a hundred small shot entered her-and head,and two shot entered|icalp of her mother,who was’/standing beside ‘her.Mrs.Winecoff‘is only slightly hurt,but Mrs.Over-cash has only a slight chance for re- ol 8. }f :le :; and Mrs.Overcash and their daughter had begun the task of wash-ing the dishes,having placed thedishpanontheendofthediningta-ble.‘Her father was seated at theotherendofthetableard_her motherhadjuststeppedtohersidetoaidin washing the dishes,when the explos- jon ofa shotgun.-was heard and thelampintheroomwasblownoutbythe.explosion.Confusion:naturally followed,but even in the dark it was found that the daughter had been dan-'“gerously wounded.As soon as the lamp.could be re-lighted Mr.and Mrs. Winecoff carried Mrs.Overcash to abedgayalarm.A physiciancattedtromStatesville tedress her-wounds,-and-those of her mother.Mrs.Overcash is little more than agirl,being only 17 yeers old.She mar-ried*Mr.Overcash last August and the couple went'to the home of the ffroom’s parents,hear Bear Poplar,to .»They did not.get along peacea- etter three_weeks the_girl-de left‘her husband and returned to ..her ts,The husvang made sev- -..eral yisits to his wife,w 1s said,and “asked her to return home with him, but she refused,it is claimed,on the ourd that he was not good to her. On account of this estrangement the hushand was naturally suspected of haying fired the shot tarough the win- _dow and Rowan county officers arrest- ed him at his home yesterday after- s and “took him ‘to Amity for an ise eke :n and Deputy White 1 t ¢I5e vu 8 tions:#5Deato be went.to Amity yesterday morning ble and took charge of the investigation |hag of the shooting.One or more péri sons were—found.who claimed.they had heard Overcash say that if his wife would not live with him_she would “never live with anybody else,” and.other_statements of that nature. Tt also developed that last September, ‘oon after the scparation,Overcash swore_out a warrant.for his mother- inelaw for harboring his wife._The case was heard by Justice McNeely of Amity,who taxed the costs against Overeash.This so enraged Overcash, jt is alleged,that he made threaten- ing Yemarks against the Winecoffs and his-#vife to an officer. Sheriff Deaton and others visited ——the-home_of Overcash and found a pair of shoes in his room.which were taken to the Winecoff home and fitted in the tracks leading to and from the ww,—where-the —shot was__fired. The officers say the fit was perfect-| Accordingly the prisoner was brought -to Statesville late yosterday-afternoon ind placed—in—jail_to_await_develop- at.= _Overeash ‘denies his guilt and he And his parents assert *that he ‘was at}home all of Sunday night.The shoot-ing occurred between 8 and 9 o'clock Suhtlay evening and Overcash was at home when the officers called between “4 atid 5 yesterday morning.It is sev- eral miles distant from thé Wincco¥ home tothe Overcash home. ‘Ford Party Names aPermanent Peace Board. A dispatch from The Hague says the Ford peace expedition has elected the following named Americans members of the “permanent peace board to sit in Europe indefinitely with the purpose of using all efforts to settle the war:William Jennings Bryan,Henry Ford.Miss Jane Ad- m8,©Charles IF’.Aked.and—Mrs. sph Fels of Philadelphia.Mr.Bry- and |not been with the peace ex- (pedition and Mr.Ford and Miss Ad- dams now in this country.Dr. Aked-is with the peace party.2.Phe board will be composed of an equal number of members from the various neutral countries and will re- main in The:Hague or Stockholm; with the financial backing of Mr. Ford..Each member will receive a salaty,and the entire expenses of the bout probably will amount to $500,- 000 yearly.Dr.Aked announced that he would offer his resignation from his San Francisco church. -Judge Ben B.Lindsey of Denver, Col.,refused to accept a nomination to the permanerit board,but probably © ¢ lst katiahd ® will remain in Etrope indefinitely in| the interest of the orphans of the warring’nations. ‘At Coneord,Tenn.,Horace Jones,41yearsold,a hotel clerk,shot and kiH- f -his sister-in-law,.Mrs.John A. Jones,and her son,Walter;aged 21,) assigned ‘then committed suicide.No cause| ..dbowe Daniels,serving a term in|State prison for killing two or three|ein Randolph county,who escap-'“some time ago,was arrestedburyyesterdayandreturned toias.prison,BiAVR:HOw ews vay ete TW But the Express People Contend bring about-a test of the act of theGeneral icating liquors,was tried before Jus- tice W.C.Moore Thursday afternoon, A package,which according‘to the la- bel contained two pints of.cocktail, arrived.at the express office for a vis-itor in Statesvilley When the pack age was called for at the express of- fice the express people refused to de- liquor;that..only quart packages may be‘delivered and the quart of liquor must be in one receptacle.Mr.JamesiW.Wilson,acting as agent for the party to whom the package was ad-jwould buy the machinery which was dressed,instituted claim anddelivery |to have heen used for the new mill, proceedings to force Express Agent)put the final:details were not workedLackeytodeliverthepackageonthe ground that it contained only a quart and was not,therefore,a_violation of|{jon on the machinery and last fall ;At the hearing held before Jus-|it was offered to the Statesville mill.tice Moore it was shown that the la-|'The offer was not accepted at bel on the package stated that it con-|ltime and plans were made to build.a new mill.as stated in The Landmark. The stock was about all subscribed,a charter was secured and sites were be- ‘€jing considered for the new mill,when package had not'been opened and none ‘tho offer to the Statesville mill was of the witnesses could swear,of.reconsidered,with the result stated. course,that the cocktail was in more §o while.Statesville is not to have an- than one bottle,and upon this ground |other cotton mill the machjnery which the court decided in favor of the plain-!was to have been used for the new m law. ple argued that this meant the pack- age contained two pint bottles and its delivery would incriminate them,Th fusal to deliver passed by the Legislature last March.The first section of+the act reads as follows:“That it shall be unlawful for any,Front person,firm or corporation,or A SUBMARINE EXPLOSION.| Four Killed and Ten Injured ic,the submarine itseff,from the out- side,shows none of:the effects of the explosion,the second fatal accident of its_kind_in the history of the United States“navy. was badly.shattered,but so tight was the vessel’s-shell.that there was nomeans.ofescape for gas which accu- mulated and it was more than an hour after the blast before the work of re- coyering the bodies could be complet- ed, away;-a man working on top of.the submarine was blown 20 feet. onto the floor of the dry dock but suf- fered only slight injurtes. explosion, has either not been:found or the facts ST 0 PINTS MAKE A QUART) That the Quart Must Be in.One Receptacle —Suit For aPackageofCocktailRaisesAn Interesting Question of Law. An interesting case,which may Assembly restricting the hipment and,delivery -;of -intox- iver.it.on the ground that,-the law orbids:the delivery of two pints of ained two pints,and the express peo- iff.Mr.-Wilson..was..represented..in.the. ase’by Attorney L.C.Caldwell.Mr.! sackey was not represented by coun- el-at the hearing,but-he says the xpress company’s attorneys will test || the ease in the higher courts.The act,Rey.H ipon which Mr,Lackey based.his re- the package was hip,transport,carry or | |While Craft.Was Being Re- paired.;a Four men were killed and ten others| injured,.five of them dangerously,in’Sunday afternoon: an explosion which occurred Saturday ee ae submarine E-2,while |preached at the First Associate Re- dry dock at the New York Navy Yard.the absence of Pastor Pressly,whoOneofthemenhiledwaanciatedagin‘Chavo,where he conducted ian workers.At least three of the ten |N Senn a Feats a si eset aeae now in the hospitals are not expected IO SCaeee eee NG ee re to live.~: “undergoing repairs in —Althoughthedetonation was terrif- The interior apparatus A ladder was blown up through ihe eonning:tower and fell 150 feet He fell Navy.officials are investigating the but so far the cause for it 1 have not been made public.The only! statement so far is that the new-Ed- ison storage battery was not respon- sible for the explosion. Live Stock Association Meeting) The meeting of the North Carolina | Live Stock Association,which is to be! held in Salisbury January 25-28,will doubtless draw a large crowd of stock men.Live stock shows with attrac- tive premiums,and addresses by prominent—speakers,will _be-the fea-tures of the meeting...Among speakers who have promised to at- tend are Jesse M.Jones,agricultural and field agent United States Depart- ment of Agriculture;-J.-Shamberg, New York;N.P.Hull,president of the National Dairy Association,Bi- mondale,Mich.;R.A.Derby,presi- dent Sandhill Board of Trade,Aber- WILL NOT BUILD NEW MILI. The Millineer Company Has Sold pany,recently chartered to |build a new cotton mill jn abandoned the enterprise,D.Miller and-J..W.Kaneer,the pro- moters of the new mill,will retaintheirpositions.with..the..Statesville Gotton Mils,-as-secretary and treas- urer and superintendent,ly,TheMillineer compariy—3,000 has been taken over by the Statesville‘mill.“The Statesville mill “stockhold- ers have authorized the issue of $50,- 000 of the preferred stock,to be sold at par and to bear interest at not ex- ceeding 7 per cent.,to 3;000°'spindles and other.machinery. that the new mill woufd probably not be built and that thé Statesville mill out until aMillerand Kaneer had secured an ‘op- pared for business. FRONT any;Sunday it was decided to extend a call agent,officer or employe thereof,to/to Rey.H.M.Parker of.Georgetown,deliver,in's,C.,to any manner or by_any meang whatso-|Street and Barium churches.ever,for.hire or otherwise,in any one:¢Parker accepts the call,which will be package or at any one time from ac}or y L urged,he will preach at Front street point within or without this State to jn the forenoon and evening of each any person,firm or corporation in this)Sunday and at Barivm every Sunday State,any spirituous or vinous liquors,afternoon. or intoxicating bitters in a quantity|der consideration another call and greater than one quurt,or any malt’may be that he cannot give Front liquors:in’a quantity greater than five Street an immediate answer. gallons;and it shall be unlawful for any spirituous or vinous liquors or in-ppresbyterian church met at the church toxicating.bitters sc shipped,trans-)Sunday afternoon to discuss the ques- ported,carried or delivered in any one|tion of a new Sunday school room-for package to be contained in more than}{he church,\“All ‘were agreed:that 1 lo”?taeonereceptacle.|additional lmittee .was appointed to —seleet-—a ‘one faction objecting to the authority the | / neetoeerete Semana aot Its Machinery to the States-ville Cotton Miil. The Millineer Manufacturing Com- Reported at’Meeting ers’Association, rStatesville,has Messrs.TF. present. respective- machinery bought for the spindles-—teaching.Following Dr. selections. awarded Iredell.County pay for the It has been known for some time Arey,awarded to Farmers’Bank of ‘State few days ago.Messrs. hand saw.donated by Mr. the farm,for the best keptoAlbertClarkofEwfola. ill ‘goes into the Statesvilte-CottorrZrintandthismillwillbe.better pre- ST.CALLS.PASTOR .Me Parker of South Car- olina —Presbyterians ©Dis- cuss Sunday School Room— Church News. At the congregational meeting ~at Street Presbyterian church ress being made toward school conditions were School reported that in paying for a piano,the ‘provements. of FrontIfMr.the pastorates ized. Gray have organized a trees and Mr..Parker‘now has -un-buildmg and ‘grounds. it meetings of the Loray club. Sixty or more laymen of the First Sunday:school facilities were badly needed and that-some kind of building should be erected.A comi= At.noon the teachers dicordingtogrades finance-eommittee-and a plan commit- teo for presentation at a congregation-|" 1 meeting to be held at the close of used during the study_perio the service next Sunday morning.Mr: C.M..Steele vresided at the meeting Rev.W.T.--Walker of Barium ander as Deputy Coll formed church Sunday morning,in Mr. Mr.Pressly returned from Charlotte yesterday. _Rev,-C.-F._Norman—wil preach at St.Michael’s church,Troutman,next Sunday at 11 a.:m.;at St.Paul’s at 3 p.m.and at Amity at 7 p.m. —-Fatal Riot at-a Church.— Rioting which broke out between rival factions at the Church of the Sa- cred -Fieart-of Jess;-Cathele,-in—Du- pont,‘near Scranton,Pa.,Sunday,re- sulted in the death of:one man,the probable fatal injury of two others and the serious injury of at least a dozen more.Knives,revolvers and clubs played a prominent part in:the riot,11 State troopérs being among the injured.This church has been the.scene of half a dozen riots in as many weeks, race.Collector ‘Watts he and the latter will go on February 1st.‘Mr.Vé.Roy resignation is _effective lector Watts has ceed Mr.Plott. Was Late But is Here. exercised by Bishop M.J.Hoban of the Catholie.Diocese of Seranton,in naming’a priest to take charge of the affairs of .the:church,and the other supporting him.Every time the new- ly-appointed priest has sought to hold services he was prevented from entering the church by the opposing faction.Sunday an attempt was made to hold services under the:pro- tection of the sheriff,who called the State police and troops to his aid. Mrs.White Seriously Burned. Mrs.G.B.White was ‘burned yesterday morning about 10.30 o’clock at her home near Snow Creek severe cold wave. ably Jow temperatures.” tures ranged to 30 and 40 church.She was standing in front of}and blizzards that interf an open:fire-place dressing.when_her|iransportation and tele |dress was ignited.Screaming from}phone lines. fear and pain,Mrs.White ran to.the!re deen,N.C.;_E.:C.:Gatewood,general live ‘stock agent Southern railway,Rectortown,'Va.,and Charles.GrayScot,of the American-Aberdeen An-|gus Association,Chicago. Alexander Road Botids Valid. Judge Cline,who heard argument:in the Alexander road bond ‘case at Hick- ory Friday,yesterday rendered a de- cision holding the bonds valid,The restraining ovder is.thereforedissolved,The plaintiffs appealéd.:on EN Ne eee aca aitThechildlabor.bill which has-been under diseussion before the labor com- iy mittce of the House of Congress.the Kittrellpast'\week,has’ ported)«so oo"‘ (been favorably re- first.scfeéam and was rushing toward ithe house.-He reaghed)Mrs.White’So !as she was leaving the house and toher.back into the house,where ;smothered the flames with bed cloth-|ten,8. ing.In so doing his hands were pain=!Smithfullyburned:A,large portion of route'Mrs.White’s.clothitig..was.burned|¥from her body and the lower.portion hadofherbodyand‘her arms and hands!/"0 | were badly burned.Physicians_were Smith was ealled immediately ‘and it*is hoped that her life may be saved. ge Sunday ‘afternoon ste he viously ill’inCC..It wasbecameill advised to the Stinday evening train. s SmithTheDukeshavegiven$12,500 to Charleston, college,/a negro school.in in Columbia and wrote Vance county,the’‘school to taise a,there to his family,in whic similar-amounti |was mentioned: Supt.Gray emphasized the tance of placing sign boards at each school,giving the.name of the school, township and district,and announced ithatinechadearranged:.to have attract- ive signs of uniform.size made at $2.50 each,Mr.Gray also announced that another public examination for teachers would be held on the 29th. Reports from the teachers of prog- improving then heard. Principal Lankford of Harmony High addition to Harmony school -has--a—balance.of_$40_for_im-Miss Daisy Jennings of Cool Spring Academy reported that a domestic science room has been fit- ted un by the school -and_patrons and a cooking class of 20 has been organ- -Misses Alice Bilby and Janie “One-DayClub”in their school,which will plant otherwise beautify the Miss LinaDeal:reported.good attendance:at thecommunity| as to this part of the country. dav,Saturday and Sunday were cool, and yesterday was cooler,but the tem- perature was not unseasonable. The weather in the West and North seriously |last week was very severe.Tempera- o further details were given. ATESVILLE,N.C.,TUESDAY,JANUARY. AWARD CORN CLUB PRIZES, Signs For the Schools —Im- provement at “Rural ‘Schools Teach- The attendance at Saturday’s meet-ing of the Iredell Teachers’-Associa- tion was very gratifying,120 of.the 168 rural teachers of the county beingThemeetingwasheldinthe college-avditorium—and-—opened with devotional exercises conducted by Dr. Charles--Anderson,who also made very fitting talk on preparation for Anderson's addressy-Mrsy-Jds Fh Carltonr-sang=two County,Demonstration Agent Dull Boys’»Corn Club prizes as follows:Large loving cup,donated,by .Dairy Agent John Erwin.Alexander of Mooresville,for best acre of up- land corn,the yield being 81 bushels; loving «yp,donated by.the.two na- tional banks and the Merchants.& to Sharpe Browning of Loray,for best acre of lowland corn,yigld 75 bushels; to Paul C.Williams of New Hope town- ship,who made 77.bushels on upland; jack plane,donated by Iredell Hard- ware Co.,to James Linker of Moores-ville,who made a yield of 62.9 bush- els;book on soils and crops of.thert, sville, Dull, t repor Principal Oliver Overcash the Feimster school announced that he and his assistants had inaugurated a visiting campaign among their pa- trons in the interest of the work.Mrs.E.L.Lowrance of Open View schoo!will have a One-Day club.ac-for the study of|“Country Jaife and Country Schools,”recitation rooms of the college being vided doThenextmeetingoftheassociation ig scheduled to be held February 12th. Mr.Allison to Sueceed Mr.Alex- ector. -Mr.M.P.Alexander will retire as deputy collector of internal revenue on the 31st of this month and Mr. Richard _P,Allisen-will -succeed-him. Alexander,-has -been collector since Collector Watts took charge of the revenue office.He-is a eandidate—for—sheriff—of—tIredeltand} retires to give.his.attention to therecom- mended Mr.Allison.as his successor .depu AS the j :Plott of Waynesville, who has been a deputy in the collec- tor’s office,in charge of narcotic work, Ihas resigned and leaves tonight”for Washington to take «position in the office of Senator Simmons.Mr.-Plott’s tomorrow evening at the close of business,Col-recommended Huch A.Love of Waynesville to suc- N The cold wave which the weather bureau said was coming last Thursday did not reach this part of the coun- iry last week..A dispatch from the weather bureau at Washington Sitid practically “the entire United States was in the grip of the winter's most With the exception of Florida,évery State had _unseason- Not correct ¥ below ered Mrs.John A.Smith received.a mes- that ok her husband,Rev.Mr.Smith,was se-a hospital’at Charles- stated that suddenly .while en to a Charleston church where he} as scheduled to begin a mee ating heno ilin impor- school )2€rO er,C.A.Turner,FE. and there were rains and SO etre Reiger,W.D Turner,W.A.Evans,wi graph and tele- Mr. for 18,1916. MR.W.H.H.SUMMER Other Deaths. Mr.W.H.H.Summers,a promi- nent citizen died Saturday o’clock after a long illness. ily residing in home some-time ago, thought the end was near.Mr.Sum- mers was 73 years old and had oper- a Anderson,Ind.; Wade Summers a ne...andaoaJ.NE Fahwsorof Statesyille and Statesville. took place yesterday at Rose chapel. wound, red.ao Miss Katherin appendicitis,performed Friday. ter of the late Dr.and Mrs. Ross of Morganton. bers family of—Iredell,~ Mrs.-Ross...of Charlotte,a ton--Saturday—night for-interment. home at Newton, place. of and jaw being exposed.She ed for two weeks before it occurred. number of children.The body ;wastaken-to-Newton-Friday:night. at El Paso,Texas,of.liver disease ty time, port of the existing governments. til his fall,and.when Diaz -wasob ional President. revolution in Mexico City in Februa ry,1913,.when the Madero govern {r dency. for the death of that unfortunate by the forces of,Carranza and Villa Huerta lived for a-.time in Last year he returned to and after a time where he was arrested by the Amer ican authorities on the ground tha he was preparing to-lead an expeditionintoMexico.He was in jai for a short time and after his re lease was kept in-a detention camp. ri-:Stockholder Meetings. Furniture Manufacturing Co.,at thei annual_meeting last—week,elected-di rectors for 1915 as follows:J. ||| |Herman Wallace.The only change i door and started in the direction of |Rev.John A.Smith Seriously)y+.Steele was re-elected president,|Thursday night the University team, her husband,who had gone to the}I.Mr.Turner vice president’and Mr.|won by a good score and at rham mail box:“Mr.White had-heard —the Keiger secretary ‘and.treasurer.Mr.|Friday night Trinity College was witi+ |the idition than it was.@ year ago. it them. ess the wee .{Lewis, S DEAD Prominent.Citizen of Bethany— Baby Died of Its Wounds— of:Bethany township, evening about 5,15 His con- dition had been critical at intervals forsomeweeksandmenidersofhisfam- Indiana---were..called when it was ated_a_store at _his,.hame for.many. years.He is survived by his wife and specially ~to"provoke “intériational the following *named ©children:|troubles at this time.f } Messrs.James and Thad.Summers].He appeals’to the Secretary of and Mesdames Nicholson and Stone of Messrs.George and’ Mes- Hatchett of the vrcinity of,The funeral and_burial Katherine Blount,the little daugh- ter of Mr.and-Mrs.A.McN.Blount of Barium,who was accidentally shot with a 22-caliber rifle last Tuesday,as told in Friday’s Landmark,died Sat- urday night from the effects of her The burial was in BariumgraveyardSundayafternoon,As hasbeenstated,.the child ano an olderbrotherwereplayingin4%room alone when the distressing accident.occur- e Adelaide Ross.of Morganton,23 years old,died at theSanatoriumSaturdayeveningabout 6 o'clock,following an operatjon for Miss Ross was an orphan,a daugh- Chas, Wer mother wasaChambersandrelatedtotheCham- 2 Mrs.J.-C. Dickson of Morganton,an aunt,andrelative, were with Miss Ross when she died. The remains were taken.to Morgan- Mrs.George Smyre of Newton diedFridayafternoonattheSanatorium,death resulting from the effeéts of burns received some weeks ago.Mrs. Smyre,while alone in a room of heronThanksgivingDay,suffered a sudden attack_of ill-ness andfell.unconscious into the fire-When:members of the fam-ily found her,her clothes were aflameandherentireleftsidehadbeenbad-ly burned,the bones of her hip,armwastreatedbylocal.physicians until De-cember 22d,when she was brought totheSanatorium,where it was hoped that her life might be saved.It was realized soon after.she was..brought to Statesville that her case was ut- terly hopeless and death was expect- _Mrs.Smyre was 32 years“old"andissurvived‘by her husband and a Gen,Huerta is Dead —Former Mexican President. Victoriano Huerta,.former Presi- dent of Mexico,died Thursday night He had been “critically.ill for some “Gen.Huerta was a professional sol- dier and as such he had,up to -the overthrow of President Francisco Ma-| dero,been known for his loyal a He fought loyally for President Diaz un-no longer,chief_executive,Huerta fought.for Francisco-de 1la-Barra,the-provis-After Frantisco Ma- dero was elected Huerta’s loyalty was not.challenged -until the Felix Diaz. ment was completely-overthrown:and Huerta himself elevated to the presi- Huerta -was the moving spirit} in the plot against Madero and was renerally credited with responsibility After he was forced to leave Mexico Spain America went to”Texas, The stockholders ‘of the Imperial C.|Statesville,Wilkesboro and Elkin. Steele,R.B.McLaughlin,E.G.Gaith- Morrison,C,E. ijn the case of My.Evans,who suc- ceeds Mr.C.'L.Poston,who has dis- posed of his)istock in the ‘company. |Keiger rendered an excellent report ofpastyera’s business,which was very acceptable to”the ‘stockholders. The company ‘is in much better con- 1 Irving -and~Herbert Updike,aged ting,and 32 and 21 years,respectively,sons of been’removed.to a hospital,but,Furman.Updike,a ©Chicago million- Mrs.!aire,were arrested for planning to leave for \ill their father. Charleston at once and.she left_on|was going to change his will,to dis- Rev...Mr.!inher i left Statesville FridayHespent.Friday nightaletterftom|arrive today They believed he Mrs.H,A.Millis of High Point,willtospendthebalanceof k with her mother,Mrs.W:G, CARRANZA IS AFTER THEM Bandits Who Killed Americans— to Be Killed Without Formal- ity.© Through American Consul SillimaninMexico,Gen.Carranza advises theAmerican.government that he-prompt- ly issued orders for the -immediate ”pursuit,capture and~punishment ~ofthoseresponsibleforthemassacreofAmericansinMexicolastweek,The ,bandits,according to the ordér,mee becapturedandkilledwithoutformality. Gen.Carrarfza believes the outragewascommittedbymenassociateddi-rectly with Villa and that it was done reece State and to the public of the UnitedStatestoconsiderthewidestripofthecentralrailway,the great difficultyof-guarding-theentire distance,:and the comparatively easy task of ---—~destroying a train vr.attacking.a —small place.He says.that’nobodycanlament.more than he,such /an atrocity or be more concerned aboutit,but that protection is relative andthateveninthebestregulatedStatesoutburstsofdisordersandlawless-ness may cause destruction of proper-ty and loss of life.iGen.Carranza refused to permitAmericantroopstogointoMexicotoassistinhuntingthebandits.StrTheadministrationwillnotcounte-—hance armed intervention:in.Mexico until Carranza has been given an-op- .portunity:to show what he can do.Secretary Lansing,while announcingthateverystepwouldbetakiseethatperpetratorsof:the-erime:arapprehendedandpunished,denied pub-~lished statements that the WatsonpartyhadreturnedtoMexicowiththeassentoftheUnitedStatesgov-ernment.He explained that the StateDepartmentneverhadrevokeditsre-peated warning to Aimericans to leaveand.remain out of Mexico on accountofunsettledconditions.there.Ameri-cans are still urged to remain out ofMexico,he said.The:bodies.of..some-of the victims.of the massacre near Santa YsabelwereinterredatElPasowithoutandemonstrationonthepartofAtneri-cans.Thursday there were threatsofreprisalsagainstallMexicancit-izeng and martial law was proclaim-ed,but quiet prevailed next day. BRIEF ITEMS LOCAL NEWS, 5, # .—Box supper at Abernathy:school.”house tomorrow night.Public invited... =—-Miss.Texie'Evie Mayberry and.Mr.Walter Combs were married 1iterdayafternoonintheregister’s of-fice at the court house,Justice:W.J.Lazenby officiating.ae ©Rev.aoe eee the New'YorkScotch.preacher,who will talk:about.©“Seeing America Through ScotchSpectacles,”is to appear jat ShearerHall-tomorrow:evening asthe next-—attraction in the Chautauqua’winter.course.re SoS Ga eee:—The Daughtersof the Confedera-.’-cy will meet with Mrs,M.-R,-Adamstomorrowafternoonat°3.30..T ¥ 7? meeting is on the Lee-Jackson birth-day anniversary and all Daughters,-members of other chapters as well as |this one,are invited to attend. —Mr.M.N.Hall was stricken-withparalysiswhileatthedinnertableahishomethreemilesnorthoftownyesterday.His entire right side isaffectedandhisconditionisconsideredserious.Later—-Mr.Hall diedat 6.=~~80.this morning.:Paes sey—There willbe a-partial eclipse ofthemoonThursdaymorning—if the |,almanacs have the facts right—andfolkswhowanttogetupat3o’clockinthemorningcanseeit,The Land-=~mark will depend on Prof.Laf./Bar-ringer to do the ‘observing for this paper.apo piiatiysh lesianendi hag Se aE ee ae tre pct —-Mr.E.0.:Heritage,who has-been —"elected secretary and general mana-ger ofthe Iredcl Telephone Co.,hasbeen..released from his position withtheBellcompanyandisheretotake.charge of his new:position.He will:probably not take over the.manage-ment-until.February 1st.ch Bette —Mr.L.C.Deitz has closed hisblacksmithshopandisnowwithMr;‘A.B..Lineberger.“The building.inwhich‘Mr.Deitz had his.shop:is on "—property affected by.the improvement ©on the west end of Water street,and ':against which the city has broughtcondemnationproceedings. —Messrs.Smithey &Fraley wereinDurhamlastweekandleasedafarmtheyown,near.Durham,.to Mr.-Lewis Fraley,Jr.,of Tredell,who willtakechargeoftheplace.They also..bought’a lot.of goods in Durham for ©the-Smithey-&-Fraley stores--at t 1 r Defeated at All Points, The Statesville basket ball team re-turned Saturday from its trip toGreensboro,Elon College,Chapel Hill.and Durham,Theiteam lost all”the’—games of the week.At Chapel-Hill 8 ner by-a score of 42 to 12.The locals were handicapped bynot having all caetheregularteam,it being neces:use substitutes who had not played_|gether“enough to do good team work.’Elon College teamwired’yesterdaafternoonthatitwould:beagamewiththelocals night. J.A.Trammell,amGlass,Cabarrus county,mer shot and killed Luwasacquittedbyajury inSuperiorCourtlastwclaimedthatbhiee2 we store,where his:family:;byandthat|in solfsdet of'to me of “12 Big ae Retail.Stores | »staple was priced around eight cents, WONDERFUL PRICES ON NAINSUOKS AND LONG CLOTH.’ King Phillip Mills 36-inch ‘Special’Nain- sook,value $2.25,bolt of 12 yards,rele Drees Pe eesv $-$0 King Phillip Mills,36-inch °C Boe Cloth,value $2.40,bolt of 12 yards,sale price $469 King Phillip 33-inch Shadow Check sook,value $3.00,bolt of 12 yards,salePoea?“price Japanese.Nainsook,width 40 inches,naalue $2.50,bolt of 10 yards,sale price '.$1.98 Sea Island Nainsook at special sale prices. $3.00 value,12-yard bolt,42 inches wide. Fine Sea Island Nainsook,sale price,{Pe r “bolt.nw %2.69 Sale priceson al!Table Damassk and Nap- kins. Sheets and Pillow Cases all reduced F special WHITE SALE! tt aba eS or,thias Now is the time to buy your Spring supply.These reduced prices are wonderful. _Priced bargains mentioned here are ony,a few of the good ee Nain-- Begins Thursday at9 O'clockand Continues Through the Week. ‘Cotton Fabrics SALE PRICES.‘ON ALL STANDARD DOMESTICS. 10c.value yard-wicde Bleached ‘tic 33-inch Gant Embroidery Clot! ee yard-wide Do:Restic,or { Canon Cloth.Do es en 1Oc. 10c,Cambiiee sale Srice.par,tee, The well known yafd-wide Pepperel N.G. Twill.The very thing for Middies and Mid- dy Suits,sale price ....s.....*12 1-2c. 'Five-cent Counter ended ‘with Short- Lengths of .Bleached Domestic,Canon Cloth,Dress Ginghams,Apron Checks and yard-wide Suitings,and many other bar- gains,valueyup<«to I2°I-Zc.Sale Ppsrice,es a ata 5c.yard. a RETTY LACES AT SPECIAL PRICES. |lot Val.and Round Thread Laces,your 8 1-2c. nen finish Be eefGr oe,ob.2c.yard: }-dot Val.and iinen_LLaces,new goods THE ae THAT SELL WEED WS PS SESRGNE NE ER ITESTS wi ee ee ea “MIDDY BLOUSES AND MUSLIN “UN. ; ?:h ott 1 de ble its-value one vear ago,our offering of hundreds of dolar worth of finecottonFabrics contracted for when the 2 «OY_With cotton nearly dou MAKES A SALE OPPORTUNITY NOT EQUALED SEFORE IN THIS STORE'S:HISTORY, are sure to be higherlater on.The reduced pee oa ee eeeworthuptoI2c,your ‘choice .....,|lot of New Embroidery froma 3 to 18incheswide,Cambric and Nainsooks,_special 10c.,12.1-2c.,15c.,18c.DON'T aMISSTHISOPPORTUNITY!a latin feng “DERWEAR ON SECOND FLOOR,-A big line to select from.Thisis a money-saving proposition.Don't fail to investi-gate it.»Gowns,Chemise,Pants,Skirts,-Combination and Corset Covers.:Corsets and Brassiers go in this sale at ree =ff 7ducedprices. VERY,VERY SPECIAL!|lot full size.White Wool Nap CottonBlankets,-$2 value,sale price ....$1.25 ‘oonIlotfullsizeWhiteCrochetCounterpanes,in$1 value,sale price 896...MARSEILLES COUNTERPANES!—'abeautifullottoselectfrom,values from $1.-°*~ 98 upto $3.75.All reduced for this sale. aa ete A special invitation to the Ladies to attend this sale—white goods “ae “appeal to them. POS LESS. alway S LS. Phone:212 |ic.§ HE LANDMARK would be removed trom the Hick- LORS iboard,who said the convicts were not being worked to advantage on °the |roads and that they woukt be hired to contraétors”at Badin for $1.75 a day.At-the Asheville meeting,how-. ever,Supt.Mann sala tne State pris- on board had made no such order and he and Gov.Craigadeft Mr.Varner in5suen SON,VARIOUS TOPICS. i}Says-2 report from Goldsboro,is. “deeply grieved”to learn that there is! *criticism of his failure to prevent the lynching or prisoner in his cnatnes*He says he “heartily.condemns the,se Nada rag ta ar_#lynching and.will leave nothing uns Ms ;ope oe se a SOW Ap 200 ee-done-to bring the mobto .justice}Varner to say something.“That is very fine,but if the ‘sheriff had left “nothing undone”to prevent“the lynching’there would be no cause one David Clark,by telling _theACharlotteediier. distinguished himself for complaint.To leave a prisoner in House labor committee that the peo- a tall and an aaedod LA community vle of the mountain section of ~-his 3 UAE :“estate —are opposed to education.&where there are threats of lynching ,->*Oe aul ee a..is inexcusable and cannot be defended.|pee ee ee os much le.That seems to have been the case ab}.°,Dares of her own sons,—Asheville*Goldsboro.If it-wasnotdeemed wise |Cizcn.scrente wane ai Char-®to guard the jail and risk a conflict aa re el o*oe Chi ee’@ with a mob,which should be avoided See .a a "Chie h ae als,whenever possible,a-remova]to_an-ch k's Sse aap Nica pal CC aothercountyisalwaysinorder.This ark’s opposition to the child—labor- should_haye-been=dowe inthe Golds Fe rane in-Corer a.5S is so great _boro case.nat he did not,according to all re- **#8.|nor ts,testify wise]ly before the com- Dr.D.H.Hill,-who will write the.pod Said foesha coe __Confederate history of =the)State=yuo Me Ora“and.the-work4vill_be-well_done—has.“Cucatingbecuse the pountate people resigned the presidency of the A.and|Sppose it and would vote against theiM.College,-his resignation to be ef-|Pepo comaisory oeWas fective at the end of the present term.|“°C!If pee ee te hel;ae ee&While the directors of the institution|e":Capt..Clark believes that,-are looking for Dr.Hill’s successor.|1%,Could have framed his testimony} yThe Landmark craves che privilege of |differently -——could have said the peo- *the floor-to make a suggestion—and|P<|Gppske compulsory educatien:j‘that is that the next president of the |that wée*have a mild See aw “Av and’M.be a man noted for physi-|"°W because the peonle have to he.eal-strength and courage rather than|‘educated uv to it.That would not, *s@intellectual ability.If the combina-j Rave left the impression,as his quot-|,tion can be secured.so much the bet-'°¢"remark does,that the ©mountain|"ter;if not,raise the physical rather,P°0Ple are all ignorant and preju-|than the intellectual standatd for that |diced and that ‘politics is the main’ particular office.The apparent need |Consideration in such matters.But“of the A.and M.for some years has|2other statement attributed to Capt.‘‘been for a man who has the physical Clark is worse.He said in substance _strength and.the courage to “knock that the Southern mill men would *down and drag out”when the toughs |bribe mill.inspectors to give them aj ‘giwho disgrace ‘the insutution start!Clean bill of health.Tf such testimo-'their “rough:stuff.”iny as that doesn’t help the advocates ee *;of the child labor bill,it will be sur-| In some way en Potro among Prsing.nee eefthemountainpeoplethatthe peni-|pP :ie thaittentiary‘authorities.intended to with-,Fifty Mem bers of the Crew/draw the convicts engaged in the)eee aegconstructionoftheroadsthrough)Fifty members of the crew _of-Hickory Nut and Swannanoa Gaps:re “hire them out to private contrac-;rs.There was somewhat of an, _“arousement”in consequence and Su-|*perintendent Mann of the State)pris-|«on was called to Asheville to jginivGov,Craig ina reassurance to thepeople.They were there from both,ends of the line and the middle.Tha'“assemblage was in the Board of Trade}‘rooms and Governor Craig made an-Coomacement that there was no inten-‘of withdrawing,a single convicttheroadsarecompletedandtheintheCentralhighwayisclosed.r than that,arrangementsdefora’concentration of theserene,whereby the finishingworkwillbeSipelentade=rver.{got out”that the con- the.British eae Clan MacFarlane, torpedoed in;ae Mediterranean De- jcember 30,are still missing and have been given up aslost. The survivors who arrived at Maltastatethesteamshipwas‘torpedoedwithoutwarning.in a rough séa,thesubmarineappearingonthesurfaceonlyafterthetorpedohit*the ship.!After the crew had taken to the boats:the submarine came alongside the boat!occupied by the steamer’s captain,and the submarine commander askedandreceived..information regardingtheshipand:her crew.|The lifeboats battled cight against mountainous seas,with theoccupantsonrationsconsistingofhalfabisenitandasmallcupofwa-ter twice daily.Six-lifeboats a, iroke!SS heen tied “together,but threeores,OmerOther oer Won't bea away,before help:came and are:te-)cases,nomatter of how long standing,}¢by the wonderful,old:tte De lieved to"have ek Josyntiseptic‘Healing .Oi It teeaeWi,$1.00, days| BUILDING?—CG. Ws WAEEENES.| Nut Gap road,January 145, ESDAY,---January 18,:1916.;t2rough a letter from Mr.H.B,Var! ‘EAT “!—|ner,chairman of the.State ‘prison }, ‘responsibility {Roosevelt and with —publican—unnamed_tor—Governor,—-Matt ‘for some time,met to ee their Cc.H.TURNER.: grievances and each fired5s shots.!{Iredell ’Phone No.74,Bell No.7.Jones was killed and \: Birthday Dinner. .Serrespondence of ‘the Landmark. incriminating Documents’Pound | iinYonPapen’s Possession, A dispatch from London says ecop-|A»surprise birthday dinner occur:| ies of correspondence seized at Fal-red at Mr.W.A.Goforth’s JanuarymouthfromCapt.franz von Papen,!18th,in honor of Mr,Goforth’s 76th!About-45 to 50_relatives and! were present and enjoyed the} Mr.Goforth is a good -cit- -an of north Iredell and we wish him} Cais attache at-birthday.to Ger-friendstothee¢casion. transmission 4 reealled--German— Washington,while on his way many,been turned over American embassy for }.nave to the State Den:tment.They show many mere happy birthday17 ~-von Papen-made frequent ONE PRESENT, payments to persons charged with the ee =eSayPoeLlowing“NP mai GIRLS!HAVE WAVY,THICK, { || t | GLOSSY-HAIR,FREE FROM iDANDRUFF! | ,tiens works a United /States.:One that von Papen gave $700 to Werner Horn,whowasarrestedinconnectionwiththe Save Your Hair! blowing:up of 2 bridge at St.Croix,in a Few Me,_The day before-this check was —Tf-yeu-care for heavy issued the German embassy paid.$2,-glistens with beauty 000 inte Von Papen’s accotint.;with life;has.an incomparable soft- Double Its Beauty: Moments—Try ‘This! air,thatandisradiant} ' Capt.von check stubs,ness and is fluify and lusivous,try! bank—beoks-andetcers vom his bank Danderine,ey al —-the Riggs National Bank of Wash-.Just one-appliéaticn doubles the! ington,D.C.—show about 500 items,beauty of your hair,besides it imme-| many of-which had to do with routiné diately dissolves every particle of) expenditures.Others,however,re-dandruff vou cannot have ,nice,: healthy hair if you have-dan-! This.destructive ceurf robs re vealed payments to various persons heavy, who have figured prominently in.the druff. activities of German agents in Ameri=the-hair-of-itstust ¢a_and_to at least.one_spy_whocom—its very.dife,_a mitted:suicide ima cell in an Vnglish pr oduees a feverishness and _itehing prison.>rot the scalp;the hair Toots As an example of the size of »the loosen and die;then the hair’falls ¢aptain’s financial operations.his out fast. bank beok shows that in January of If your hair has been neglected 1915 he received approximatély $6,400 is thin,faded,dry,scrageyvor and paid out $5,000.:oily,get a 25-cent bottle of,Knowi-| ton’s Danderine at any drug store or | fnot-overcome “itd and ita-strenpth and a -|24famish, toa} E | STATIONERY!| pe YOU SHOULD SEE OUR DISPLAY OF QUALITY STATIONERY BI B P e e s v e o e rs rr e c s v e s o e s v cl o s e se v s o e s e ve : +3 3 VI I I I I F By the Pound,the Box and in Correspondence Cards, AH ight Parfoe +‘elt;toilet-counter;—apply—a—little—as—di--—__--____Mi.Zeb.Vance Walser of Lexing-rected and ten minutes after you will ton,one of the main leaders of .the S4y this was the best investment you Progresssive Republicans (Bull Moose),&Yor made.in North Carolina,and who-attended “e-sincerely believe,regardless of‘the Progressive conference in Chica-everything else advertised,that+—if cola you desire soft,lustrous,beautifulstweek,announces that ‘the wordAGeodLACeuanTChitawas,“Go Hair.and lots of it—no dandruff—noaeineseltrenchésandfightitout.”itching scalp and no more falling hair And we are going to fight it out in YOU must use Knowlton’s Dander- Nerth Carolina this spring,”says Mr.If eventually—why not-now?, Walscr.He says hesadquarters Will be |es =ccreme name opened in Lexington in a short time ! to push thecampaign in this State.W ANTED! My.Walser.furthor confides to the apublicthatthe-West’is all afird-for—-earRaPp BRASS =Heavy Brass 7te. Roosevelt a can-:aerpound,Light Brass 5c.perdidateforPresidentandacertainRe-‘pound und,Light p FOR SALE: New and second hand machinery for sale and ‘all:kinds ‘of boiler room supplies ine, eT Walser professes to believe that theDemocratswouldbeunhorsedin North Carolina. Near Goodwater,Ala.,G.W.Jones and H.By Dunn,who had been at-outs Dunn oncanet ' unhurt. HAVE YOU WEAK LUNGS? “Do colds settle on your chest or itt yourbronchialtubes?Do coughs hang of,or are you subject to throat troubles? Such troubles should haye immediate,treatment with the strengtheningpowers of Scott’s Emulsion to guard apainst consumption whiclt-so easily follows. Scott’s Emulsion'contains pure cod ver oil which peculiarly strengthens theires-piratory tract and improves the quality of the’blood;the glycerinein it soothes.and heals the tender membranesof tlie throat. ,Scott'sis prescribed by the best special- |ists,You can get it at any drug storey:Scott&Bowne.Bloomfield,i.h 1y “DANGER’”’ Come like a thief in the night and seize the a of your little one by having a bot-tle of FORCroupandPneumonia. Prise 26¢.,50e,-and $1.00. on,receipt ofBRAMT MEDICINE CO.,. N.Wilkesboro,NeCe* |BUILDING?-pi a n ge Fes anergy paca WHE 905 CROUP and PNEUMONIA| upon the infant child.Be prepared to save|& Brame's Vapo-Mentha Salve|g Fot sale Py all,dealers or sent post-paid z C.WATKINS. liver ¢iilled Pk ee \ The farmer who tises Genuine Oliver.oF Chilled Plows is one whonotonly believes in “Preparedness”but backs up his faith by his work,The continued tickling of Mother Earth:with Oliver Plows.has , brought big bank accounts fo hundreds of 4 Iredell county farmers.‘Are you one.of iy them?If not,now is the timé:to get on oe the bandwagon.Buy from us and.be. happy,|u Yours truly; Ta o ‘ has agonyLazenbyMotisoheryHardware-€o i LE tn SP E I OG R E AE as Pa c e Be BS Allthe newest designs and =§#£x£(§ colors. i Statesville DrugComp’y,|:9 Quality Prescriptionists. ee ia re t SS S § i }| SE S B E B B E j On B S e r a aa e e e e s Fe P P e P P P . 2S ;Train No,16 ar.9.50,leaves 10.85 a m. oe Train No,24 ar.8:14,leaves 8.14 p.m. imily doctor told my husband he Fi ;uid not do meany and he ha Meera erye ore fatudPeebeeomoct©Nos.28 and24 gre not operatedom Sunday ui,the woman's tonic.|th oo ing seemed to doKkelevenbottles,andnehdoall itl world,My wTlookthepicture of health.” inthe past 80 years.At alldruggists. G1 last,my.mother advised me to take ‘was no use forI was nearly dead ‘andgood.now |am ableofmyworkandmyown ‘Ithink Cardut is the best medicine inLdeight.has.increased, if suffer from any of the ailments:‘women,get a bottle of CarduiWOtipyouEPsRelpedthousands‘Womenofother,weak women Mr.Templeton’s Collection of‘Interesting Souvenirs. _Mr.R.8.(“Bob”)Templeton _of Mooresville was Showing The Land- mark the other day.some interesting souvenirs.One was a metal badge of the famous William Henry Harrison ‘campaign.On its face was a repre-sentation of a log cabin with coon-skins tacked on the door,and a cider barrel with the hoons plainly show- Hing on-the-barrel.~-Many.-of .the..old- er people recall stories of the famous Log Cabin campaign of 1840—‘Tip-pecanoe and Tyler,there be who have personal recollec- tions”of’it. the lot was of the vintage of 1856, femen,”wnplain wrapper. oe te:Chattanooga Mi @ Co.,Ladieseeecations,ie To includea can of our Gold Medal Coffee in your nextorder.You will like it.A fresh shipment just in.We Don’tForget in 1840. vast quarter of a pieces as sma}l as 1-4 cent. collection is of Jggal interest. 1875—the centennial the late Jos.-P.Caldwell. Shop rear of McElwee’s Planters“Warehouse. :‘|have a complete lineadeeheavy,groceries,such a ~—a}as Potatoes,—dried m=j Beans,Peas,etc.a:|PHONE 89— i @©=—_|Eagle &Milholland. *.|BLACKSMITHING! ,|SEE LINEBERGER for anything ;|in Blacksmith line.Horse shoeing f fe (No.'3 and smaller)60c.;No.4 70¢, across my bowels. so that I hands on my knees. he could do nothing for me. avail. Kilmer’s Swamp-Root,and asI_had Subscript ions Pakéa to all’Pub- -lications.Club Rates. ~RP.ALLISON'S ~ Book STORE. ‘ Too”’—but few Another :metal campaign badge in ~Aninteresting piece in the collec- tion)was a quarter cent piece coinedThe1-4 cent is copper and is as large as the quarters of today.Many people recall that two and three-cent pieces were common within the century,but few know that the governmentonce coined The last piece in Mr.Templeton’sItwasametalbadge,or souvenir,of the 20thofMaycelebrationinCharlotte.inwhichmany neople recall—and_was ‘given him.-by. Another Wonderful Recov-eryFrom Kidney Trouble. For nearly nine yéars I was a greatsuffererfromwhatmydoctor’saidwasKidneytroubleandmybloodwas out of order;énduring all that time excruciating,pain “in my back —and }-was drawn down could only walk with my My doctor saidItriedmanvkindsofmedicinebutalltonoAfriendtoldme.about Dr. tried everything else that I heard of. T bought a bottle of Swamp-Root and -NuptfalaofMiss KaufmardMr,Herbert Hoffmann1 Danville.= The Danville (Va.)Register.of the! 18th-hasthefollowingaccountof the marriage of Miss Babette Kaufman]and Mr.Herbert Hoffmann:ofStates,ville,which ocecurred at Danville on:the evening of the 22th:- In the presence of a.throng of rel- atives and friends assembled from sev- eral States in the Beth Sholem Syna- gogue on Sutherlin avenue,at 8.80 o'clock last night,Miss Babette Kauf- man,only daughter of Mr.and Mrs, Julius Kaufman of.this city,and Mr. William Herbert Hoffmann of States- ville,N.C.,pledged their troth eachtocachinholywedlock,Dr.Edward N.Calisch of the Beth Ahaba Temple, Richmond,‘Va.,being ,the officiating minister.“They synagoguewas not sufficiently large to provide seats f->all of the friends of.the bride and groom who had been invited to’the wedding re- ception which followed the ceremony, so tickets were issued admitting the recipients to the synagogue towitness the ceremony.The edifice had been beautifully decorated by local florists and presented a charming background for the wedding tableau.”“Flowers; white blossoms and dark green fo- liage predominated in producing.the! charming decorative effect. The space before the altar-was massed with towering palms,_while the base of the decorative design embraced ferns and'other foliage in vrofusion,arran very effectively. White blossoms everywhere relieved the sombreness of the foliage and glowed against the rich background. Lighted candles were so distributed among the tropical foliage as _to heighten the effect.Southern,smilax was gracefully twined at every avail- able point.where the effect might be enhanced,and directly over the heads of the young couple,while they took the marriage vows,was.suspended from the ceiling a canopyof -smilax. The:head.of.each.new,.was.surmounted with eens and blossom and the air was redolent with the fragrance of roses,.lilies-of-the-valley,narcissus and other blossoms.‘ The services of Miss Brewer,organ- ist of the First Presbyterian church.and..an.accomplished...performer,..had. been secured to play the marches an to render selections while the congre- gation was assembling.For the pro- cessional Miss.Brewer played the fa- miliar march.from “Lohengrin,”with its jubilant marching strain.When the ceremony had ended and the exit.be- gun,she played the stately,melodious march by Mendelssohe. The procession to the marriage al- tar was in the following order,all save the bridegroom and his best man] entering by the main aisle:The ush- ers,Messrs.J.B.Wallace of Salis- é 1 it did wonders for me.IY prize it high er than any other medicine and shall recommend it to my friends. wish to add right here that after us sound and.well,and feel like I migh live a long time yet to tell what.you medicine has done for me. Yours very truly,‘4T.C.CLAY,750 Sugar St.Marion;Ohio.State of Ohio,, -Marion Go. C.Clay,who subscribed to the abov statement and made oath _——THE— |Paine View Dairy Has just had its cows tested and they were found in *good condition —another~—}}—reason why the Dairy with — *||the Dacro System should «be patronized. -='PHONE 847 BLACK,— a an ee e CHARLES W.HABERMAN.Notary Public,_Marion county,Ohio. Letter to|Dr.Kilmer &Co.,Binghamton,N Y. bottle:It-will-convince anyone: neys and bladder.sure and mention the Statesville Sem — P all drug.stores. ing Swamv-Root for two months I be- van to straighten up and am now Personally appeared before.me this19thdayof,December.A.D.,1914,T. that the same is true in substance and in fact. |Prove what Swamp-root willdo for you Send ten cents to Dr.Kilmer.&Co., Binghamton,N.Y.,for a.sample sizeYou will also receive a booklet of valua- ble information,telling about the kid- When writing,be Weekly Landmark.Regular fifty-cent and-one-dollar size bottles for sale at bury,N.C.,and Mr.D.Franklin Wal- lace of New York.SMrs.Louis L.Kaufman of Danville and Miss Hoffmann of Statesville.N. C.,sisters of the bridegroom,brides- maids,.followed singly.by Mr.Louis Kanfman and Mr.Aaron Clarke of Richmond.Va.;then Misses Emily Schwed of Summerville,N.J.,and Ida Clarke,of Richniond,Va.;_walking together:Mr.Beniamin J.Hessberg of Richmond and Mr.Isidore Wallace of Statesville.singlv;Miss Corinne Clarke of Richmond and Miss Rena Herman of Danville.The six hrides- maids wore charming gowns of Lucile model,fashioned ‘of ‘satin,veiled in tulle-and silver lace with garnitures of French rosebuds in-—pastel shades, three of the young ladies wearing pink and the other three white satin:”Thev all ‘carried shower!bouquets of La France rosebuds and sweet peas. Then came the maid of ‘honor,Miss Merle Hessberg.formerly of this city, but’row of Richmond,herself a pros- vective bride,but on this occasion acting as maid of honor for Miss Kaufman.She wore a superb gown of pink taffeta,veiled with tulle,and with a touch of silver garniture.a carried a hat bouquet of La France buds and sweet peas.« Next came the hrids on the arm of her_father._Mr._J.__Kaufman,__Her magnificent gown was a Paauin mod- el of ivory -satin ‘embroidered in vearls.court train:and a bridal veil of tulle flowing to the end of the train II tr e i- -.|DRAIN YOUR FARMg t Any quantity 4-inch and -6-inch DRAIN TILE on -hand.Tait Common Bricks,Face iie delivery.Bricks,always ready for: Statesville Brick Co. and canght vy with:sprays of lilies-of- the-vallev.She carried a shower bou- CANNED.GOODS. String Beans. Corn. Tomatoes. Peas. Pears. Apricots. White Cherries. Peaches. Pineapples. |C.WATKINS for |<“Everythingto Build With.”|FULL STOCK.-LOWEST PRICE BF looriing,Laths,Lime,Cement,etc., Shingles,Doors;Windows,Ceiling, ,Siding,Boxing,;Mould- ext Planters’Wh.Statesville. Raspberries: Ss Miller-McLain Supply Co. valley.Her.only ornament was vlatinum.and diamond _lavalliere, +|fection--and esteem of Mr.and Mrs.Julius Kaufman, rents of the bride,in honor of Mr, at a several years.room,and both the private dining room and the large general salle-a-manger of the hostelry had been engaged for the occasion,andeveningallwerethronged with a mer- ry assemblage of handsomely gowned ladies and almost as many gentlemen. the main parlor consisted of Mr,and Mrs.Julius Kaufman,Mr.and Mrs. W.H.Hoffmann,the.bride and bride- grofpoor,and.Mr.and: guests were introduced to the receiv- ing party by a bevy of handsome Dan- ville ladies and extended their con- gratulations to was maintained,there was a constant stream of guests,in all nearly or qiite’five hundred ladies:and gentle-, d|Sam is tevyin avet of bride buds and lilies-of-the- ‘aa relatives and .Besides the gifts,many senteircordialcon-lations;eo ‘TheReceptionThewedding.reception tendered b:a- Mrs.William Herbert Hoffmann, e Hotel Burton lastnight from-9 mtil nearly 12 o'clock,was one ofthe largest,most brilliant and:elegant in I its appointments in this city for The parlors,reception during:the.entire The receiving:party stationed ‘in oom;Mr.and Mrs.J.H.Hoffmann Statesville,N.C.,parents of |thers.Louis L. aufman of this city.The arriving the happy pair. For an hour,while the receiving line men,calling to extend their congrat- ulations and.pay their compliments to Mr.Hoffmann and his fair and lovely young bride.From~the reception room the guests were conducted by those assisting in the reception to the smaller dining room and here a-group of Danville’s prettiest girls of the younger set.very effectively served them with a salad course,followed by an ice course and ‘a delightful cold punch.Above the rippling laughter and the almost continuous murmur of many voices the strains of music from the orchestra,‘stationed in the rear of the main dining hall,.summoned the young people to the almost perfect dancing floor,which was soon throng- ed with couples:dancing the new and popular steps. LTS Federal Special Taxes Due— “Prompt Reports Required._ The matter ofpaying’taxes is ever present in this glorious lan of freed- om;‘and~the-people on--whom-—Uncle g'tribute-had_bettergive heed,lest a worse thing come upon them.:: Dealers in tobacco who sell as much as $200 worth annually must vay a tax of $2.40 each six months. This tax must be paid this month. The special’taxes levied on thea- ters.bowling alleys,etc.,is now due. Tf the taxes due this month are not vaid by February ist a 50 per cent. penalty will be added. “Individuals who have an income of $3,000 or*more rust also make re- turn.Single men have an exemption of $3,000 and married men of $4,000 You Can Still Join the Christmas Savings Club ; Over 900 have already joined,and we feel sure the membership will run over 1,000 before the Club.closes, If you have not already joined,you may do so now.. The payments are small,and may be made weekly,or in advance.|Hey We are glad so many of ourfriends from the ¢ are joining.It matters not where you live,you can.join the Club.a EN Nats All that is necessary to do is to decide which class you want..to join,figure up the payments due,or the amount you wish to pay,and send it in with your name and address,-and the membership-card will be mailed to you.nate ear .You may join one or more of the following classeswe.te'et $25.00.-MemberPepacersget DOO.00 Members.startin monFc d.increas-» ing 5c.each week for 50°Qi PP ee weeks,...get...oe 01D Members starting with $2.50 and de- creasing 5c.each week $63.T5 we mi :°Cee ti4 afor50weeks,Bet sages De | -Members starting with 2c.and increas-ee $3500ing2c,each week for 50° Members starting with $1.00 and de-'weeks,get .... creasing 2c.each week $25 504a:BO GP Vy Members paying 50c.a week,fixed,50 weeks,get ee eee 8 for 50 weeks,get ...... If there is anything about the plan that you do not understand,we will explain fully when you come in,or * if you will write us we will send you literature,and an-”é; swer-any_questions by,mail.|See Merchants and Farme on Federal income taxes.but the law requires every person who has a net income of as much as $3,000 to make report,even though the income is not taxable, by March 1st.There is a penalty for failure and the failure to report may result i court. doine business,or if in business and making no profits,must make return by March—tst.—$———$——— The collection of State taxes 1S usually lax.Often taxpayers take their own time and depend vood nature of tax collectors to save them from trouble.That is,not Un- cle Sam’s way.,He is strict and his tax collectors have no discretion.If you have business with _Uncle Sam, better not take chances.He doesn’t stand for negligence. antees That Hyomei Will Relieve the Worst Cases of Catarrh in Statesville.Soar es When one of the most reputable concerns in ‘Statesville guarantees or they~will —refund-the—-money,—it speaks volumes-for the merits of that| remedy.”It is in this way that the Statesville Drug Co.are selling Hy- omei,the treatment that has helped | so Many cases of 'both acute and| present from the briderroom. bert Hoffmann.accompanied by hest.maf.Dr.S. W...HoffmannStatesville.N.C.,entered ly with the appearance of the b and her father and met them at th ing rabbi..Witk the bridal grouped about ‘the altar,Dr.Caliscl the wedding service,with responses by the couple.He prefaced the mony itself by a brief statemen tive to the beauty\and sanctity of th marriage relation.- bride,was gowned in gray panné.vel vet with diamond “ornaments,: Long Loaf Kiln Dried ‘Pine Flooring,Ceiling,Boxin Mrs.J.H.Hoffmann,mother of th bridegroom.wore a_superb’gown 0 g,|cloth-of-gold.veiled ‘in orchid The bridegroom.Mr.William Her-his| of |spray—orfromth¢/bed in. rear of the synagogue simultaneons-ride jand eithat comes with every outfit.Benefit! head of the aisle before the officiat-partv|first treatment. cere- Mrs.Julius Kaufman,mother of the while|e;expensive and f|dropper and sufficient “Hyoméi tulle several weeks’treatment. aa bee ,|Coite L.‘Sherrill,M.D., :Will answer ‘phone calls left *#at Dr.Long’s.Sanatorium or \4 |Geo.M.Foard’s residence, t _ -§Butter Wrappers! Weatherboarding and Casing are best and cheapest,because they stay where they are nailed and cost you less ‘mon- ey.C.WATKINS,Next to McElwee’sPlanters’Warehouse,Statesville,N.C. TWELVE ‘GRADES “Pine,Cedar,Cypress and Tin,$2 per M and up.SHINGLES!‘-C.WATKINS,Next to McElwee’Planters’Warehouse,Statesville,N.C|| We have the.very best OLD,NEWSPAPERS —All you want al 10c.a hundred.Worth this to start fires Parchment Butter Paper,and can print your.name“and brand on same.Let ushaveyourorder.for anyquantityyouwant.See us.’Prices reasonable.* A Gapony,=-=Net)onenek raiony.Dec.2i—8t"_ ~.|Metéalf,»[the value with.Also good,to.put under carpets andpaperthewalls.Come to THE LAND- MARK.for--them.art |els atlasesil splaas R G.ROSSER,M.D. GENERAL Bele ae N iv |F ( mat ok t, and with bodice of ,goid brocade.| The religious ceremony concluded,| the wedding party_and guests went te the Hotel Burton,where a large and| brilliant reception and dance followed. Mr.Hoffmann and his bride left.the| nity shortly after midnight for a wed-| ding journey.which will include in| its itinerary “Washington,New.York,| Boston and other northeastern.points; of interest to tourists.Returning,} they will be at home in Statesville.| N.C..where the groom is connected| with the Wallace Bros.Company. Several hundred wedding —gifts! were received by the charming bride,| manyof them coming long distances.| These include’handsome pieces of| oy _|ailver,sets of flat silver,cut glass. china.bric-a-brac and a great variety| of other articles expressive of the af 3 The Gint of Me Pi“Laat December,t bad a very severe cold and waarealyvowateke in beds T bought.two, bottles.of “Chamberlain’s Cough Remedy and} it.wos.only om.very few.days until 7)wasletelypentoredtohealth,”writes’,J.Weatherby):Mo...1fyou would know ‘thie vemely,ask any one-sv’tined.It,Obtainable everywhere, {will refund your money. |day in the week until fur- ‘ehronic catarrh in Statesville and vi- cinity., Hyomei is not a a lotion I€*is an oil,the air of which | pill nor is it a ust breathe in your nose,j youd : lungs by the aid of an inhaler |will usually be seen from the very| This aid destroys all germ life in1 in his impressive manner.pronounced|the air passages and lungs and enrich- lesand purifies the blood with the ad-3 \ditional ozone it supplies.It _ban- t rel-|ishes catarrh of:thé,head and throat »jand respiratory organs.Wherever 'tarrhal germs,there Hyomei will dolitsworkofhealing. The complete Hyomei outfit is in- includes’an ne or Remember that if Hyomei_does not relieve you.the Statesville Drug lo. LISTEN! Bristol will continue to buy: or gin your cotton every bereA ther notice.Come,my friends,any time it suits your convenience:We will.be at the old reliable stand} ready toserve you. 4 and the report must be madej« n indictment in the Federal/){ Every corporation,even if-it is not|§ on the\§ Has Faith in Quck | ~Remedy for Catarrh)} The Statesville Drug Company Guar- that a medicine will produce benefit|§ \q that must be rut |f throat|————-_—--+— these mucous membranes contain ca-|§ rs’Bank,i ae_Of Statesville,“The Bank For Your Savings.” Big Bargains in Fine Odd Bedsteads,- Dressers and Rockers.ook by A LOS We have 27odd-Rugs—27x50—worth - $3 to $3.50 at $2.00.Also some small”” Set pee Rugs.Must make room for our new spring stock. i| éRepairing That Repairs!(TERMS:CASH.)4 wh akOurrepairdepartmentisthemostcom- completely equipped automobilo repair shop || in this part of the State.Special tools and _ time-saving devices enable us to turn outa job in much less time than the average shop.° _Qur mechanics are experienced and when you bring your car to our shop you are not. paying for guess work and time thrown away for lack of experience.We guaran- “tee all repair work and make a specialty of.\ repairing Ford Cars.ee e ‘Carolina Motor.Com /“SERVICE FIRST.” atesvillé,|'-“Mooresville:Sta 3 _FOR CONSIDERATION. oreigners employed by} (eROM OVER THE cot INTRY.|- 104,gone dissatisfied.on account:of| ‘|wages,started a riot in which two or =ithree:people were killed “and many’ wounded and-destroyed property ‘of the estimated.value «x $1,000,000. a eee 1,00 jly forthecrime-—if it canbefixed 07] the real perpetrators,which is doubt:| times.ees ‘iets have m Raleigh of ‘alleged mis- _,Management of,the Soldiers’Homo, the complaintbeing made by the in- ‘come Wihiam ance on the property can’t be eollect- 1 accoun he circumstance:The Home is under the con-|°"°"count oft js Cee Te;under which it was destroyec,-tro!board of directors.composed |‘dabei »tdamages can't be ¢olleeted fromstanding;and most or all i Ou Taitadarats veterate county or State.Ohio”has a well|.i "gets es ilaas ceaicathe foe jorganized State ¢o rafnment—in the —coe i 1 Aish sy i,the |hands of the Republicans at present,:é i ,as is I sie : case of all the State institutions,the|by,the way—-there was.no tay Home is examined by the Staic Board|War or insurrection up to the time ef aJeia:Tha arof,Health,the board of pubiic im-|the outbreak of the mob.The author 1000 ba! provements,aie.ih de one radolled-|jities seem to have acted as promptly |y;aiight jas possible and restored order prompt-loftion,that these complaints have heen|°°?I es.‘mat and |tive.of Mt. Preside ater TH ca at East Youngstown,{tems of Interest About VariousMatters. "Philander C,Knox,formerryofState,»United States Senate in Ponugpive- nia, is os Téxtile mills at Woonsocket,‘The rioterscan*be punished personal-!and Taunton,Mass.,all annowAereaseof6per,cent.in the wages’ tof-their-operatives,..__ »A voluntary wareful-—but.the:-property owners have |Loonts.a day hus.been granted 25,000 | no.recourse,Attorneys employed toimine and smelting employes i Butte,| investigate the matter say the insyr-}Anaconda and Great Falls,Mont. Sparger, manufacturer of Bristol,Tenn,,died a!ew days ugo,aged 72. Airy;N.C.but the jin Bristol sinee '874. nt Wilson has appreved Sen:|;man’s proposal to establish! A. ja government (Hearings on Senator Tillman’s bill he-| state of|fove the Senate navial committee to- rs,-W undeter mined .ly.“But before the ul £o Springs,Missatedinthepast‘and found|!9 But before they:could --the ‘half million.epee ‘jy {Property of many people was destroy:men*«to hav little or no basis.Recent y |Retrial of.fix!ed and these people have no'‘recourse,the Newtheyhavebrokenoutafresh,It is| said the complaints are confined to a! few inmates,that the great majority:;&:“|}pect of the East Youngstown,case w“|Ateresatisfied._,a t;a i fattract little attention.In Mexico =|disAnyoneWhoisatallfamiliar.with ;koReesrevolutionhasbeenssfor|™the conduct of public institutions of For ives aiaae eran €Qe Vt $senycharacter,knows there are always},"«Servenl ins,“nae there has been no recognized authori-|"ome inmates who can’t be satisfied.ent -3ld people,weak mentally as well as ,physically,and sick seople are prone to:complain,no matter wnat ine con- This is a condition for.awhich rem@dy has been found,and this yi in prog statfive,years.two or |CCtycapableofmaintaininglawandor-|i ae der in Mexico or in any consider:able |American portion of Mexican territory.>As : is always the case under such ciren m- and order could not be maintained.sthesepeopleandtoinvestigatecom-DvrangoTherewasneither ‘Landmark.has.an idea that the com- plaints of the Soldiers’Home manage- ment are not well founded. “s Pe eticansto,get out of Mexico and stay of ¢ out and offered to help those unable,cur Territory is always under the sovereignty’of ¢ nation,and-the authorities~of a na- tion can do.what they please'in that! jremoved,-Not only can tovacco be The bill pr shipped-to neutral countries,but ne mainder Mc of the authorities.If it is uncertain;Permit them to get food and clothes who the authorities are in.that terri-!—not even milk for tory he runs at once the danger-of |War is all§loss-of liberty-and life.” .At leasttwo-Sups have held that,notwithstanding wart law,an individual may bring -into the State as muc~whiskey as he}1 the children.He ‘then some. erior Court judges| —Have-to-Go-«charged th If this nation finds it must go into.thelexicahef« =ireorder.ean be establish-|ihe mails. in the c ishing Company of of its alleged officials,who’wereShermansaiditwas-and-charged with sending obscene matter through the mails¢ violent anti-Cathalie paper and in,itstheShould-Stay in Mexié}if We attacks-on the ae Church-it was _he paper weed inVato (hich was Concluded ten days ago. vs of Wuropean ynflict COUrts. no 4 nu ditions;and we venture the assertion I “on urint a testanes,stances,the-criminal element has rahatnobodycouldpossiblysatisfyallviot“-Murder;~“urson:theft 4 att Th::i <a <d fader,“arson,anc a VatheinmatesoftheSoldiers’Homie’br!|::‘rare .4,Jother crimes-known to the calendar|@"¢of any other public institution in the:’were common,because in the disor-!State.Thero will always be com-;aie .it::/-:ganized.condition of the’country law prem!,plainers.It is proper to safeguard :aeaa ovide 000 in each Stete.]in the ratio which the pop- The ase of Secke ta-a candidate for the RL,ice an a prominent|| ‘He as a na-|ud lived armor plate factory./ >.cation ‘compress niaak:5, of cottonjere destroyed by sfire and 20 loaded origin.at.Hollyestimatedat.a wh ‘e former directors:of Loss Hi aven &ailros id,under indict-| »to violate the, n of the Sherman ;been ordered by| rrogory.The jury) 1 of these mén,| who have ;during the; is to be determined It is possible that an) accepts Amer arm! settle the ||‘s of |Americans| Mexico is ‘the! a,Department,,but ,not counting “the tocase bmbes 2 Mormon colony at Ca- nere still lera and other points in} are at Parral,| '+os :safety for perso \arrailplaints.—But-it is very unjust tovair i aronere :.-J whose contrel by Carranza}:::nor property and no authority tha‘han 800inthenewspapersthepettygriev-egecae ‘jis.dot ‘btfeh nore.than 3800.::bg :could -be—held--responsiblo_for—such t-5590tewembers of the ‘entiances.of a few chronic complainers 5 ine .+| é “Hi never——be-—satisfied-——Th safety.Recognizing this fact.the ca vegroes)of the United |b isfied:IC ;ci :zgovernmentrepeatedlywarnedAmer-stationed “at |SgHOrcns)tenderloin district |f c and houses oc-|; people to get away by their own efforts.Wes ated.%was not until).5 N thetand:inves i a ba the Second,Infantry,|THE REASON.|Notwithstandingall.this many Amer-wich nets,tame ta thé aid When the agitation was on last|!ans have remained in Mexico and/of the }hat the rioters could be; ummer about the Lusitania and oth-/™any have gone there,for one reason restrained.|_.poh ene BeervesselsattackedbyGermansub-|OF another—prompted by the spirit of |The roma sy uy Ero uies|::resident,who died.amarines;some of the critics of the|#dventure or the idea of making mon-0,is,Thursday night,were | President wanted to know why,if)ley,in the maing#®and whenever.one of jinterred there.It is uznderstood they | .;So ee .Moxt city =President Wilson could warn Ameri-these Americans is kiiiéd,or ~his|-vill be taken to Mexico ee bee!| property destrayed,there is a shout M2nent interment when peace =tans to get out of Mexico and stay out,y S stored,Hnuerta’s body lay in state in|he didn’t warn them to sray off ves-lof indignation from many people andi)paco on tl y of the funeral and| els carrying ammunition.The Land-|"¢Wspapers in.this country,followed many of his former adherents vicwed.| mark suggested at the time th:at |by ademand on the government to pro-05 remains.‘°a :.Mean .de5tectthepersonandproertyofArner-Arguments were eet ade lastprobablythemainreasonwasthat}:prop ‘lneiada fie lhabands Comment at that time Mexico had no govern-|jicans abroad;and a denunciation o1 €is on “pron 1 ine“relased | ment’that could be held responsible req administration for failure’to af-son news print,wrapping | ds-of paper,fr st=for outrages on our.citizens.After|-this’protection.nds~of paper,from Enstnoe¢.a Consider the-cases of th nC and in Michigan to points |§the killing ofthe Americans in Mex-|_e~cases “of the’East 4,4,the Mississippi river and the| ico last week and it was pointed out)*oUNgstown mob and the Mexican seaboard,the Great Lakes and’the. that Americans had—been warned to.“886%:and see whether they do not Chio and Potomac HIeR aS in-) :offer something to think about creases would tun 2s high as cents|stay.out of Mexico,the same ques-/~~‘6 eee 1 f eye7.OU t 4 {eae eneterenmereensee the 100 pounds. tion came.up again and here is the;The British government has made:<A good roads bill,earyingan_ap-! answer of Secretary Lansing:.lit clear that all restrictions on the,Propriation of ECE ss us im- #6 i “rie {eh}'provement of rural reads,has been:The high seas are common terri-'shipment of tobaceo abroad hasbeen te i aea a ee ‘Congres_tory.to eyery nation.jintroduccd aforexpending $| and half the re-! attempt will be made to prevent the .ey Ree (Ser merSovereignty.On the high seas a non-somes tivo nent i .“a "ulation of each St Bt pear sist0 aiacombatant,whether neutral_or bel-neutral”countrics population of all of the States,it LL _ligerent,has a right to pass to and/Austria-Hungary,Germany and the demand for money iF the Cus ue without having his life endanger-|‘aks other central.powers.That is to Wo nays Rowe ver,the Bill will aed,unless:he is ‘or a ublic .ship.a i In a _territory_he_only-ie the-Habel say,Great Britain will permit her ene-A-verdict-of not_uiliy was-retura— to pass to and fro with the conssent |mics to get tobacco but will not ed by a Federal court jury at Joplin,|Pub- and| The Menace Aurora,Mo., The ‘Menace is a had_used_ob- nt language,which; aw prohibits being cireulated in! case was similar to! putative Doughton ts auot-|that brought against Tom Watson of) wants for his own personal use Bopre Usually the law is interpreted:to!=by..the correspondent of ae Char-;Georgia.“mean that when one *s found with lotte Obser x in favor’ofmorethanaquartonhandhejs/ZOing in to never ‘taking}We.does rot want the to onan if-it aesbeavertedand t the situation eit tly to mak down the flacguiltyofviolatingtnetaw.In Bun?!United Si combe court last week cucge iard-possiblyrtfingheld,in the case of a man w ho © had brought 20 pints of liquor from ny Wennessee,that.there aves-no evicenee,“Our duty to human of guilt”because it was not shown!a thoresooner or la“It -is vy hones xthatthe’liquor for other than|....ee honest opinion t is ~alaety drive said, hat if we may he was lif we have to assume the personal use.It is sate ine Minte |re ;lit}and obligation to keen will appeal this case and it is impor-'the Me )we may just as©»th naibility.Wtant~that the point sviould be defi-|ell take the sponsibility,We ‘he annot afford to ge:o the trouble andnitelysettled.It is The L andmark’s oxpensséof establishing law and orde: “PAINS IN SIDE Burlington,Wis.—‘‘I was very irrag-: ular,and had ra in my side and back,| AND BACK How Mrs.Kelly SiSutfaved and How She was Cured. { } ~recollection that Judge-Webb ren-|nothi Why should we not have -dered a similar decision and probably|some benefit for our _endéavor?”|rrrsrcansrersinacicanameresrena7s_Judge Conner has too.enerenentenmemen7. |Mexican fs)al Formerly,=e 7 :ae aeItfallsoutthattheinclusionof|Sehool at Huniersville. Burke in the list of counties in which’oeae Rad :an adherOe1b v itia In tne S ‘aN PeVOIN-no incomes are listed for taxation Un |fon,nid to have been one of the. der the State income tax law,was anjk @ ader in the massacre of the Ameri-| etror,as the Morganton News-Her-|°8ns in Mexico last week and it js re-‘iported that he has,been executed.|ald said.The records show that the}Roderiguez,as has been mentioned,|taxes paid on incomes in in but after takingLydia,E.Pinkham’sVegetableCom- pound Tablets and, using two bottle the Sanative Wash J am fully convineedthatIamentirely cured of these trou-bles,and feel better ail over,I know your remedies haye Burke in wes when a boy a student of the high | 4914 amounted to $144.7 aiti3,returned for |Some of his schoolmates and otherstynottaxed,must be axation.As our State tax laws are|jbo MARY poderig nee,when:he wagnschooletfuntersyille,remember?iO yn yoselyenforced,Many people liable}thim.He belonged to a prominent and||this tax make ho reiurn and in 30))/wealthy family in Mexico,it is said,/|edunties of the Stato no incomes|land was probablysent to the Hunters ;ville school through the influence ofre“returned;although it is improb-|missionaries of.the Assoc iate Reform-that there is a county in thejed Presbyterian Chureh in Mexico, which there is not ia Jaw-eran] br Sther professional man}7°Drive Out Malaria e t make ovet $1,200 a year. |they need. UPASTELESS chill TONIC.“You know |had killed one of their|what you are taking,as the formuls-is |injured others,the stu-printed on every label,showing it ig|the University pf Pennsylva-|2abolishthe“bowl cle 198 |he Quinine drives out malaria,the |Iron builds up the system.50 cents | .Under the ‘school in Huntersville,then condueted |good and I hope every suffering woman Btate law incomes in excess of $1 200 |the Oe y a Orr,pe Ber a will give them a trial.’’—Mrs.ANNA 7 3 2ernacie 8S “a fs]erormec oI pohfromsalaries,fees and other proper-|pr.ssbyterian.chuveh in Charlotte.|ar 710 Chestnut Street,Burling: |‘The rnany convincing testimonials con-stantly published in ‘the newspapers ought to be proof enough to women who |suffer from those distressing ills pecu- |iar to their sex that Lydia E.Pinkham’s Vegetable Compound is the medicine |This good old root and herby,remedy|has proved unequalled for these dread- And Bulld Up The System |ful ills;itcontains what is needed.to Take the ,Old Standard”"GROYE'S|restore woman’s health and strength,ua If there is any peculiarity inyourcaserequiringspecialad- uinine and Iron’in a tasteless form,{Vice,write the Lydia BE.ham Medicine Co.(confidential), Lynn,Mass,,for freeadvice,«- done me worlds of Pink-« increase of 26); N foreign mili-|' service thus forfeits his citizen-| ud the De partment of Labor:has| were|* 3834Pa4 pa SSS OTE Pn mee nage eer we {The Carolan Motor Co.—Statesville,Mooresville Newton—has always and will continue to grant to its pa-: trons every favor not impractical with good business meth- ods.To do more than this wouldnot be to the best'inter- Fsestofeitherparty..- Begining the first of next month—February |—we willputourbusinessonabasisofCASHorAPPROVED_putour :ROY Ei TERMS.We.realize it is not practical for us-‘or any other EM ane TS concern to do anabsolute cash business.‘There naturally must be exceptions..To take care of the exceptions we will ise terms that are satisfactory and in keeping with safe businessss principles. sf \ Thisnew basis does not apply to gasoline or new cars,but to everything elsein our line—repair work,lubricating ires,tubes7msASSeyoils,greqs ,spark plugs,etc.,ete:,etc. aaapings hse once wilt erable sto save considerable _ the way of bill collecting and bookkeeping.Our, Sere will beg expense int ven the benefit of the saving iin reduc- tion on prices ee charged. ‘Carolina Motor ~“SERVICE FIRST.”STATESVILLE. SE Olnpany, MC NEWTON.OOP,CR ESVILLE:’ Sa eaenau SOEUR ON ee # T h 4 ¢iw Be Sure You are at the Right Place. verry crowd of money savers that are daly faking ad: ost sweeping slaughter of men’s and women’s Commercial activity ar of the m apparel that the section has ever seen. has t bet as in the Sale of J.ML Hundreds of eager,enthusiastic economists await the openinie.of_-the doors,and it is really remarkable to see how these tremen- dous crowds are handledin good order,which prevails through- out the day. Mr.McKee has just returned from the North where he pur- chosed a large ass:ottment of DRUMMER’S SAMPLES at a start-ling LOW PRICE.These goods have just arrived andconsist _ of Ladies’and.Misses’Coats,Suits,Waists,Skirts,etc.Thesegoodsatétheseason’s latest modes and have been marked way below former selling price.Women who know styles,fabricsandworkmanshipwillappreciatethis’great array of bargains. Really and truly there is no printer’s ink that can describe to you the mag mice of this event.m 1 xy er 1never| McKee £(o'sS.;Stock. sti ‘Don’t Be Misled. -M.Niekicc &¢Comp’ys} West Broad:Street.N.Ccas“ie i Mandan e been so.effectively displayed in-Statesville af ‘12 value,now ......:$6.69 :;BOnelotofLadiesSkirts—:6 value,now:........3.98 Children’s and Infants’Shoes, Serges,Corduroys,ete.$8 value,now .......-4.48|now 49c.and up. $8 values,NOW ..se.ee $4.98 |Men’s Work Shoes,extra quer:One lot of Ladies’Raincoats,$5 value,ROW\...++.++.2.98 ity,regular $2.50,now .$1.75.|values to $6,$1.98 and up. £6 value,NOW .ere.ccae 3.39 LADIES’COATS, :.All U‘Ladies’fine Shoes,Button and [$5 value,now .......$2.98.nladal’be:BUT oY Ge Lace,values up to $3,now 98c.+$6.50 value,now “2 ROGET ER SUG ONE._Val- /\:ues,now 19c.,39¢,,79¢.,re-a8 cy a ;|One lot of Infants’Coats,ex-tively,All.MilliMisses’Coats,,latest |styles isles :*°|spectively,i inery:at and Patterns.Hs ie fine values,now 98c.and |bog rockprices,ge . Pdebene oF RE E S E eso » \ : -#‘“ ‘Mes oe oe :7 ‘ i Bid 4 #¢as , Se Rene ioe nsec MS “)“gtitutional —dise~’*tutfonal treatment. qualified as administratrixHeWhite..See elke Secondhand Fords and.\for sale—Carolina Motor Co...----¥ounge lady wants position.—Ad- dressBox 47,“th rect ¢belt pin.— Reward for return ofBF,Russell.-i.Manure for sale and oat strawwanted.—E.M.Sentman,_.Young lady.wanted for office work,Write M..care The Landmark.fJ.Paul Leonard has™qualified asadministratorofMrs.M.J.Leonard,Py P,-Dulin,commissioner,-will-sell land February 21,‘Today,tomorrow.and next day gttheLyric.: “R,V.Brawley and L.C.Wagner|ve increased the reward forthe at-mpt at burning the St.Charles ho- CaeOT AR S.R.“Brown and son.L.C.Brown,aré State agents for shock.absorberandsnubberforFordcars.|The Carolina Motor Co.announcestoitspatrons:a change in method of doing business,ae : ,Special sale of Kclipse shirts.Sherrill-White Shoe Co."Bargains in rugs.—Statesville Housefurnishing Co.Repairing that repairs.—Carolina Motor Co;Stationery.—Statesville Drug Co. Saving for a home.—First Building and Loan Association..You can still join theSavinesclub.—Merchants ers’.Bank. Hams and.evaporated peaches.— The Robert Bunch Cash Grocerv.° Join the sale crowd at J.M,Mc-| Kee &Co.’s.Monitor.radiator base burner.—| Crawford-Bunch Furniture Co,° A week of remnant selling.—Mills| &Poston.«*:mtClearance68ebegins Thursday.—Ramsey-Bowles-Morrison Co.| Annual white sale bégins Thursday. —~Johnston-Belk Co. Wedding and Serenade—Better- ment.Society,Etc.| Gorresvondence of The Landmark.i Statesville,R-1,.Jan.14 —The young people are easily excited,and especially on a wedding day,when the| boys will gather up saws,Horns,‘bells and all things that will make a noise, as they did Wednesday night.serenad- ing Mr..Q.L.Freeze and Miss Fan-| nie Plyler after they had driven to Troutman and had the marriage ‘cere- mony performed by Rev,J.C.Keever. Mr.‘and Mrs.Freeze will make their’ home with Mr.Freeze’s parents.We wish and hope for them a long and happy life.\, ‘Our’Betterment society met at the Plyler school ‘house this afternoon. Next.mecting with Mrs.Emma Bass.| Christmas&Farm- We have decided to’have an oyster’ supper at_the,home of Mr.and Mrs.| W:A;Dearman Saturday night.22d.| The proceeds are for the benefit of the new school house.Everybody,is| kindly_invited.to come. plenty.of.oysters,pickles,_cakes and| all.good things;am sure you will get} the worth of your money..Come ear- ly.ay Our Moonlight School has closed and_I-think that a lot of our pebdple | have been benefited by it. The “health of the community_is very good—alf-except colds. Upright,who was ill with pneumonia,| is better,Iam glad to note...‘ Personal Mention._. Mrs.B.F.Long spent Saturday in —_Charlotte.Miss Elizabeth Gitt of Hanover, Pa.,arrived in Statesville Saturday far a visit to Mr.and Mrs.R.B\Cook,Maunie and Annie Forcum,Ed-SPECIAL en Rugs and =Druggets at| ple.i :h _imoniaand Roy--Heath,Maggie and|THARPE'S 6 and 1goStore,|| Lelia —Corpening,-who—spent+ppp a ‘:Fi, HSE PETINBy pent inie Maiden,Maudie —and-Dewey|nig LINE of new goods at THARPE'S 5 awhile at home,has returned to Rock- ingham.~~: Mr.:Robt.L.-Jenkins.who visited _Mr,and Mrs.John M.Sharpe,has re-|7turnedto-Radford,Va. Miss Ruby Eldridge,who was the guest of Mrs.F..A.Carpenter,left Saturday for Her home in -Washing- ton.i Mr-Emle Clarke 6%Richmond™is spending a few days’in town.Ss sascsieecoalgefemesia Songs For Rural Schoo!ls—Ret- terment Asscciation’s Request. Reported for The Landmark.. “At the-college Saturday the.Iredell Betterment.Association distributed 60 part-songs for mixed voices for the four schools,in the county having pi- anos,and four dozen copies of,the mu- gic for the North Carolina toast,one dozen of which were donated to the askociation by the composer herself, Mrs,§.D.Sawim:of Lexington,a former Statesville girl,February “2th a chorus will sing this toast when “Prof.‘Branson of the State Univer- sity,a distinguished authority on ru- ral problems,will address the "Neach- ers’Association.Every member 0 the Betterment ssociation is urged to attend the next mecting,which will beheld at the college Saturday,Feb- ruary 12th,at 10.45.To enable four children in the county to attend ‘schoo the association requests.suitable clothing for a girl about 14 years of age,and three boys,aged 6,10 and 12:years,Any donation will be,glad- ly recdived by any officer of the asso- ciatton-and will be forwarded to these children.This need is an urgent and worthy one $100.REWARD.$100. readers of this paper ill be pleasad .to learn that there ts at least one dreaded disease that science .hus been able to cure in al)ita steges,and that is Catarrh,Hall's Catarrh Cure ix ‘the positive cure now known to the :ical fraternity.Catarrh being a con BO, The Halls Catarrh Cure en internally,acting directly upon ood and mucous surfaces of the destroying the founda- tent strength by.build Sy the:oun~stre ,by.ng u con- at on assisting nature tn .doing y)taytak Send for gstUO,Pole: '|A:WEEK’S SOCIAL EVENTS. Club Meetings and Other Social |Mrs.E..M.Land of Goldsboro was We will have }“Seee Mids Waterlily.” “Mrs.R:E.Clapp will receive this;ernment for-a tong time holding this; Fafternoon in honor of her guest,MissMrs.| |The Parents and the School. “lGom TALEie SAT 1 smartest,from their own reports.Yet;COMMISSIONER 8 SALE requires a-consti-- ‘he Ce vanetct fe ad8.NO that:rki‘Dollars for 4 ny case i ‘ Honor Roll Duck Creek Schoo!:|. Correspondence of The Landmark.’| First.month—Beatrice and Ruth Cash.Willie,Lottie,Hattie and Har- old Hoover,Guy and Eugene Smith, Maty and Jettic Plyler,’Rochelle } Miss Blanche E,.Tutter Mr.Q.T.Hollarid were pee go “4: \the 1915 ¢otton drop amounted to 532,-552 bales,against 462,073.balesiyeat,to that date.Cotton seed crush-ed-to January 1 was 2,628,610 tons,against 3,838;176 tons last year. pioht Cotton Seed-and Linters.Linters ohtained to January 1 from last a good deal.of material was gathered|~A oes ey | te Prof.Frank Brown Of Trinity *Once—in awhile—not oftén,*| College.“A-piano solo followed.The},,praise be—something.happens © club president,Mrs.Whiting,told of}that causes delay in delivering * the class of 20-irls which she agreed|;,Phe.,Landmark.Numerous et to teach domestic science at her*home.|.,things can-happea,—that_can-et Mrs.R.T.Weatherman read a good),net.be foreseen or prevented,* article on home economics.Mrs.Geo.),b to cause this delay.The hand-e B.Nicholson gave an interesting :ac-),mark has -pride..in_prompt de-*| count of the New York club biennial!,liv ery-and=aty.deny anneya: preparations..Mrs..Rufus..A,Cooner|,the office more than it can an-aI read a five article on “The Benefits|,ROY patrons.Within the week ZofMusictoaCommunity.”Mrs.F.Ts)y The Landmark has had trouble * Meacham read of«“Open Air Drama!,with delayed shipments of pa:.| and Pageants.”Mrs.Frederick Con-|,Be"and-peor quality of paper"y cer related the “Spanish.Require-|,that caused delay.This -is;the ' ments in Railroad and Manufacturing |.explanation,and on these occa-ss Masiness of |Today."....Mra.D...M.[°Sioas,which we:hope ©wif be |more rare,we bespeak the’pa- Ford Cars.Sold on StateAgents for Big.« Six Shock Absorber and Snubber For .20 days trial and*: money back if not satisfied,Office in Commercial National = Bank Building. THE the home of the bride near Zion|Millsaps,Dortha and Tom Mills,)">?yy rales chureh,in Union Grove township,|Pascal Raymer,a weed ware apnea ad 29 Bie bates Cee Both parties live in-Daion Grove town-Second m:nth-—Willie,‘Lottie,Hat-oF titer nh iohtained ,Y aalber 2 ihe ne ie and face is Boorse).sla ce and {of linters were obtained.fb z qe :é ‘ree Murdoch,Rochelle Millsaps,|;;oan get Quite a number of young people|Dortha and Tom Mills,Pascal Ray-oatnot ae -mee ae ae Vi eg ty rticipated-in'a-dance held-in-the-An-|mer,-Guy-and-Eugene Smith,Alvah for only,60c.Others charge 75 cl LAE dersonhall Friday night.Mrs.John|Troutman,Brown —Murdoch,Max'for the game Axe.—-ad..eet ny |W.oa spanerene.A large Edi-Se eee eae Pool,|Hor-~Bot Stel : son machine furnished:-music.tense Smith,Reid ‘Troutman.~~~:= ast week’s meeting of the Night}Our enrollment is 41 and.the aver-MARKET REPORTS.ES a ee Bridge club was held with Mrs.J.W./age attendance is 88.Our school “is Btatesville Produce Market,p g Wilson.‘f |progressing nicely.Bae eory The following ‘prices were paid yesterday fA Y DIRECTORS "Whe officers of the local.lodge of|The young men of the school have {produceon the local,market Alar ae eee Knights of Pythias entertained the|organized a debating society.Mukees dhe sere (4 lodge at a fish fry and oyster stew|°Mrs.Jo.Hartline and giater-in-law,|_Henap’ite,per ib.»DR.M.R.ADAMS, in.the lodge quarters Friday night.|Miss Ethel,were the guests of Mrs.}Se oy a er .(Physician). The noveltyof is event wes the zack 0.A.Murdoch this week.sree ie pantie §Ww.T KINCAID, that the lodge officers did the cookin er aeemeerprmmnarnreisreMen Beeswax,250...per.Ib.traf./ot and serving of the fish and Soutere School at Liberty—North Iredel!)Green Hides,tie.par ih EE (Lumber Dealer). and they did it well.&News.a GreeHams,ate Ato:serIb,Nall A.’P.BARRON, ‘The First Baptist church held.its!correspondence of The Landmark.©Sides,“ioe.perIb ie “|s 4 (Merchant). annual roll call and reception at the!ffarmony.Jan.16 —The sciool at;Shoulders,120.per Ib.Halt Sat.!T,D.MILLER church Friday evening.’The ‘conzre-|;iberty is progressing nicely with Red Handy,$e ae Boma b Atay (Cotton Manufacturer). gation met in the:main auditorium,|\yy,¢,W.Sharpe and Miss Clyde Jen-|SARK EROT MONAR:MORONET te eae per Ib.Leal where the church roll was-called and|ninws as teachers |Graiz.~Pr SHH R,A.COOPER, vratifying reports from the various Mr.1.G.Reid <a preparing to erect?The following pricés were paid yesterday Vee |‘(Capitaltst).i departments of the church work were!new dwelling on his farm in north|wheat,185 a ily.+ISIDORE.WALLACE theard,.after.which all repaired to the|Togell,Ng |Corn,inew),606%per bushel.ay (Real Estate and Cotton“Merchant).Re: Sunday school department.where an|Miss Armie Mullice,who “spent Efe Cate,bbe per bushel,eee spin ncencmenss fo sep ST ea ST Va ee eae hour was spent in social intercourse.|holidays with home folks,returned-to|og ile Cotton Mark efit,el JOHN F."BOWLES;'eh During the social hour Miss Annie B.|in Wednesday.Miss Esther Reid}On the mine geaor Se As ips SG |(Merchant).eae Terry gave a number of readings“and is visiting her father,Mr.I.G.Reid.pound wae paid for best,erade cotton.T.N.McELWEE, the:Baraca guartette rendered two She swill return to Statesville Satur-|ON ee kal (Tobacco Manufacturer). selections.Refreshments were serv-|jay,where she has a position with the ed by a company of young ladies.Ramsey-Bowles-Morrison Co.~L,B.BRISTOL, Reported for.The Landmark,re |Mr.“Amos Templeton.whe moved (Cotton.Dealer). On Friday afternoon the XXth Cen-jhis family to Winston-Salem a few R.B.McLAUGHLIN, tury club and ea few guests were en-|months ao has teturried,He thinks |~S.R,Brown &Son (Lawyer). tertained by Mrs.J,FE.Heinzerling|there is no place like old north Iredell.|\es f W.F.HALL at her-home.on,Tradd street...The se pom me ar ot Statesville,N.C :Druewis programme began with foli-lore,andj"|“oe ee ee eee o-Ale Me (rugelst). by each person relating a share,quite)PATIENCE,GOOD ‘FOLKS.|D.J.WILLIAMS, (Merchant). |OFFICERS.uiR.A.COOPER,President. T,D.MILLER,.Vice President. WNO,W.GUY,Vasnier. a Heacuries December 31,1915,'$799,-019,60. Fey {f\t ! FIRST NATIONAL BAN Statesville,N.C.ee Capital $100,000.Four Per Cent Paid on Time Deposit U.S.Depository,a Ausley read of the private‘art collec tions to be open to club biennial vis-thence of a loyal constityency. % itors_and the reception to be ‘held in ee in the Metropolitan Art Gallery in New Want Protection For Dyes.° York Mav 23.The elub has secured i t Ow the promise of a Shakespearean cele-|,,Charles H.Herty,Chapel Hill,N. bration at the college this spring,inj\)pres nt of the,American /Chemi- open air if possible.leal Socieiv,and others,advocated be- Reported For The Landmark.\fore.the House of Congress ways and i ___imeans committee Inst week the en-| The Macdowell club|held a Very)ctment of the Hill bill designed to| pleasant meeting Friday afternoon!{,,imports of dyestuffs sufficiently with Mrs.R.B.McLaughlin as hos-|{9 encourage the building upsof an| tess.After the discussion of current |american avednduatry |2 | yerents ae following programme Was)Mr,Herty deélared that withgut leg-| carried out.lislation the European nations will try \;to wipe out the present small indus-|la guest of the club.At the conelusion |¢2.,a aath ee WE,sas eg ‘of the programme delightful refresh-!433 coy dnfant nd ctricd aan | ments_were served.-_sees | renee ||Sees«“e-'Thee.”sete:2 aePTpreeeAryaGully.aces May Offset Our Claim.| “Hobe.”;.Gries.||It is understood that the sum whick | Agee Mrs|H.O.Stecle._.lis being elaimed__in behalf of the wove.Moderati.|g ain ee yey:) wo."ames H,O.Steele and A.P.Steele.|State cf North ;Carolina ,from the nd Hungarian Rhapsedy.Liszt.}United States for troops furnished Mrs:Clapno and Misa Rese Stephany,during:EN 19 30 : “Intermezzo.Op.76-Ne —»Brahms.rd ¢the War cf 1812 is offset by;B“|bonds held by the fovernment against | Von Fielitz.|the State.The State is claiming| |$150,000 to $200,000.The bonds-held|walt,|by the government,which are said.to| i total $200,000,were)purchased:>with||money from the Indian fund:the gov- Mrs.D.J.vraig. Mrs.Clapp. ‘tnd Bitteroef.thy)Ter Garten EryIst's.2 : “Mrs.Dorman Thompson. ae as trustee and putting some.of| the money in North Carolina bonds.penne Soe ch anaes ec ee OE ENS i 5 Ibs.Sedal for_only—10¢.;-2—_Ibs., |Roasted ‘Ceffee for 2b6e. |Blizabeth Gitt of Hanover,Pa. |Honor-Roll-at—Helly Springs—Good Lard:lic.at SMITHEY &FRALEY’S.| |Correspondence of The Landmark. |'Those_on_the _honor_roll for second |(ADVERTISEMENTS in “thia_column 10 cents!: |;:y ‘ings 8 «|per line.No ad.taken for,less than 25 i}month of Holly Spring:school |“cents.Cash must accompany order.) iClara Baity.Robert.Opal_and Russell | | andatt;Morler.Ted and Hal.Messick,Gillie}ite.Store. 'Webb,Harold and Ruby Tharps,-Opic |Reid,John Tharpe,William Caither,: r. SOR SALE —Second hand Fords and:auto-| mobiles ata bargains CAROLINA MOTOR |} +s 5 .a co..Jan.18%| |Phere_was-a “spelling bee!tN 0 cal oF chant school house.Thursday night,13th:WANT ee es |About 100 persons present.and,allt}~Addrcss BOX 47,Statesville.| ‘seemed to enjoy the spelling very Jan.181%.; Much.“Te is especially iiiteresting to|DEL ithe young people to hear the older lones spell by syllable in.the Bluc- {back speller.:: |We as teacher and pupils wish to} insk every parent in our school _dis- itriet,who has not visited our school, ‘to visit it and get better “acquainted- led”with school work. |Tf it is trve that “homes make the nation,”it is certainly _true that | jhomes make our schools.The home ‘and the school aré@ very closely relat- led and the parents and teachers should ‘he also in the training of the.chil- idren.We all know that one She a rnc ncre re jor even a fairly good child who is un-|WANTED—10,000 bushels of good white shell-| lrulod at home,can almost.ruin a whole|ed Corn.Will pay highest _market |cash l school in spite of a teacher’s best ef-|price.STATESVILLE FLOUR JULLS. forts.It is a good plan for parents Jan.21.cen land guardians to visit.the schools once j n lin awhile,not so much to discover the|aor Phone .893 apie lfaults and failings of the teacher,.as|cabs ts ithose of the children.You may think |FOR RENT—the Nicholson house on Bell |your hoy or girl the only well-behav-|street._DORMAN THOMPSON,executor, jed child in schgol,:as well /as the | FOR SALFE—Few loads Manure,Fifty ‘bales |Oat Straw wanted.BE.M.SENTEMAN,—| Jan.18-1". SPECIAL—See Big tine of Laces and,Embroi-dery-at.THARPL'S 5 and 10c.Store.| WANTED-—-Young ledy for office work.Must: be able to use shorthand and willing to work,| Apylications must be in writing and address |M.,care The Landmar:.,a 1 .’Statesville,N.C.| Give experience,Where employed ani salary| expected,Jan,18, LOST—Belt Pin.Reward for return to B,F,|RUSSELL at Iredcll Hardware-Co.iJan,18=2t—-| SALE on Table and Enameled||SPECIAL THARPE'’S 6 and 19e.Store.Ware. fea 3 |WOOD—Cut deliver GAI stove and heater lengths.Prempt Black. Jan.11 Jan.7.i SALE,OF | fyou may find;out by personal inspec-}HOUSE AND LOT.| jtion that they are a the coe BY VIRTUB of a-decres of the Superior, troublesome as well as’helow the av-|court of Jredell county,made in wcertain spe-| erage when compared with other chil-|cial proceeding entitled,James Hampton Clar-\ dren i jence \Hampton,\Maggie Hampton,Matilda! "Hampton,W.‘A,Evans et als.,ex parte,the | The Lyric Theatre Announces three photo- plays of.unusual merit. If you have never.been toa picture theatre;if you used to go but.haven’t been recently,come to the Lyric to see any one of these three pictures.We are sureyouwillbepleasedandthatwewillseeyouat our theatre often.We ofter TodayTheexquisite star Marie Doro ‘in a fanciful romance of the Orient, “The White Pearl” This announcement.willbewelcomedbythose who were fortunate Miss Doro in ‘“The Mor- ‘als of Marcus”.If youwishto‘see’a trulycharmingand_utterlycaptivatingfilmproduc-_tion,‘‘The White Pearl”. enough to~have-—seen—| Savin tora Hon To some day own his own home is the natural ambi- tion of every worth-while man.‘The manwho:thinks and looks ahead does not wait until he needs the home before he,begins to make preparation for it.He'real- izes that if te owns a home he will have to pay for it o of his earnings.AP UR ES a The first lesson,then,to‘be learned by the fellow: would some day own his home is that he must earn so >thing’and then save part of it.The fellow who ‘spend all or-more.than he earns will never be financially inde: }—-pendent,_He-is-in-worse:-shape-than_the’proverbial” that tries to get to the top of the well by climbingo foot‘up and falling two feet back.:“ “TP one is to save to advantage it must be done sys <matically—a little bit at regular times—and for a definib purpdse.—as ‘=Se # The 59th Series of this institution will be open Saturday,February 5,and this is the time to start -ing-up for a home.Begin then with as many shai you-ean and-increase as years go by and as your ®a capacity increases.You will be astonished how,fast ahi ___fund-will-grew-and-how easily it willbefor you to: .the kind of home you want...:Gs EO For any information jn regard to the jwystem of Sa ing-for a home,ask our Secretary.SEs a :First Building and Loan’Associatia -OF STATESVILLE. will provide it. Tomorrow.A wonder photoplay, “TheTurn ofthe Road”We can.say nothing herethatwilldojusticetothispictureproduction.You will simply be de-‘lighted withit.The ad-|mission for this day willbe10centsand15cents. ThursdayTheillustriousdramaticstar.Helen-Ware in ‘The Price” Miss Ware starred in “The Price’as a spoken dramain New York.Wearesureyouwill.enjoy the film Production.. ‘Lyric Theatre, “Photoplays.that Please”... P:Seeaae undersigned commissioner.will,|on |Candidate For Superintendent of|yroxpay,FEBRUARY 21,1916,| Schools.:|:at 12 o’elock,noon,sell to the hizhest bidder, 2 (eae for cash,at the courthouse door of Itedell I am a candidate for the office ofjcounty,’the following deseribed lot or pareel of Superintendent of Schools,subject to enue together:with the mene rae thereon,ae +ike y Plated in)Statesville township,adjoining ,the the action of the Democratic PYIMA=|larids of Fred.Chambers,Bell Houston ot als, ries.If ominated’:and elected,I and’described,as follows,towit:£ pledge my.time and my best efforts Cnn ine ‘,anne in the a aiden .SP deat TTS oe,ambers streat,in the city of Statesville, to the work of huilding up the rural Fred.Chambers’corner,and runs thence with schools.:said Chambers’line nortn 10 degrees:west,to |Having taught in the public schools |a stake in the Cemetery line;thence north 80: and high schools’of the county for more than fifteen’years,I have had opportunity to study their needs.“andi,|JOHN F.MITCHELL. degrees east with said Cemetery line 50.feet i esteem :Inert &FRALEY:|They to w stake;thence south 10 degtees east to a hey Bell.Houston’s corner;thence “with the north éide of said Chambers street.to the beginning, ay ving she identical lot of land conveyed1o"gohu Hampton,deceased,by deed of Py WeSteeleSeeHookofDeedsNo.24,pave Uh,of records of Iredell county,ih This lot has.on it a good fiye-roorn honse be fean and.will save you money., \dersigned on Gr stake in the north side of Chambers’,street,: “ADMINISTRATOR'S NOTICE.— Having qualified as administrator of the es,|)of }tate of Mrs,M.J.Leonard,deceased,late Iredell county,North Carolia,this:is:to noti- fy all’persons having ¢laims against thd estate of the Said deceased to present them to the un- iy before January 18,1917,or this notice will be pleaded in’bar of their recovery.J.PAUL LEONARD, Administrator of Mrs.M.J.Leonard. Dewey L.Raymer,Att'y. Jan.18,1916.cata iain cp otefenctlADMINISTRATRIX’S NOTICE. Having qualified as administratrix of Cati H.White,deceased,this_is,to,notify all personthavingclaimaneninstsaidestate.to~present them to me on or before January 17,1917,or this notice will be plead in bay of their reeov- avy,All.persons indebted to said estate will LV.FURCHBS,Secretary and Trea Heereesctteceaessetesetereersseessist Morris’Supreme Hams-—all-this week at 2(c.per — pound.’ it is not my present ambition to be recognized as t largest grocery store.in Statesville,but to be reme bered as *"The House of Better Values.”3 10e.Waggoner’s Peas ...<:-.10.12¢.¢Old-Time Peas .... Pocahontas Peas ....<, FLOUR,BEANS,ETC. Hecker’s Prepared ~Buckwheat wee POUT,og vere eeves 10c.Pkg. Mountain Buckwheat Flour,COFFEE. price fivesodlevAPRS lb.|.White House Coffee ..3'Tb. Mixed Beans .:.....00%‘White House Coffee .1 Ib. Pink Beang.....6Fe.86 7 1-2c.1b.|Queen Quality Coffee,steels, Lima ‘Beahs is.eesetces 9¢.Ib.|°cut,put up in 1 Ib.cans Yellow-Byed Peas ..........9¢.Ib.35c.value for ...s.0s46GoldRibbonCoffee,1 1b.caiWholeGrainHeadRice71-2e.Ib.} Dandy Cup Coffee,1 Tb.pkg.Blb.package Queen Quality,Rice spd ede sees ...-28¢e.Pkg.|\Ten Penny Coffee,1-2 Tb.ca 1-lb.Pek.Queen Quality Rice:\‘No.1 Bourbon Santos Coffee Abe Castespacha ic,Pkg.in bulk.We grind this Towle’s Log Cabin Syrup,‘fresh-as you need it an quart cans «2...se.eee 39c.can.|guarantee everypound value™for ssi.e3 No,1 Blended’Coffeevaluefor..s.essee ‘No,2 Blended.Goffee, value for veneer eeeeArbuckle's Coffee,per lage.ep ee ae Compare these prices with what you,have been paying.| California Prunes .....-+..11¢.Tb, 'CANNED GOODs.° Elk Head Standard Peas,3c. can for.ccc cee es pendrin 2hee =The Robert Bunch Cas“The House of Better. aei2 make immediate ae pane.TaeRael ene ee oe and ts a good level lo ural ret peut e 1 at 8M.HEY &|no.Aa!aad ‘Commissioner. plepse :“be MRS.REBECCA LO:ty GeJan.19,1916."Admrx,of Cail hite, eyo Ma nkobi SN *Phone No,229 ZR iether arene npn it mp eK wealhe wfe ere .ay hy ey “Sereneomnesedesingiectintethehsiealtabimbibs whoa ocean nin keine mhretmemydehdeel dnp ” i eae IWS INVCONDENS ns of Interest Gathered From Over the State. .Cyrus B,Watson has been se- ly ill for some -weeks at his me in Winston-Salem.He was bet- at last account,: ‘aroliria Social Servicebein’session in Char- 23-26,i nl welfare.:; ‘Mr T J Lutz reports to the Lenoir ‘opic ithat his grandson,Ernest Lutz, setween six and seven-years old,has Srithed reading the Bible through and begun on a second reading.Some er—that boy. The case against Moses B.Brock,) isbury man under.indictment Bont Smith,Ark.,for illicit distil- ing,and cases of a similar character #gainst others,have been continued ©a later daté. _Floyd Abeears.old anda deafmu yan engine at Danville,Va.,Satur- fay morning..He stepped from be- ind #passing train and was struck yy a shifting engine.: Mr.Caesar Cone of Greensboro.is first to respond to:Gov.Craig’s saggestion that a monument be erect- on Mt.Mitchell in honor of -Dr. Mitchell and.the peak which he dis- covered.Mr.Cone gave $100. POR.G.Ferguson,the young man who turned up in Charlotte and tried the jopus check game,gets six years In Be Sisic prison.He proved to be a ardened sinner in that direction and previous leniency by the courts had ot checked him.= Mrs.Minnie Reese,who lives near nton,Haywood county,1s advised t-her son,Baxter Franklin Reece, 0 years qld,was killed while fighting a the trenches in France with the al- ied troops.Young Reece enlisted in Canadian regiment while -visiting latives in Manitoba. ‘Dr._W.G.-Bradshaw,postmaster _at Rierorineeee 60;;~died——Saturday. ~Wa ken with paralysis of Hickory,about 20te,was..killed, e ‘sat Bradsh :v “Randolph county but had lived in igh Point;for many tWo daughters:survive. ye ait Mis:Herbert Chafin,of untsville,Ala.,were awarded a com- ed.wandict of $10,500.in the United tes,District Court at Asheville gaingt the Langren f fity.They sued for $30,000,alleging ey were ejected from the Langren the charve of.immorality. 4 Charlie Byers,the .young negro i arged with entering a residence at Havida-n last fall with felonious in- nt,was convicted of second degree furglary in Mecklenburg Superior ourt and sentenced to.383 years in tate prison...In the first trial of the egro,last December,the jury disa- Breed.&The labor meperess “committee of the House .which is considering the eating child’labor bill,declined the vitation of:S.F.Patterson,the orth Cardlina mill:man,extended to embers of the committee to.visit -Carojina-millsand see for them- that conditions were not what Keating bill ag q Rh ka vesadvocates..of theimtheyare.” The long distance lines of the Bell Pelephone Gompany.will be connected th the independent exchange at oncord,(for.Jong -distance service ly.Formerly the Bell would not mneéct its long distance lines with ‘fndependent company,but latter- it has come to that.The only reason, ubtless,‘that.it Jhasn't made this ection in Statesville is because Bell has a local exchange here. While looking for blockaders in 3 eae county Deputy°Collec- Galloway and’‘Policeman Straup €Rosman came upon two men trans- rting the ardent.The ‘men.fled, yaupfired’on them and smashed the ne in the leg of one—Hal.Chap- who was,captured.The otheraped.Galloway is ‘the officer who Maotunnd-weunded--by--blockaders. e timé ago, erbir Hurley,employe of the Shu- de@otton.Mills at Hickory,and said ie.possessed of a family of a wife nd five children,and Mary Nelson of noir,were arrested near Newton laturday,it being alleged that the n had deserted his family and was ser citizen”of that town.Wife; SAID FOR JUDGE B.F.LONG Statesville Man’s:Recommenda-»tions For the Supreme Court—Matters of Interest ©in Washington. Correspondence of The Landmark. Washington,Jan,14 -—~-Endorse-ments of Judge Long for-appointmenttothevacancynowexistingontheSupreme~Court bench continue to reach Washington,.notwithstanding that ‘it is generally known that .theNorthCarolina.delegation,with the-exception—of_Representativée Dough-ton,have endorsed Justice Allen,The bars of Statesville,Concord and Waynesville endorsed Judge -—Long..Mr.Doughton~filed-all-Judge Long’s endorsements with either the Presi- dent or the Attorney General. In addition to the very strong en- OLD HICKORY’S .OPINIQ What the Old Man Thought |About Preparedness,- ‘Monroe Journal.‘::: The flamboyant Teddy who holds|aajthatanationlongwithoutwarwillrot,denounces all men who want tokeepthecountryatpeaceasmolly.eedaiee and soft men.About a hun-dred and fifty years ago there wasborn:in Union county a red-headedbabywhobecamefamous.His/famerested.upon -his.fighting ability.HelickedtheIndians,defied Spain,thenilitarynationofthattime,and ‘wip-ed up the British at New”Orteans-He was considered a pretty strong-minded citizen:He -was-twice electedPresidentoftheUnited.Sta HewasAndrewJackson.Thougn he was indicted on-account of the fail-the greatest fighting man of his day;ee andic : De Mien rn Russian ambassador.atn,who recently received .comntthatRussians©heen mis-|ited ut Hopewell,Va,,has receiv,‘through the State Department,theanceofGov.Stuart of VirginiathatRussianshavenotbeenmistreat-‘ed at Hopewell.~~:Bmmeline Pan :oon leader,who arrived in*New‘ork last week,was detained bytheimmigrationauthoritiesonthegroundthatsheisanundesirable,having Served one or more terms in an Eng-lish jail.Her case is before the )Col.John T.°MceGra tie)+national committeeman from West dorsement the Statesville judge had in 1914 and those received”recently, Mr.Doughton filed with the Attorney{General a biographical sketch of |Judge Long,found in’“Makers*”6f 'America,”a book which contains sketches of the leading jurists of’the |astern and’Southern States,and jwhich has a very fine sketch-of Judge Longs with.bis..portraits .onsesssTtisknownthat-both the President jand‘the Attorney General are opposed to the appointment of a man who is more than 60 years of age,but the \friends of Judge Long insist that in |his ease this handicap is more than loffset by the judge’s remarkable phys- jical and mental vigor,which is evi- |denced by the fact that in the last six years he has not missed a court on ac- {count of illness and that last year he‘held court 46 wecks and tried 1,200 leases.Thriteen years of this kind of |service,they say,fic the indefatig- lable judge in as good physical condi; ltion.as at the beginning and still a’i young man. |The confirmation of the report.that |Americans-had been murdered by Vil- ‘la followers in-Mexico caused somelexcitementhereinofficialcircles, ‘Some fiery speeches were made_in} Congress,notable among which was: that of Senator Sherman oflindefenceofhis-resoliation— \for joint Pan-American armed|ventionto restore order _in Mexico.{Howey view..of Secretary Ua|sing’s statement that Americans h | aw Wasa native}been-warned to-stay—out of-territory|pot under the control of the bona fide ears and was;government in Mexico,the serious-thorizing the President to set aside anessofthesituationissomewhatre- ilieved.But it is pointed out that if “Carranza cannot reaci and punish ‘those guilty of the outrage the sit- ‘uation may be grave indeed. The Women’s Peace Party held itshotelofthat!first annual meeting here this week,| |beginning with a mass meeting at /Poli’s theater,which was_addressed by,several of the leading women in |the movement for peace.Miss Jane |Addams,of Hull House fame,presid- ;ed at this meeting and she and.oth- jers are attending the meetings of the {various Senate and House commit- ‘tees during the week,urging Con- gress to take some wction with the ‘other neutral nations vo restore peace ie Europe.Incidentally this organi- |zation is opposed to the preparedness \programme of the administration and in some of the speeches made at the mass meeting broadsides were fired by these women that show they.,know what they are talking about.Judging from the enthusiasm they aroused in -an audience of-several-hundred_people, representing all classes,it is evident they_are capable of reaching the peo-ple with their message. |The present’sess‘on of ~Congressibidsfairtobeoneofthemostimpor- tant in the history of our country. The many grave matters pending,to- gether with the interesting political |situation.make every action full of in-;terest.The attempted_amalgamation jof the jtwo wings-of the Republican jvarty is looked upon as meaning that the party in power will have to meet 1| +3-united_enemyinthe next election.|Necessarily the legislation of this Will hdve its political effecs.The ad- ministration’s .preparedness pro- ure,is-considered by many-as_likely {to be of,vital importance politically. ‘The Uplift of Flowers—Encour-age Their Cultivation. Textile Manufacturer. ‘Textile mill managers who have tried the experiment of offering prizes to their operatives’for cultivating flowers and well kept premises,have \found it a good investment.There is |something uplifting in the cultiva- Ition offlowers;it is one of the ways jica isin peace, {stitutions require-or=permit-the-main=| Illinois ufioaest |Congress,whether so intended or not,| ‘gramme,while -not—a—politieal_meas- turing. f ure of the national bank at Grafton,he clearly understood the danger of |W.Va.McGraw’was one of-the or-militarism,of.armaments,and the:;@anizers of the bank and Durbin was silly flap doadle that preparation for)former president of the institution.war tends to prevent war.He under-5 “Roy H.Wingo,a lineman’émploy- stands alao that the:strength ng Amar,ed tf the South Carolina Light,Pow-In his fourth annual Se ‘AmessagetoCongressGeneralJack-|o?©Railway Co.,was killed at Spar-Boh-said::ee Ss.22 aupporeny.from eos <GNA han:Shy piknakt ;__{ing in contact with-a live wire;whi-“Neither our situation no#our in-at,workin‘the.plant_of an ice-cream Manufacturing company...H was ‘heard to scream and when found was” unconscious under an_electriclightanddiedinafewminutes. Luis Fuentes,a son-in-law of thelateGen.Huerta,and Aristarco Car- rascosa,who were indicted recently atSanAntonio,Texas,as participants in.the alleged Huerta conspiracy to start a new revolt.in Mexico,weretakenintocustodySaturdaybyagentsoftheUnitedStatesDepartmentof Justice..Fuentes gave bond in the! sum of $2,500 and the other man Wenttojail. tenance of a large regular force,His- tory offers too many_—lessons of.thefatalresultsofsuchameasurenot to warn us against its adoption here.The expense which attends it,the ob- vious’tendency to employ it because it exists,and thus,to engage in unnec- essary wars,and its ultimate danger to public liberty,will lead us,I trust, to place our principal dependence for vrotection upon thé great body of cit- izens of the republic.”.iWhenGeneralJackson used _these words of warning against the danger of armies and militarism the ink with which President Monroe wrote the doc- 'trine that has taken his name was}’ scarcely dry on the paper,and Old Hickory was not afraid of its -being violated.European powers were still regnant upon the western hemisphere, and there were no strong republics to the south of us.He probably knewthattheBritishhadburnedthecapi- x _| The Furniture Factories. The furniture faetoyies in .North} Carolina show a notable advance in} Capital,according to the annual re- port of Commissioner of Labor andPrintingShipman.The number ofestablishmentsis182against84re-, ported Jast year and the advance in> igor =a capital is $8,079,982,against $38,327,-| Sra peels SE enecemmisae05 last year,The mills report the nid conquer country:4use..of..11,586.7 horse power. deli i Theenumber of wage-earners report-|ped..is...5,044,..salaried_employes 408.Of the wage-earners 5,622 are males, 22.females..The average number ofhourswerkedper.day is 9 and 55 could cor ‘Game Bill For North Carolinas Congressman Small of this State has introduced a bill »n Congress ‘au- -Wash- khurst,_Britiait ‘sut+} Virginia,and Charles’R.Durbin-have:£ drop|§ Sec Neieereae att ‘ is $1.50 Eclipse Shirts,Special Sale Price$1.00 Eclipse Shirts,Special Sale Price See window displav of these Shirts now onsale. |...SPECIAL-PRIGES-ARE-CASH..—»--- ==’PHONE_NO,83..-——_|SHERRILL-WHITESHOECO. eeTHECOLDTRUTH IS QUINACETOL CURES A COLD. 25 CENTS A BOX eee eee te rap fom , EYasmERIE ~—HALL’S DRUG STORE,- minutes.Seventy-three factoriésuse }z 5 pur-isteam power,six electricity,elevenchasesbyaSaetaartspoleUstheSteamandclectricity,one steam’and{Mountains OF or arofina andi water.The estimated value of mate-|jknown as the Appalachian park res-|als used is "$3,895,935 “‘Eatiinatedjervation,for the protection of gamejyalue of yearly output,$10,595,959,| Becretary of Aedcultutetocrbakaleieeiee oom’gPayeell:salaries,lrules and regulations for hunting and|ee ee fishing on the lands in such reserva-} tion,to the end that such game and} fish shall be properly conserved and}STIPATED.;even increased. ;This legislation by Congress is con-‘When.Bilious )sidered necessary and appropriate be-.a cause the government is about to};come into possession of the valuable hody of land recently purchased by the Vanderbilt estate.and which had been liberally stocked with many va- rieties of game and the streams stocked with fish during.the life timeofMr.Vanderbilt.Unless such a law iis enacted,there.is a strong probabil- ity that huntsmen and fishermen may jdestroy this game and thus sacrifice the foresight exercised by Mr.Vander-bilt.-Se ey ‘ The Legislature of North Carolina forcing a passageway every few days|at its last session passed an act giv-With.salts,tathartic pills or castoringtheconsentoftheStatetotheoil?;.|enactment of stich_a law by Congress.,Cascarets immediately cleanse and‘Not only the people of the State,but regulate’the-stomach,remove ~thelofthecountry,have an interest in the Sour,undigested and fermenting food joreservation of the forests and also and foul gases;take the excess bileofthegatheuponthisreservationinfromthéHverandcarryoffthecon-our North Carolina mountains.|Stipated waste matter and poisonfromthebowels. Remember,a Cascaret tonight wii!) straighten you out by morning.Aj 10-cent box from your druggist means| healthy bowel action;a clear head/ and .cheerfulness for months.Don't, nart or the whole of the lands USE “CASCARETS”FOR LIVERANDBOWELS.WHEN CON- Headachy,Sick,For! Sour Stomach,Bad Breath,BadColds. Get a..10-cent box. Take.a Cascaret tonight to cleans? your Liver,Stomach and Bowels,anil you will surely feel great by morn- ing.You men and women who hive are bilious,nervous,upset,bothered with.a sick,gassy,disordered stom- ach,or have backache and feel all worn out.Are you keeping your bow- ° Knitting Mills Prosper. The summary of the knitting mill jindustry in North .Carolina for theeeroebyCommissioner.of Labor jand Printing Shipman,indicates a,oh asan——— vromising outlook for this industry,|{orset the children.~~|The report states these manufacturers | jare ‘having -frequent inquiries from) Catin --Ameriean—countries and that, much progress is being made in_bring-| jing the buyers and manufacturers in-| \to-direct communication.This ap-|7% {plies to all lines of textiie manufac-| and other Skin Troubles | -ee -~--——We-Guarantee—— The summary.shows 81 knitting!at a : {mills in’operation,an increase of 2 @ ,1 ithree for the year.The capital is $6.-ya,¢e) (§41.225.an increase for the year of :|$1,879,689.The commissioner says’to stop:the itehing-and begin healing |the report shows a general increase of|with the first application or return your:,/husiness’for:the individual mills.money.”There are.lots of skin reme-|_There was used the past year $3,617,-|dies but Saxo is the only one they guar- + i headache,coated tongue,a badcold,‘|’ .els clean.with Cascarets—or merely, \Drainage District for |Board of Drainage Commissioners "PHONE 20.Prescriptionist..: x a THANKFUL FOR TRADE! I want to-thank for their trade all who traded with me this year.In the year which begins tsmorrow when you need anything in the way of jewelry,clock or watch repairing,examining of eyes and fitting of: glasses,I want you te come to me. h.-F.HENRY, |Jeweler.i "GOODSATIS again.Time is money.Why not buy yourself some | for 1916.“I have time from $1 CO up._H.B.WOODWARD _.______Jeweler._- Seed ‘Timber Boundaries!| We are in the market for STANDING TIMBER.Write or “phone us. BOYCE LUMBER CO.Geo.H.Myers;-PHONES:Resibence =|Vice Pres.and Manager.-}RESIDENCE 423 \ —==$250 REWARD!A We will pay a reward of.$250 forthe apprehension.azd conviction ofthe per-‘son or persons setting firetoourproperty—the St.Charles hotel.The tryingto-destroy our property isamenacetothewhole! msomseensilmom—NOTICE TO CONTRACTORS! Sealed proposals for the céenstruction of age improvements in Upp Coddle Creek Iredell,Cabarrus and Rowan counties,N.C.,.will be received by the up to 2 o'clock,p.m.,on the 24th day of January, 1916,-at the onlice of -Z.-V.—Furlington,Moores- ville,N.CC.This work consists of about 11 miles of ditch.Plans und~specifications are on file at the office of the clerk of the Superior Court at Statesville.N.C.\ Certified check for $170...nade _pavable to the Commissio 3s ef the Upper Coddle Creek Drainage Dist murt accompany,.the.bid. The Board feserves the tht to reject any and all bids.{ 1.A.QRAVEN, W.F.SMITH,4 .a fi .Owes 126 vort raw g ar 3 S te li ..Wh %°.ipingwiththegirl.The Hickory!teaching’the child through his soul|0,Wort"of Taw,material and the es-/antee like this.Why don’t you try It?|W.F.SMI town.in truth an undesir-orden .discharged--Hurley on the,nent of the costs when he agreed stay at.home and support his fam- x.Chufas’Lee Raper,dean of the maduate school and professor of eco- ics at the State -University,has ently accepted the chairmanship '@ permanent committee on tax ed-tation,which has_just been organ- d by the Southern Conference forucationand-Industry.This com- Hitteé-is to wage a campaign through-the Southern States for a moreitableandefficientsystemofas-sment and taxation. e@ Anti-Capital Punishment Socie-of America,with headquarters(Oo,has undertaken the work of g@ Mrs.Ida Ball Wayren,thei-Salem-murderess,Who is un-| tence of death for,complicity murder of her husband.The woman:and her associate,S. sty,have ‘professed religiontheirconvictionintheSuperiorJastfallandapparentlyneither*n*has.much hope of escaping:h “penalty; wally valuable as a~becahse ‘it contains the |‘tonic propertiesofCUININE;Ttiacts on the Liver,Drives»inriches the Blood andSystem.50 cents,| oung white wornan‘committed suicide d Sickly fengthening tonic,TONIC Arives outnystem,G0c.|Thefirst application gives Has in} \the beautiful objects of nature.No jhuman mind can resist the appeal of |a flower.No mindo sordid that the cultivation of flowérs will not,bring to it new inspirations.A winding3tream,a sunsetf glow,a rose cluster- —ottah foliage,the,ing.among dee y song of a bird,a brilliant+constella- tion among the stars,are ‘the best {text books for any mind;and they jmake an especial appeal to the young ‘in forming character.The cultivation |iof flowers and a taste for.neatness | about the home will go farther toward | making happy and eontented the lives| of mill operatives than anything else.! Prizes for flower-growing.and neat | kept premises’pay a big dividend on}the investment.i ,.(While it is most important and; worth while to encourage the grow-| ing of flowers and neat and attrac-| tive premises for mill operatives,it is also important to encourage this for every home.<A>bit of well kept | lawn,flowers,shrubbery,shade trees, hedges—these are not oily attractivebutgiveone‘a feeling that makesvhome“doubly a home when compared [toa building with bleak “and”bare!surroundings.) CT OE RAN TA eeREEY TT Constipation and Indigestion.“I have used Chamberlain's Tablets andmustsaytheyarethebestIhaveeverusedfor|constipation and indigestion...My wife nlso}iused them for indigestion and they did.her|rood,’’writes Eugene 8,Knight,Wilming.|tam N.C.Obtrinable everywhere.} 1 || ncithaesiebaeisiseiicti Representative Doughton:has intro-|duced in Congress a bill to authorize |ithe spurchage.of a site and construe-tion of'a-building at Albemarle to coatnotover$70,000,“ $LT ES Piles Cured tn 6 to 14Days |out druggist will réefanda thon if PAZOINTMENEfailstocureanydasestWeenie,Blind,Bleeding or Protruding Piles in 6to14 days,e¢nud Rest,50 1; {|| > jhorse power is 4,946.Twenty-seven of { |tert itimated value of the output of finish-; g Ws F:HALL,DRUGGIST,,ed product was $11.960.362.There are}pate.seville.1124,540 spindles,18,099 knitting n-(as‘chines and 1.434 sewing machines &™PASTEjusedbythe81mills,The aggregate r4x20 Dressed Bucket Cedar Shingles! The same Cedar your water bucket is made.of.Government statistics show that 63 per cent,of the Shingle roofs in the United States are of Ce-average ‘War wood.They won't crack nor split.C.WATKINS,Next to McElwee’s Planters’Warehouse,Statesville,N.C. ‘WOOD'S Prosperity Seeds. With bright prospects a- the mills use steam power and 30electricity.There are 7,264 em- ployes,of whom 2,562 are males.The mills pay $2,001,628 in wages and $248,420 in _salariés.Theworkdayis10hours. g;N.C.MANGETSQUICK RELIED. W.R.Davenport Better After First Dose of Remedy. W.R.Davenport of Parker,N.C., long suffered from a peculiar malady of the stomach.He sought treatment with but little relief.At times it aes that he would have to give up,hope. He took Mayr’s Wonderful Remedy and,found immediate benefit..He wrote:,’.4 “For years I have suffered from adiscasewhichpuzzleddoctors,They| néd it'catarrh of the storiach,say- ing the only hope would be a change, of climate,and that in all probability| {would never get well.“Then I heard of your remedy.One pottle’gave me |! instant relief.It-madé’me reel like||a new man.Your full course of,|treatments has about cured me.Sev-;|}eral of my friends have also been)!FARM SEEDS are of tested ger-cured.”'|mination and superior quali- PARKEI etable and all Farm products,out farmers should feel:en-couraged to plant improvedvarietiesofseeds,so as to in-crease their-crops, WOOD'S VEGETABLE SEEDS.tong known for their supe-|tior quality and productive-43,nave greatly increasedindemandandpopularity Mayr’s Wonderful Remedy givesi|7:0 $permanent results for stomach,liver|ties.”Write for BENT ‘&and “intestinal ailments.Eat as much||WOOD'S DESCRIPT VE CATALOG)and whatever-yot likez No moredis:|gives,weipaple Ante UO pent,tress after eating,pressure of gas in||<)Gcedsfor the Matto and Garden,”the stomach and«around.the heart,||Mailed free on request.)Get one bottle of your druggist now ‘ada’,absolute gu T.W.WOOD&SONS,and try it on.an.absolute guaranteeifnotsatisfactorymoneywillbereturned,-cigs an ¥ Commissioners, | jsmege crxeeuted by Jd. 11-4 poles to a pine,Sam.Alexander’s corner;head for good prices on Veg=-}+ WOOD'S GRASS,GLOVER.and| ‘|,Horses to.tru Mooresville,N.C..daa.11--4t ‘MORTGAGE SALE OF LAND.| |BY VIRTUE of powers contained in a mort- i.Aiexunder ‘and wife, |Ulemmmie Alexander,ta James W.Brown,dat- ‘ed the llth of March,A.D.,1918,and re- lcorded in the ofiice of leyxister of Deeds of Iredell county,Book 36,page -473,to’secure ;the payment of a note of eve date with said lmortgage,the undersigned mortgagée and as- ;Signce will sell the following described land jat public outery,to the highest bidder,for 'eash,at the Court House door in Statesville, EN.€.,at -12-0'eloek M.,on ‘TUESDAY,FEBRUARY 15,.1916, |to-wit :: A tract of land lying in Iredell county,Cod- dle Creck township,adjoining the Iands of J. L.Alexander and ‘others and bounded:as fol- lows:Beginning at,a dogwood near a spring, Allman’s corner;thence S.44 degrees W.37- { \ j thence S.1 degree W.61 poles to a stone,Cra- ven’s corner;thence S,1 degree W.8 poles to nu stake,J.I.Alexander’s corner;thencé S,89 degrees E.98 poles to a stake in Allman’s line; thence N.°9 1-2 degrees W.°33 1-2 poles to a jstone in center of the road,Allman’s corner; ithenée N.89 degrees W.47 poles to a stake, Alman's corner;thence N;-4 flewrees WwW.63 poles:to:the:beginning corner,containing38acresnnd33polesmoreoyless.|! JAMES W.BROWN;Morteagee;4 MERCHANTS &FARMERS’BANK,Assignee. Jan.dl,1916.By W.D.TYRNER,Receiver,:sy NOTICE! DR.R.A.BASS,;Veterinary.Surgeon,has“moved to Harmony } for the practice of:his profession, All’calls will receive prompt at-§tention.’Phone Harmony. Jay,14—-2t*,Caera ?i Nie able |citizen,we want toapprehendhimandaskthecorporationoftheentire.citizenship to aid us. -R.V.Brawley, La«C.Wagner. Jan.18-1t. Fresh Goods. Fresh Mackerel. Cranberries. Mince Meat. Evaporated Peaches. Evaporated Prunes,| Evaporated Apricots. -Sherrill &Reece, ‘for,Cash or time,Cab B Phone 123.108 WestBroad St | |DROOS,WINDOW,MPiabereYouCanBu‘WATKINS,St -Mantels,Bude,ToWher tatestoMcElwee’s| ;j :A i | re TE \TEE LANDMARK '!TMs OF CURRENT NEWS. TUESDAY,---January 18,1916.Happenings Here and There inOnSerra|the State.— nS MORE PENETRATING |AT DRUGGISTS |- AND RELIEVES QUICKER]25°50°$1205 0-acre Alexander County Farm,near school and churches,near- “est railroad station six miles,fronting on’‘both sides of -publi¢ ~yoad,soil and location well adapted for:fruit,grain and stock farming.Over two hundred fruit’treés.Two-story,six-room ~dwelling,two tenant hom.barn and outbuildings.Well water- *ed-by branches-and spfings.150 acres in cultivation,generally level and productive,balance in woodland which will cut over one hundred thousand feet of timber.Bargain at $17.00 per acré, Seventy-eight acres one and one-half miles fron Statesville,ad- |joining the State,Experiment,Farm,Forty acres in cultivation, ;level and productive,five of which is branch bottom,balance in woodland..Three-room cottage,small barn,two branches.Well located for dairy and truck farming. For further information call on or write,ERNEST 6,GATHER,fS58 SaKeAni™_*PHONE 23./OFFICE NO.1,MILLS BUILDING.| =Se eee ee 5cercsrereeraroes -t te iT | | ‘Gorham’s Sterling Siver Is all.that could be desired.We have it in Knives,Forks and Spoons of all sizes and in sev- eral different designs,at the right prices.We have Catalogues and price lists we will be glad to give you.: ICKERT &SON, | of |R.H.R JEWELERS. = ~ -“The StatesvilleRealtyInvestment Co. ==INSURANCE!: icyholders do not-seem to-know that r certain conditions named in the buy.We deen it advisable to ch the same will be rendered Asa great many poi “their insurance will be void’unde contract of the policy which thcy mention some of the causes under whi valueless,viz: wry 1—Vacant or idle property for longer than your agent for permit. "9 Mechanies-making additions to,or extraordinary altera- tions in or on property—always get permits from agents. 8—Property upon which there is a mortgage unless notice of same is given—apply to your agent. 4—Any change in the title or ownership,or ty insured other than by death.. 5—Assignment or transfer of property-to another. 6—By any increase in the hazard,notice must be given. 7—The taking of other insurance without notice..: 8—Keeping explosives on the premises without permit other than kerosene oil,~~9—Property encumPolicyholdersshould read lines 7 t of their policies...It is impossible.for a; 80 days—apply to interest in proper- bered by chattle mortgage.o 30 Of the printed contract gents to know of.these de- WOULD HELP MR.WILSON.| abishaneniek ae War With Foreign Power Would count of the massacre of American ‘in Mexico last-week was natural,and it is proper showld use every legitimate effortto| sce that the murderers are punished. iBut much of this outburst.andmost iof the clamor abou jpartisan-purposes. the protection of American:lives and (American {Mr.Wilson. +\ martisan advantage. intervened in Mexico‘or,.gone to warIs Senate Priday;Senator:Stone,-chair- iman of the foreign affairs ¢ommittes, inet to endeavaer to embroil our gov- aent firmly to maintain order. lit be we are going to co-operate with \Ville and.Zapata to helo overturn|chin’sand from the Catawba river to|j (this government before it is establish-|whitnew for their work there.Thejf> ed?leand will be pumped out ‘of the river|)J lragalntions.J am here to say that the > ,lhe to f)built that wav.ti pont international anestion of Bi tics,Tha.American peonle are behind) Hi President Wilson to RB ond peacefully to aid in establishing Joseph EB.Willard.A By eovernment in vnhanny Mexico.”| A on admitted,for ia case of war nolit-|about by Mr.Willard,from the vice| A |Vexico. -vention in Mexieo——which ha will not Gove Cra.who sold his home iv! |Asheville after he was-clected Gov-| Y ‘omnoy,has hought a lot in Asheville| Politics |and will build a new homie.“The Gov-| ernor has.had no intention of locat:| ‘ing elsewhere. Help the President — the Main Motive in Criticising ‘His Foreign Policies —The , Mexican Affair |J,GC.and Moses.$ .\ton-Salem,who were The outburst-of-indignation On--ac-—Lears.oO -onathe.charge-of--« 3 their printing office afire.are to bed’ put on trial.The case against them was held up when Mose Stewart #ecm- ed to,insane.| Isham Smith,Frank and Ben’Co-, ‘lev,colored and charged with ©com:, \olieitv in the murder’and robbery of| ithe,Wayne county:farmer.for which John Richards was lynched.were tak- en 40 the Stote rrigon.in Raleigh:af- toe the tynchings 4a Roaster falls,later this -vear than} ysual.—The first Sunday after the full jmoon which falls.on or.after Merch o1e%ig Raster an,this vear the first| rd}mann pfter’March 21st ic Anvil) 18 and the Sunday following,the 2384) of April,is Faster.\ Tho ease of the flour mill peonle| asked for a restraining order| ‘against the Commissioner of Agricul-| ‘nga ta prevent the colteetion--of a+; cpecial tax.whieh was decided ‘adverse| tewart of Wins-| indicted some|etting After taking stock we find we have | -some Great Bargains in odd straight _ Chairs,Rockers,Tables,Dressers, Pictures,Lamps,Dishes,short lengths — Matting and 100:window Shades at half ‘ that our government t the foreign poli-P the administration,are for The-loud-movthed concerned about ries of ities are more proverty abroad than’is Polities is.the controll- ng motive and the critics hope for*»z's Had Mr,Wilsoti price. these same critics ng him for plung-)into war In’the who vith Germany, would-be denounci ing the country Now is the time for you to furnish : very little expense.ge agg hain aieRil tp ne alana2Sdmakeyourselfat home, __we are always glad to see you whether._;@ aAX your home at anaes advertine to the Mexican affairy said:ae Onein aK “On this occasion,more than anv fo the plaintiffs by _Judec*Peobles tima_in_the last five years.we ought will he appealed.It is intimated that the caso will po to the Supreme |Court of the United States. The Hardaway Contracting Comna- ny.which built the dam at Lookout! ‘and is now at work et Whitney.will! srnment with Mexico,.We ought now to aid Carranza to establish a govern-| | Can|| you buy or_not. lsust below the raiiread bride and a| ltrack is-heing constructed from the| iriver to the railroad.Tt is said the} company expects to ship 20 to 50 cars) a day.:| W..R,Honewell ef Craven county.| jwho was orrested on an indictment} charging him with murderine his} SF 2 5 ~anahl ;rin '_his} Lee lf +h wae acai OS i hp be wife,.who diedlast June,by adminis-| thine a {wets :a **:| nine that could happen terra an’|onine.noison.married a serond wife| ‘he Democratic party Holitically would|;Qetoher.The wife of the second| ti is)e vere Mexivo ore also |napping Jost.a hushand last March} Set oR ith such.war-Papingys nd-there-was-spanicion as to his as .eee ern path bak seooridence sas.tonnd_on|t————— oe “avout SS which to.hase the suspicion.A the| OS A drad fold.spit inireumstanees eaysed the talk about} But the President,happily,is not |tronowell.but it is a little late to try.| Rio will not green t0 find traces of poison in the re-) ses ;;th's Gyains of a nerson who has heen dead.| sind into’the mire of partisan Doli~|more than ‘six months.:| “7 dq not helieve a Senator on the Rapuhliean side would vote for war. t?this is to be partitan polities we are going into as a result of these t \ President of the United States is too| A hig to-involve so much life and hope Willi Rie : iliams Furniture Hous‘in war for politics, seb ythhe eta tinplate alpine 1 os hi eeeSue sata.dinat sduttte babel IOS ite THE ASHEVILLE CITIZE @l pay anp sUNDAY Is the Great Want ad MediumofNorthCarolina— That Citizen.Want Ads : Bring Results has been j Suit for.$50,000 ‘damares against|% merican ambas«{* That is»sonsihle deliverance.Mr jsador to Spain.has heen _filed in|a aa Phat Nee consinie Gelverne e+_eT |Washington by Charles L.Ruffin,2} Stone's statement that the eharess of |ivi)engineer,who charres that hej ¥ the President's re-election would bel was injured to that extent by his dis-|‘ opeatly.inerensed-in_ease-of war will)Gyarge:-alleved-teo have heen prourht| preserve peace} anal nartisanshin is greatly modified pposidency of a company organized | and the issue in the main is one of +m eonstrnct 73 miles of railroad from|# ding tw the head of the govern Richmond to Urbana,Va. sjont oeainst the foreifft®,As’3!)——————ee : l-~olitical matter.therefore.Mr.Wilseo A STATESVILLE MAN'S EXPE- sronld be helmed bv intervention in RIENCE. But believing that,the Pres-| ident will rot resort to armel inter- yy a Resi Tell the Tale. ve ficiencies unless notified.Call on us for any INSURANCE infor-Ralenial tinea pyoa es ;.4 :mai te INSURE aes I ne prearh OS ious dae as aheede doubt the evidenes,of thig)‘ S :‘ISURE'ANY’:INSURABLE.”yi donal crtties take that as ¢Reuse |.adville citizen?fi ;pseu J F CARL O ,OT Mann task Gao an ennonent of|ere oe Apatacy}1 ydors |“demonstrated tin e 3 and Oe ON 48 N,Manager,Fishh Ldministration had this tov a"cei Se in to th th u and: (f , ?PHONE’54..STATESVILLE,NC.bith referenes’ta the resentment fol-ment.if again to e€ousands O :jowine the Mexican affair:_.;Read this:e le ho a k a ae of Sea aoe:5 =7 “AM.the mare reason.thhrefore,Sean 209 2oylosare gt tg W ; a BR FEB BOROEEI BIOL OSI AIELLO why the ore onls ‘een tes _Ho Se er oul earl al.p op y na e use oO : -H 't ihnad-Ali—t}pre reagan wav Con:Statesville,says:§In pretty;%ae ooo 3 :‘e e Fi wnes,which eer pomathing ae bad shape with kidney d bhidder|.these inexpensive but ef 3 -shout the matter.should remain cool;trouble.I>could hardly get around |{ ss :er ]Ca @§0 :eposl an eeronerats 4 ve eis fenh,to frum.the awful misery in my back.{¥ ::f :And omy honorable and effective wry a,1d .i f :Sea a i 2 nyt of —Hreatiffenity,if itis pasatble.t My 1s wee se ee k.andstiff that |: ‘::7 ishort of intervention.~Dace is-naed couldnt straighten after stooping.|9 :a :‘by he demonstrated Hirt the design of;Mornings.couldn'tectout of hed.My!% ;.:‘these whoa committed the outrare Wasi }idneys were ‘shiggish and the id | 2 :1 ay 3 naat fy,sey dicerodit ayrenca ond preci itatea!‘es ee “i 3 F Issued by this,bank bear interest from oe a Z ai se Re ney ceerotions scanty and unnatural.| B ae as S he e a segtedaly.has General Villa charmed;|never experienced such misery in|seit IC acai i date at,the rate of 4 pet cent per an H the administration with de:ehiws my Hfeoas:when the kidney -seere-|ADDRESS”i »:num.Savings Deposits 4 per cent,H a acedi dO ia nae Ae we tions were passing.Doctors didn’t|§ong oye Woes Te Ber —¥aye Saeeee ee Hf tween the suoremacy of Carranza |8°m able ub he v me and I kept got-|_The Asheville Citizen,Ashev ie H credited quarter ly..;ond American intervention Villacsyonla ting worss,Towa advised to try ‘aeE a es : :3 cant H rhoose the Initer.The San Ysabel/Dean’s Kidney Pigs and I did,After}“Citizen Want Ads Bring Result uy, F Checking Accounts Dee isproof of it.ee the bag 8 had ‘taken one kox,I was perma-|<: ss H ‘‘dent and Coneress must bear this im)ie ey AGS +5 :bere 3 aya?t :§:H mind in considering what ection shall nently-eured—of-kidney—troub ace eaeaENrES al :me :‘FA taken in dealine with the cravest)Price 5Oc,at all dealérs.Don’t; H :HN Af nl]the camnlications that the nol-||.a |SogeeseeSESESteSthESUSERgessstEssuseweeeceseeeeveedy ree -¥-either large-orsmall.cordially.invi (e 5.lis at FE Te rotate simply ask for a kidney remedy—get|‘ S Be A W t a1 ine =Eee i .a ee :Doan's:Kidney—-Pills—the -same—that..f-ee ee H e want your pusiness.9 ;Qld Csrranza_may_be little better |a.erage aE bien Ont ; a ;ees!y Y as Hi shan some of those opposing ‘iiwar but |Mr-Stroud had.J:oster-Milburn Co.,,omnmercia whe :.:ee Hike was the hest thine:in sight—of-;Props.,Buffalo,N.Y.|eas A ;Ss H |fored the bese hone—-for the restora-|,|OF STATESVILLE,N- ae |People’s Loan and Savings Bank,§orca |, :4 Monica:etherhecan -sueeee S::{ 3 ‘:¥8it5 he demonstrated,but.it is »fact N y |5;ote \; iS a .H that since the recognition of his de ;@W Year if ce i 3 Pee fe “¥BRITOMP ce.H facto government there are more in-ieee = .pats 4 OF I ICER de “Hi tieations.of neace in Mexico than_at |We te .}3 Capital Stock Paid Ht,ine ;:Hany time’for five years;and Carranga’[~~‘etn ane :oe ge :GEO.H.BROWN -President.A |should have the moral support of this :a3 ou :a i O2b.TURNER se Cashier.j lmountry until it is demonstrated that ?:|:Surplus and Profits 31,500.00 2 ae Hire is a failure.It shenld be annarent f ;seat A |to anybody.ns the New York Suni}cB ’” -—.|points out.that the Mexican massa-|,‘@iik ‘Members of Tederal Reserve System. P eee —=icra was for the double nurpose—of;tH :g ne ais ;;ishawing the hatred of Villa and tel if Ls \4 ‘ i\2 ‘followers for Americans and to dis-|it ‘S Gace (GREE |L |Nl (>SS leredit Carranza;and if we tur on iB Your Baxking,business solicited and ::(Caranse.batass:Be 88 a0 an dot \f every accommodation extended to de- |nortnnity to show what he can do in W |ed mt J h d t b k : ae x “Lo wen!Mexico we will be aiding the very men,e nave provi e we i}positors consistentwit pru en an . :iwho-planned_and/exeeuted the Ameri-+}.7:oa {Sree A etal.iyo timc hed Descente kin eee lean massacre and carrying out one of||with Flowers for all New }\#ing methods.: 9 ae Hithe purposes-they.-had..in..view.,When yon PAG h Bo cg oe a ‘?they-committed the crime,|~functions,and”or he vou OUL,er’cent.aid on time and Savin g cecal \j Year tuncuons,(§EUS GEL PE Mhccn coc annie “ ie :Harvey Morrow For Register.||New Year Gifts for the i Deposits remaiming on deposit three’ Q A ue *the male oF a aca 3 Wo oy .i:~months or longer.i ye i B ;oe am glad to know that W.Har-||young ladies.Who are al-|Zs ‘%‘ecause we bought before.the bi vey Morrow.who has been deputy||ae if SAT AT :::a é 8 register of deeds for six years,will |wa ga reciativeof your iB OR I ICERS Way ADVANCE is the reason we are bea cae for the eT f ys app SALES “4 \ iy S eae nomination for register of deeds.|h htt ]:di La W.D TURNER ie ag ve Ys :i 4 i have had much ‘business with thatof-|t oug ulness In sending|§Pent wh es going to sell you thiscar of WIRE :siness |tof»)*if ee 30N. ws Foye iy eo,and I do no injustice to former |;:K.MORRISON,” he ::+>aprive ‘Aeputies when I say that the county,;flowers.:$.«<a er FENCE,which has Jus y arrived,has never had a fe comipetent’|4 Ds aR ni cei ee ee meget Lat ue instaking and obliging young man He See TaD yo ae ¥*AT .:i.pains ef :|4 : ‘3 Pin-any ofthe offices.than Harvey Mor-|se.eo eccanersesteentl ‘ :“7 row.He has ited Nien al.reg-\rrasterereertteteritesstet i325 eTTITTIITTTITI ras ae we Me ister of deeds,1 his faithful serv-|}=:sn enveme area ener samme The Old Price.-—_|ieweyritass,ou a WELL BUCKETS,STOVE (i @ for him the promotion he seeks,Fel-|=YW had JIN TU LD,j Alec:low Democrats:He has been faithful an hi ey 9 We havein stock Well Buckets made up in any size.| aaa in the “few things”;let’s give him|Pedy |(eas used about bucket.«Ary size orweight Stove Pipe ma the “many things.”©DEMOCRAT,Feat ea elena vines ae mee Statesville;Jan18—adis ;GEXENSBORO,B.6.Also full line in stock, ——SY Oe ee ra STATESVILLE TIN CO.,H.C.Moht Beymasie 6.Ha a :9 ‘That Does Not Affect The Head Polk Gray Drug Co.~PHONE AS.|Z 114 East Bi pine a hie ;(eo «>Pi pecanse of ite tonic and laxative effect,LAXA.|Deiearare G We Se eee 2 lod ..a itd Tre e ‘ar ware O |TIVE BROMO QUININE isbetter than ordinary .hecal Agenta aon ene —— we :/(.ie ‘Yi Quinine does not cause nervousness nor Na =RS ee .TaN pa +U .SS | PO ed Bee imateDeeRe __}READ WHAT STATESVILLE BUSINESS J f iia alate a i aay ":iy teat i st P Dah,sk n e cea pT a Tiny M sue sjpSd waehad TRL f a4 i i és ::; :i id y Careful and courteous atten gales people.:=,|| »~~Mail orders will be filled-at sales prices when accompanied with the cash.Come every day while this sale lasts.oer RaeeeaEs Will begin Thursday morning January 20th.—-ee =f =e ee A AAT MELT MEE ISBIGGERAND BE and will continue until Saturday night the 29th. Nine Bargain Da Every department will have its special attractions butwe would -emphasize especially allLADIES’READY TO WEARS,which will be sold at unusually low prices.-~tion will be given your every-want-by..a-corps-of-experienced Ramsey-Bowles Morrison Co. R THAN EVER 1 ou ACS SRT SES TET ALISCL MALT EE I Nine = Bargain Days i}LANDMARK oF SDAY,--January 18,1916. IRTHE UNSPBAKABLE. ans.and.British Hammer- ‘the Turk —AustriansrrunMontenegro—NewsiftheWarZone. the Turks are now being attacked‘both Russians and British.In theasustheRussians,greatly rein---on .the-offensive_along.a ‘of almost 100 .miles,while inpotamiatheBritishhaveforcedgentoftheOttomantroopsthbanksoftheTigris,riverpsouthofKut-el-Amara and still losely ‘pressing them on the east n 8:north. antinople reports PHE that near heavy casualties,while Petro-Aaserts that at some “unnamed Russians_were defeated | |tro -Hungarian cruiser of the No- vara type in the Adriatic.“Since no Austro -Hungarian ship is missing,” says the news agency,“the Foucault powers by mistake.” to answer demand for the punishment of the which the Baralong sank,Germany is! forced to adopt adequate measures ofretaliation.i Business Changé at Taylorsvill> —The Bord Hearing. Correspondence of The Landmark.| “Taylorsville,Jan.17 —Mr.J.Ci Hedrick has_sold_his.stock—of -grocer- ies to Mr.J.C.Jones of Hickory.Mr..Jones took possession Friday and Mr.' Point. large number of Turkish of-and men,war materials he pro-' a mane ond eight manta.B-Smith-end-L-G..Hafer were —in’“Russian:successes in the.fight-|Hickor Friday to attend the hearing County Attorney L.F.Kluttz,Ate!torneys A.C.Payne,J.H.Burke and Messrs,T._O..Teague,Cha¥.Watts, ith Persia are also claimed by Pe-|before Judge E.B.Cline,on the ques-|brad:In-its“official report Petro-|tion of dissolving or making perma-; Germans are fighting with the’_this region..The Turks in,’long the.Tigris are iwveeldbackGeneralAyemer’s|fami procéeding up the river to the:ofthe British in Kut-el-Amara, front has again died down,Montenegro the -Austro-Hunga-|is continue their pursuit of .the) htenegrins,capturing from them’ tions:'and men.Podgoritza to the’;of Cettinje and-Nisic are the lat- ‘places reported evacuated.The’ enegrin government,which had} transferred to Nisic,is now at! Albania,according to an un-}i report,from Berlin.It is re-from Rome that Italy is con-sting giving help to MontenegroSerbia,but since these kingdoms already overrun-by—theirthehelpwontdapparentlybeailservicenow. reports opening of throughadservicetoConstantinople:departure of the first trainGerman.capital.fficial statement issued insclaresthatEmperor.Williamapletelyrecovered“from thefispositioncausedbyacar-no Josses in officers during De-led 930,of whom 275 were‘Total casualties of officersneWarbegantotheendof Y were 22,08T and_the killed those | offensive of the Russians in/C the--firstannouncementnentthe restraining order issued.by )===> Judge Harding forbidding the county , commissioners issuinjz $150,000 bonds. for good roads,recently sold to-Sidney| Spitzer Co.,Toledo,O. Mrs.J.L.Gwaltney~has returned from a visit to her daughter,Mrs. has.E.Echerd,in Statesville, The stockholders of the Bank of Alexander met in the new building:; Saturday and elected the followin board of directors:Jacob Moser,H.C. Payne,R.A,Adams,W H.Carson, T.,O,Teague,P.C.AlspaughJ.EF. Chatham,W.J.Byerly,Chas.P. Matheson,H.T.Kelly,WW.D.Deal, J.M.Little,L.C.Hifer,J..C.Con- nolly and Eugene Cross.Chas.P. Matheson was elected president,W..J. Byerly of Mt.Airy.vice president, H.T.Kelly cashicr,W.D.Deal as- sistant cashier and J.H.Burke:at- torney,The bank had a good busi- ness_last year and the report.was very satisfactory to the stockholders.The capital stock .was increased to$20,000 and $5,000 was added to the surplus, The second of the administration conservation measures,a ©bill under which more than 700,000,000 acres of public lands would be thrown open for lease by private interests,was passed by the House,of Congress’Saturday without a roll call.‘Immediately af- terward the 640-acre homestead billwastakenupwithaprospectthat.itwouldbepassedearlythisweek, Capt.Edward N.~Nones,©medical i =official Overseas News ‘Berlin discredits the ad Cold Quickly Broken Up. :.Wileox,.Gowanda,..N.Y.,used Chamberlain's Cough¢ight Years ago.At that tinecoldahdcoughedmostoftherheejustwhatIneeded.”It:fh a few days,and the! p L have told many i who have used {tstterms,”Qbtainable| an-|Crockett,and threetthat.the:French subma-|coast artillery corps,were drownedultrecentlysunkanAus-,-;a2 government boat was run down and corps,United States army,attachedtothecoastartillerypost-at Fortprivatesofthe in the Galvestdn (Texas)harbor when sunk by a tank,steamer.j Women of Sedentary Habits.|Women who get but little exercise are likelytobetroubledwithconstipationandindiges-tion and‘will find Chamberlain's Tablets high-|ly beneficial.”Not so good as a three or four!mile walkeoevery day,but very?Yhuach betterthan10allowthesbowels:to reniain’ina consstipated.condition:They are ‘easy and pleris.ant totike,and most agreeable:in effect,tainable evar¥where,4 Ob-| must have sunk a ship of the Entente: ,Germany has notified Great Britain} that as that government has declined|| satisfactorily Germany’s: members of.the crew of the patrol-{ boat Baralong for the alleged killing:of the crew of a German submarine! Hedrick ‘returned to his hore at Stony |F Pere ;UESAL EN TEEPE NSSHT a UT PAL ASIN eT PEN TE EESTI NTS TOEEIENTSSEERSENSTIE TI SIO IIESREA‘A WEEK OF REMNANT SELLING RY SA Wet See :t es coats. MILLS &POSTON’S STORE. Wehave collected from all departments of our store many Remnants and broken lots ofdesirableMerchandise,which we have put on sale at great reduction in price!Dress Goods,Silks,Ginghams,Outings,Suitings,Boys’Hats,Caps,Ladies’and Chil-dren’s Trimmed Hats and all-Fancy Millinery,Ladies’Suits,Coats,Skirts and Silk Petti-A splendid line of Ladies’Silk Sweaters and Scarfs that sold for $5 and $6,willbeincludedinthissaleatpracticallyhalfprice!eRugs,Blankets and Bed Comforts—all these lines are included in this Remnant Sale. EM M I AE N ? ME L E E NE EM E Just the thing for early Spring wear! MY AC OA Nl ME R C NE T MC NE E NE L tk a ES N One case good quality Apron-checked Ginghams at 5c.per yard.aeSeMEIGS&POSToNn==uly,etbcucodl GP :Pee)- RSSNMC QSAR ee The Sheriff Makes Talk. Nothing has been’done about the lynching at-Goldsbero—-and it is not” probable that anything will be done.' The solicitor is looking into the case ‘and the investigation by the coronerwaspostponeduntiltomorrow.{The sheriff of Wayne is indignant about the criticism coming hig,way. He says he saved one negro from a mob and the»negro escaped with a State prison term inbtead of the death penalty,which he deserved.The sher-!iff also says he will have something to say ‘concerning:the action of Gov-)| ernor Craig and a negro with a soretoe.” In short,-toe cover up his apparent delinquencies,the sheriff is evidently trying to say the lynching,was pro-| voked by the failuye of the law to pun- ish in -previows ‘cases,sarees Mr.S.R.Brown and son,L.C,'Brown}have been appointed State agent fér the Universal Trailer Co.'Big’Six Shock Absorber and Snub-| ber.This new connection does not affect Mr.Brown’s.‘insurance busi-!ness.—ad.=ante SMITHEY &FRALEY will have, to arnive today or tomorrow big lot\ey Ham&\to close out at 16c.Ib. ~<A,\4USTANG For Sprains,Lameness, Sores,Cuts,Rheumatism Penetrates and Heals. Stops Pain At Once *||For Man and Beast|||25e.50c.$1.AtAll Dealers.|LINIMEN ator Base Burner! will make your home comfortable these cold days. The MONITOR is “ALL HEAT,” a -ie Remember that when you think” The MONITOR throws the heat f of a heating -stove,’Phone—-us out in front,where you want it.for a list of Statesville people This feature is not found in any who are now using the MONI. TOR,-andhear what they haveother,Heater.Le 3 to say about the comfortable’ home they enjoy these cold days, , Nou can.see ithe Monitor fired up any day at our store,Be ‘ood to your- self‘and buy a MONITOR RADIATOR BASE BURNER.Crawford-Bunch.Furniture Gompany,|. «The Store That Always Welcomes You.”+: ee Ty samen Laliiei cil spdlin td omnesmitesnoessiameseledgerssaaaioy toa pone _STATESVILLE,N.C.,FRIDAY,JANUARY 21,1916. eT THE LATE M.NISBET HALL. Sudden Summons For a Good Maii—Death of Mrs.Hol and.Others. The funeral of Mr.M.N.-Hall, whose death early Tuesday morning was mentioned in Tuesday’s Land-mark,was held at his residencetheedgeofConcordtownship,a fewjmilesnorthofStatesville,Wednesday“morning.conducted by hisRev.C.&Raynal of the Pirst:Presbv- terian church,assisted by Rev.E.D. Brown and Rey.J H Brady.ial was in Oakwood cemetery,States- et.Hall;called “Nib” Thli-by his"intimates,was a nativefBethanytownshipandwould.have n 70 years old next month.Thoughthfulatthetime,he served as a same soldier of the Confederacy,He was T TCH.SPECTACLES. Dr.Black’s View of Americans_—He Thinks Well of Us on the Whole—An Entertaining Lec- Se mornin 3 sak iMoreInterestinSchoolWork—Houston’Overcash Victim Death,of.Mrs.Lackey—Tay-Assassin—Evidence That| Husband Was the Mur- 1 ‘er—Overcash in Jail and Waives Preliminary Hearing.Mrs,Georgiana Overcash,wife of“Houston Overcash,died yesterday morning.about 4 o'clock at the home |of her parents,Mr.‘and Mrs,Robt.L. Winecoff,at Amity,from the effectsthegunshotwoundsreceivedSun-evening between 6 and 7 0’clock,-told-in-Tuesday’s Landmark;-“Her} *husband,who has been in jail since =y,is charged with having fired|e shot which caused her death and!otherllbetriedforhislifeattheterm:Tredell Superior Court which con- venesMonday,the 31st.Overcash.was rrested on a warrant chatging as-it with intent to kill.fternoon,under instructions of the“county attorney,Sheriff Deaton swore ‘out a new warrant charging murder.“The defendant waivedandwasregularlycommitted to jail ‘by Justice Lazenby,without privilege of bail,Hedid.not +Sheriff Deaton spentitheyicinityofAmityar,securing evidenceainstOvercashwhen his case cofnesAnumberof‘persons wére *-geen who claim they had heard Over- sh make threats against his wife,Weparation last fall,and af-| yits -were-secured from "persons“state they saw Overcash going the direction of Amity Sunday af-about two hours before the shooting,Two men who live between| the home of Overeash and{about two miles from the OvereashhomeandaboutfourfromAmity—made affidavit that _Overcash _nassed| 4,their home about 4.30 o'clock Sundayipuage is the same,the difference afternoon,’goingAmity.wearing an overcoat,leggings,}._.ete.“Another.testified that.he saw~“Overcash going in the same direction _and that he noticed that there *something under his overcoat.making i.coat appear as though there wasmeéthingineachhippocket. A‘young woman-whom Overeash had heen visiting since rom:his:-wife made affidavit that)Philippines .Overcash told her that he had secured‘a divorce from.his wife. in the affidavit that..Overcashyynightand.theyygotoSalisburv.Tuesday and get married.A relative of this voung woman told thr sheriff that be “had;warned her against going with;Overcash because h¢was a married .The Landmark. Taylorsville,Jan,20-—Mrs.widow of the late J.A.Lackey of ‘Hiddenite,died after an ill-ness of several weeks’duration,the home of ‘her son-in-law and daugh- ter,Mr.and Mrs.Robert L.Sharpe,Spencer,‘Monday night.“Mrs. Lackey became:ill while.visiting her Deceased.was ‘Rev.Hugh Black,the Scotch preach- er and lecturer,was heard by a good audience in Shearer hall Wednesday evening,and his talk America Through Scotch Spectacles” was very interesting and entertain- 78 years of @twodaughters,"MeofSpenceranddenite,and:threeLackey,F.A,Bae Dr.Black has lived inine years and he-is pleased with:the country;thinks ourmorelikeScotlandthan those of any!country.Talking about the © ‘English spoken in this country and in bee England,he said when a longandashortwordmeanthe thing,Americans Yesterday jlong word,the Briton the short.word. When we say elevator,the English- man says lift;when we say location,the Englishman,says site. and the word operation hassurgicaloperation. ‘this country we talk about.opertrhins,.business jdames SharpeJ.EB:Thomas of Hid~ ns,Messrs,B.-A. A ey and O.BE.Lack-cy of Hamlet,.All except Mrs.Thom-when th¢end came.gore brought to Hidden-ite Tuesday!night and the funeral ser-vice was held at,the residence Wed-nesday:morning:at10-o’clock..-The the.cemetery there.}-Rey.J.J.Edwatds conducted the ser- institutions are!Mr.Milas Nisb as were with he daughters of the late J.Rufus Ad-ms:*For a number-vf vears Mr.*HalllivedatValleCrucis,Watauga coun- ty.After the death of his father-in-to Iredell,to the interment.was but one|law he moved backInold:Adams:homestead,where he died.|: His last wife died about:two-and aSurvivingarefourhildren——Mr.Ashley.Hall and..Mrs,McClurg,who live in thé West,d Mr:Larry:Hall,A daughter who died n the West some years ago and thehternow’living in:the of the first mar-Dr.E.A.Hall of T.PyRay spent Tuesday andWednesday‘in’Charlottewhospentseveralweeks here,theotherhalfyearsago.guest of Mrs.Jameand...variousTheman.in this country who'¢store...would :1shop.|Miss Mattie Hall an‘who live at home. desire a prelimi-i $s S.McIntosh,hasyme-in-Charlotte.-Dr-}E..W.Moose went to Raleigh Mondaydthemeetingofthe jan Falls,teacher ofgradesintheschool ¥has “been seriouslyillwithgrippeywastaken.to the Char|olina he might be alive and a good lotte Sanatorium,Charlotte,Monday ‘ evening for treatmeny,Messrs.0.'As (Brown and G.W.Johnson have opened up a repair shop Lee “Bradford yesterday injsays he operates aEnglandsimplybe Keeping a to.be.used}An amusing story was told of an Eng-|\ lish lecturer who,addressing:women’s |! clubs in New York,told ‘the ladies,son and daug'udience+West are children o He meant/riage.One brother, say |Bethany.also survives.; was a good man and asii—-an honorable man whoesteem:by~-all-who knew nd Bear.Pop-;evening to at Greer,of Mors they maven he had seen in America. to’pay them a complimjkesclike-home_folksyr4—i. land.-In America it means “Wattraes+was In this country we sometilainandothers—defeated in one dis-use “homey”for home-like. at Hiddenite, of Bradford ay-here with.Mrs.EL. Mrs.Sarah E.Holman,renee ee eae :«Holman,—died--WednesdayBut.English-as_it.is spoken inthis nieht-at-the State—Hospital at Mor- everywhere in’santon,where she had been a-patient In.England,while the lan-|for a long:time..Hon.W.D.Turner, nae in|brother of the deceased,went to Mor- the language spoken in different local-|anton yesterday morning and —ac- ities is marked;and in many parts of companied the remains to Statesville the.English domain another tongue is jast night._Funeral services.will—be In the province of Quebec,!conducted from the home of Mr.Tur- Canada,French is the official language)yey tomorrow morning at 11 :o’clock —is used in the courts:and taught in by Dr,Chas.Anderson and Rev.J.F. Kirk and the burial will be in Oak- wood cemetery,in a grave beside thatfherhusband,who died several years country is understood “The following report of the teach-ers’mecting is furnished your-corres- in the direction Ta Mie eats :n education in Alexan-increasing,as|Carranza —soldiers...Rodriguez “was,shown in the -€onstant.increase ‘in at-|promptlyexecuted.hes tendance on the Alexander Teachers’}According to reports received by,kept ere were very fewof ; the active teachers of the county ab- (notwithstandingthe“bad roads":and:the biting.cold.‘The discussion of \the The interest.i der county is ‘rapidly The same is true of oth- er British provinces. over French and Dutch colonies,but|5 jthe English tongue is spoken,In the|gootoday.we are teaching f English..And more wonderful still,as Dr.Black sees it, (‘programme|Cisneros,Villa.leaders,from erossing| was animated,a_large number partic-|into the United States,14 miles west/health. he:subjects thor-jational metings ‘have added very.much,to the school) .whe is “giving his whole time to his.officialprovinghimselfanactive,efficient di-|state that eight armed followers ofrectorandtherightmanintheright)the two Villa leaders also were taken place.The association is planning forjinto custody.This band was.believed, a county commencement—“The big-taccording to Douglas -dispatches,to gest thing.ever.” Mrs.Holman was a daughter of the late Wilfred Turner of TurnersburgSeteestearateteemMeTemoie.SUNSmillionsofGermans,Italitns and |winiston,"Tenn.,..and.the.following other foreigners and yet not one*word!hamed brothers "ad pistere<: of their language appears in ours.1 the children in ipating,discussing # work of the co 1 e8 G.L.Tyrner of Monbo,‘W.D..Turner Talking about politics —govern-'of Statesville,Mrs.M.K.Steele of mental methods —in this country and,Tyrnersburg,Mrs Jas.Willson England,Dr.Black thought the Eng-|;: em offered some advantages. »een surprised to find in dem- there were so the democracy. Winston-Salem and Mrs.M.E.Gait Mr.and Mrs.Hol-er of Harmony.ny years residents ofdMrs.Winecoff.the parents nigncwere for me of Mrs,Overcash.told the sheriff ofthreatstheyhadheard makeagainst his wife when he came to see her after the scvaratioh.On one of these occasions:it.was.stated, Ovorcash broveht another man.with him to the Winecoff home,whom ‘he had to sit in a bugev near the house, ~Overcash nersnaded_his wife,whe-was jularity of the executive veto.In Eng- in her night clothes,to come out on y th orch,and then.-it istriedtodramhertothebuggy-——— The sheriff was told vesterdayv that =“Mr--Lock—Overcash..father of Hous- ton,had-frone-to Salisbury-te-employcounselfor.his son.Mrs.Overcash was 17-years old and hesides-her_parents_is survived bv a number of brothers and sisters. funeral and burial will take place to- day at Amity:church. ~Probably Stroke of -Paralysis. Rev;-John A.Smith ‘of Statesvitle, “who became ill suddenly.in_Charles- tated in ‘Tues-tiv’suffered aletterrercived ocratic’America that many.checks onFederalaffairswe have the House’of |- Congress,the Senate as a check on the House,the President with his veto as a check on both,the Supreme Court and the constitution as further checks. What amazed him most was the pop- Construction:of New Ice Plant)«ther raids in Sonora and Chihuahua The remains of Mrs.J,H.Robbins, iwho-died-at-her-home—in-Winston-Sa-|- lem,were brought to Statesville Tues-lday morning by train and taken fromherethroughthecountrytothehome of her brother,Mr.William Mitchell, Funeral services and iburial took place Wednesday at Union ‘Grove church..Deceased was 47 years| ld and—was_a-native of this county. The family had-lived in-Winston-Sa- lem for some years. ifive-daughters.Four_of tne-caughters, i Misses Hattie,Dorothy,Fannie andGrace,and Mr.A.A.Morris of Wins-| ton-Salem,accompa to-Statesville,———_— Miss Flora Washburn,15 years old, Work is in progress on the founda=|Option on the —}as ~Mia ition for the new.ice and fuel plant to Option on‘the Bridges =May) ibe erected at the Sharpe’street cross-Take Them Over.:2 {the Taylorsville railroad by}‘The full board:of Tredell commis- the company.of:Winston-Salem’peo-|sioners and Chairman Osborne Brown |ple who recently purchased the ice-|of the Catawba board,met at the ‘making machinery of the Statesville;court,house yesterday afternoon for lIce&Fuel Co.The new plant will be|a further discussion of the question of | located between the street and the jthe two counties .taking ~over”the be convenient to;Statesville-Buffalo Shoals bridge and iboth.A side track and coal chute is|the Brown-Troutman,or Mooresville, ‘to be built.The main buildingofthe bridge over the Catawba river.A mo- fice plant,which will be tonstructed of|tion was finally passed agreeing to briek and timber,will be 117 feet in!take options on the two bridges until length-and 35 feet in width.In addi-|March 6th.An option was secured on lin north Iredell. land-the_veto-has—been.dead —these many:years and if King George were to—exercise it doubtless follow. power in England jisHouse-of Commons,the-members —be- ing elected by the people.The HouseofLordshasnorealauthority.If the; people are not pleased with the action;of Parliament théy don’t have to wait! two or four years.to maké a change.| st i e k e a—revolution The entire political railroad:and will nied the remains tion to this buildingtherewillbean|the Brown-Troutman bridge for $12.- n g engine room 25x87 fect,and a-‘boiler {500 and the Statesville-Buffalo Shoals They can have two or three elections;who nad been under treatment at the!room 88x17 feet.<A large barn will|bridge at $16,200,which amounts are a year.Whenever they become dis-|Sanatorium_for a month,died Wed-|be builta short distance from the ice}less than the actual cost of the two plant for the a nena of.ihe bridges._Jt is specified in the motion .A.Ostwalt satisfied—_they—canelectionandoust their rulers. England is a’‘monarchy-it.is really more democratic in government than)and her America—by-some.consid “ously democratic ——— another,nesday.morning_at 2.15,-She was the} ughter of Mr.-and Mrs.John A-}company’s teams. ashburn of Mica,Mitchell county,'is:superintending the construction.6f/Shalfbe operated as toll bridges until young brother the buildings. The Iredell Ice & C.,Sunday,as siday’s Landmark,e-stroke of paraly V n Fuel Co.is to be|at which time the boards of the two Heft~with—the—remains—-on--the—720-the-name~of—the-new~company;—the+-counties,-if they-se-desire.shall_makeereddanger-|were with her when she died. as a Warning, has formally proclaimed |Francisco outlaws because of the massacre of American:citizens at Santa Ysabel. Under the decree any citizen-of the republic is authorized to execute theoutlawswithoutformality.; who dre alleged to have participatedinthe‘slaughter of:Americans at-San- what will happen to any one adopting leader who had been burning railroad ers-ever-since-Villa_was-_driven_out of|Sonora;following the series of de- vember 1 last .Rodriguez,as-has been stated,was,when a boy,a pupil.of Rev.W.W .Orr’s school at Hunters-ville.If he had stayed in North Car- citizen.Rodriguéy,it is said,sent a mes-senger to Madera to demand a ransomforthetown.The messenger was well treated and General Rodriguezwas.invited to entér the town for aconference.With a few men he en- tered and_was placed-in—jail-with-his men.Afterward his captors’wentthrough:the district-¢athering in Rod- riguez’s men,about 25 in all,it wassaid:They were then turned over to Brigadier General Pershing,soldierseftheThirteenthUnitedStatescav-alrv prevented Colonel Miguel,Baca-Valles and Lieutenant:Colonel Enrique of Columbus,N.M.,and thus causethemtobe‘captured by .Carranzatroops.The capture waseffected last,Boa and the:men:executed Satur- I.‘a re nsetengh al She MGW).ie es ie 4 f is|:Advices received at Douglag,Ariz., etek betesI have taken part in the Santa Ysabel murders and-is accused of numerous States.ea te yee. the new bridge is built at Island Ford, train Wednesday.morning,for their stock:of which,as mentioned above,|all three bridges free.The motion isEnglish,sys- The advantage in the tem over ours,as Dr.Black sees it,is home in Mitchell county,where inter-/is owned by.Winston --Salem peop] that-a member-of Parliament does not;ment was made.ae) district he rep- If he is defeated in-one dis- e can try his.fortunes in,an- n.from Mrs.Smith, -who-was-called to_her husband’s.bed- “gide,stated that Mr.Smith’s affected and that he.had little use o his entire left side. “yesterday afternoo interested.in-the Crystal Ice &Fuel iba board.'i {have to reside in the Co.of Winston It is under «todd that the same parties will op-|was instruct erate plants in other towns,all Mrs.Retta J.Alexander,aged 68 years,died Monday at her home in, |Mallard Creek township,Mecklenburg ‘He has shown resents. some improvement,however,and Mrs.|trict,h e|subiect-to ratification by the _Cataw- of |week and confer further <with~the iwhich are to be under the same man-,'Sonthern Power Co.relative to the The new plant at States-|building of the bridge at Island Ford. ville ig expected to be ready for op-! Many eminent English states- lmen—Mr.Gladstone,Mr, pital ;lain and others,defeated in one dis-! were elected intained their sérv- That is the advant system.Dr.Black,argues —that it! keeps the ablest.mey in the service of| ‘Smith was encouraged.Mr.Smith is,other. under treatment at a hosnital, Smith did not state what the-hos } *authorities thought about his condi-'trict, neither did she say whether his,thus the country re case had been pronounced paralysis. Greek King Protests.. A year ago she fell and frac-tured her leg and was an invalid fromthattimeuntilherdeath.Mrs.Alex-|der was born Query and was.a hallsister_of Mrs..T.N.Steele of the vi-| cinity of Mooresville. vived by her husband and.two sons. ation by.the opening of the ers’Meetings. The annual meeting of the She is sur-' “ice Moving Catawba Citizens to Ire- dell.- Talking about Mr.R.V.Brawley’s activities in real estate.the Newtonstock-|::oPhi:as Sct ec |Enterprise says:“This Brawley eee the Gr ewford <Bunch ae person has been the cause of quite a niture Vom any wale uesday!number of good,farmers leaving thisInthiscountry,no ma ter how-able and deserving a states- man may be,if he is defeated,if the State in which he lives|Ccupse 0 i 2 ng didn’t cénsider ‘it much of a show,ing showed a ood orth the price, An eclipse of the sun, t-|Not Much of a Show..The King of Greece,*protesting the country. against the occupation of his king-|foelipseoftheobser ite mea |The report of the secretary|.oy ADEE o moon yesterday morn-|..nq treasurer presented at:the-meet-° bhusiness+ |re- \district or theanAmerican ‘candidate down.he t and his service is lost. ig,there is no law in the country to pre- ivent one being elected to serve a dis- riet-in—which.-he-does not.live,cus- m has decreed.it “and we wo ind for the change. Dr.Black decried our political pes-gimism.The fact that we refer Holiticians.in terms of reproach and) chatge thém with graft,he thinks The honor of serving ‘the be magnified.So,*it but it is evident that Dr:Black C.Wilson of Rockwell,isn’t very well acquainted with~some of the politicians and their methods: powers,says the plea of mil cessity advanced bv like that given by Germany for invad- «ing Belgium and Luxemburg. the merest.cant,the for Great Britain and France to .about the violation of the neutralit Belgium and Luxemburg in view what they had done and are doing) Hies was turns x Fduring 1915. iS a partial eclipse,is scheduled for ee See eae |February 3,ey ee ee Lelland..F.”B..Bunch,W.R-Holland July 14,an annular eclipse of:the gun (24 A July 29,,and a partial eclipse Decem- ber 24.The former is visible only in the Indian Ocean,the Islands of Bor- Australia and New Guinea,|The Realty &Investment Co.waserepre- sented at the annual meeting of the |steckholders held in_the office of the pany Tuesdav night. pany’s business the’nrst year was ex- eptionally good and the new year is King declared,Mc- ldn’t {eclipse of the Bunch.The directors r.Watts president,Mr.Mor- re- irison vice president and Mr. |Bunch secretary and treasurer. All the stock ‘SeEMEREERE Statesville <The baby.recently left*at the door ef H.G.Lipngrd at,Woodleaf,Rowan ja minty.which has since been;in the has hen taken by Mr. ‘latter is visible near the South Pole. The congregation of the First Pres-:com- jealled Rev.Samuel H.Hay of Ma- wan county,©rion,8.C.,to the pastorate of that!© ntv and settling in Iredell.” And thereby “this:Brawley.person” rendered his home county a fine serv- ice,for among the very best farmers in Iredell are former citizens of Ca- tawab.The Catawba people who have moved into—Iredell.are,-in—the main,industrious,thrifty and pro- gressive farmers.The only ¢omplaint we have is that there are not enough of them.We've nothing against Ca- tawba,but if Mr.Brawley can man- age to move a few hundred good farm- ers and citizens from.Catawba into Iredell].in addition to.those we now have,his Tredell fellow citizens will be under ‘still greater obligation to him. B.! W. satisfactory condi-|flag and Bible Presentation.j begin.under,very A 10 per cent paid and 5 per.cent was added to the The present board of |d follows:Cc.M. the -Americanapproved their sm and their cheery good na- but he deplored their prodigal pointed a notary publie. natural résources and waste| in other ways,and thinks the Ameri- Dr.William W.Craven of Hunters-|, ie and Miss Ada Smith of Coddle p jmarried last ai i No'elock at.the home of ture,ae parents,Mr.and Mrs.W. |wenerally,.Dr.Black :mae hair dh eas was —Mr,'Buren Jurney has been ap-| surplus fund. :—=|directors was reelected as evening was very much pleased with >,A,Sherrill.J.G.Shelton, The three councils of the Junior Or- er of.Statesville will present a flag and Bible to ‘the new graded school. building and the exercises will take L O,|place inthe auditorium of the oldHeisneithergracefulnorelo-'Steele,C.E Mills,J W Guy, as these terms White and R.But he talks|Sherrill was re-electeiyvicepresident,M can hustle works bad results,in some;him. cases.We try to,do too much some-|quent on the platform, The speaker said he-was teacher and he knew that it was better to teach i ji ‘ltwo or three subjects and teach them evident. ro has rejected the terms thoroughly,‘than to .put on many) éred by Austria and hostil-|courses--so many it is \impossit t,Thomas Potice of North Caro-y Secretary of the Democratic na-|t‘tional cormittee,)has been seriously|qi with pneumonia in Washington,but feLaughlin.«Mr. president;Mr. ills secreta-J,F,Carlton a are understood with -us. +s|well,talks practically,and the humor ly |and good nature of the man is always ry and treasurer and) =e presented byBeforethespeaker Hammer Must Answer.He to Raynal. mraded school building on the evening of February 3,at 8 o’clock.Following is the programme of exercises: Opening prayer by Rev,J.H.Press-lv:educational address by Rev.Dr. Chas.Anderson;address by Hon.J. Y,Joyner;flag presented by Rey.J. The ch@rees against District Attor-|F.Kirk and Bible presented by Rev.ve of Chairman Kirk of the Chautauqua|we been resumed betwéen those jaarn all of,them well,or any dr committee,‘took:a hand,prithem.This,statement was applauded.ammer have been orderedaty.to ney W..C,H C.E.Raynal.Acceptance by Rev.W, sent to him by the Department,of}A.Lutz.decide’whether future enterta should bé:opencd at 8 o’clock instead30."The vote was for 3 o'dlock. On.the whole the Scotch preacheris.very much pleased with we Ameri-next reunion of United Confed- leana?‘and his’audience Weilnesday of 8.mingham,Ala.,May 16 and 17. Justice with a request that he make an answer to them. -Mr C;Monroe.Adams will be chair-{man of the.meeting...Public invited. EXHIBITED DEAD BODIES.|BRIEF ITEMS LOCAL Dead Mexicans Who Killed]—Mr.BE.A.MasseyofTurnersburg Americans Put on Exhibition}township reports550pounds. ".;—The Junior Order will present :Gen.Carranza has notified the Mex-|pinte and flag to the Vance school= ican embassy in Washington that -he|next Friday,January 28..; —Dr.G.A.Lazenbyof High Point Villa;-Pablo Lopez and Rafael Castro|has rented two rooms in the Pi Loan &Savings Bank buildiheexpectstooccupyas.den’ ments by March Ist. —The condition of Mrs.of the Snow Creek.community wy The dead bodies of Jose Rodriguez|Ws seriously burn onday,-28-and Miguel Baca-Valles,Villa leaders|in-Tuesday's.Landmark,is..reported.4|favorable to recovery. —A-mass meeting oft ta Ysabel,were exhibited at Juarez,|cans of the county has Mexico,as evidence of what the de|for Saturday,29th,to be heldat ‘the facto government is doing to the ban-|court;house in_connection with ‘the — dits.The bodies were also exhibited|meeting.of the Republic at Chihuahua City’as “examples “offecutive committee,~~ :opt —Mr.Herman Wallace has con- the career of an outlaw.in Mexico.__|tracted with Mr.L.B,Tomlinson for Rodriguez,who was captured by|the erection of a modern,b employes’of the Babricora ranch and|Mr.Wallace’s vacant lot ‘on west * executed by Carranza authorities at|Front street,adjoining the residence: Madera,was identified as the Villalof Mr.J.R.Alexander.f caeSeeaaetogeaadtaushouanteeeekaeandthreateningthelivesofforeign-|pis home in Wallacetown,: eeloreny Sonte OR Nene ee yrs i peared as well as usuflfeatsthatbeganatAguaPrietaNo-evening but died soon after he went °to bed.ig edges |a big hog—weight © ;,G.B.White been called an county ex- .W.Roy Plott.of Waynes’who last week resigned a place in Col-lector Watts’-office inacceptapositioninSenator Simmons’©office in Washington,succeed:‘Senator’s son,J.\.H.Simmonifinancecommitteestaff, —The baskethall..gameeveningbetweenthlegeresulted-in-a-vithecollegefehyeto19...Statesville was.Elon—last—week-on-the-colbutthelocalfanswereexpecfthetables.on the States ‘he gover nent 3byProf.D.MattgreesTuThiswastheminimum temperaandbyfarthecoldestofthewinter.fier so much mild ee the ‘co!;-it is- tatesville to nome team’and. cated by ‘MrastheFurcheshome.J ROEerwillmovehisfamilytothnyhouseonMulbe:as it is vacated. State Bureau of Service.—. Raleigh_NewToorganize permanentserviceleagues:around.schools as centers;to-impr:cational,agricultural,healcialconditionsofthosecommuaStateBureau.of Communit) ice has-been organized.wiquartersinthe:State DepaPublicInstruction.:The personnel of the bur f‘sists of the heads of the variousState.departments ‘and of such other::institutions as are undertaking:ex:sion activities and have funds availa. ble for such work,who have organ-ized for-the ‘mdre efficient direction,in co-operative effort through one per-manent channel,of theviceworknow.carried on separate-y these departments and education.J.Y.Joyner.was that the two ~bridges,if ‘purchased,lyal institutions.Dr. chairman and Mr.W.-C.‘by secretary:Other members of the bureau_are-Dr.W._S._Rtate:Board of,Health;‘Graham,CommissionerofAgriculture;Dr.Clarence Poe,representing.thi Chairman Mills of the dredell board|Farmers’Union;Dr.D.H.Hill,pre ed to go to Charlotte this ;ident of A,and M.College. State Making Smallpox Vaccine.: The State Laboratory of Hygiene —is now.manufacturing smallpox.vac-cine,the output being A sufficient -to—supply-all demands “imDr.C.A.Shore,the di-*- rector,has written to the health au-thorities in every.county.advisin|them that this vaccine is ayailab!and-seeking to ascertain the extent. and location of smallpox infection,The plan is to issue‘the vaccine to —the county.authoritiey and let the physicians and othersvaccineapplytothe county health - The only.other vaccine now made-in the laboratory is that for typhoid=.fever,for which there was an:es); cially large demand last season. laboratory has,however,reducedcostofanti-toxin for diphtheria to ”fully one-fourth of its ;to citizens of ‘the State,this teduc+tion.being attained through:special contracts with:manufacturers,obligated to supply the anti-toxin in.to be <distributed -director of the labora+|” Rapkin,,of the large quantities ‘dianbeassdcmteninabtigmtone ‘ o Ministers Condemn 3 the Lynchingy The Ministerial Union of Goldsboro resolutions conde the Wayne.county lynching.“We: ther regret that this lynching 1 to have the:Semi-approval of man people of standity,”says the resolution the ;ministers,more deplored than the lyt solf,”they conclide,and lay too much st in the ‘com aun C o long will it ourselves and see if it is our fanlt. true sports and hope.for better for- Landmarkto make _bold to.express the Statesville sports would quit try j .losses of the home team.When the agro,Dr.Woods Hutehinson,dis-jhome team wins,it is our superior strial hygiene,asserted |playing,of course.When the home ‘ive almost’twice as--long,team-loses-it means some of our best than a third less frequently,|players were away,the umpite....was, only two-fifths as often and/“rotten,”or something else.They nree times as much money tojseem never disposed to admit—or bas 30 years ao,That is mak-/rarely ever—that tHe other fellows ‘some progress,for which we simply outplayed them.| d.thank God and take courage.”fellows try to explain it away when++—#twee win—and they have~the same) ned :{ x Jerationin ‘Washington a few made county grand jury is of jright to do that we have—it would Wake county lake,county home must be a good punishment that could be visited on'plug and spit the yellow juice of the them.lweed,”a-correspondent of the Mon-| Some of the papers-continue to-ex~;made fort =" and:when we lose we should examine|World’sNavalFoner4)5 selves a _ning of the War... If it isn’t,we should bear the loss as How the United States is leads The|third amongtheworld’s naval po) at the beginning“of the ~Euro be psec ish thatforetheNationalthew way the |Wa!When data on foreign , ing to explain away the ceased to be available,is,,einaletter:from Seere'ubli¢by Represen Mad:den o Mr,Madden led.ention toa statement.byentative*Kitchin,-the--House:ty leader,who is opposing the }‘havy programme,in which he-declar- If the’other|$d that the records showed the Amer, f ican fleet was superior to that of anynation—except-Great-Britain.”re=ply the Secretary said the strength’Phe Wake .MR.:‘_jof a modern navy could be*estimat-pinionthat some folks in.the}mean:that we won only by.default,led only on the number home could support |Quit trying to explain the losses.Be;;a mselves and the county commis-'a true sport and don’t whine TET ee ents tener Gat Bee:f stoke e fs ide 2 x --are asked to investigate.The |things don’t come your way.lain had August 1,1914,46.dread. home.Some of the county homes in|Remarking that it is no use to talk er ine meaner the State are desirabte places of res-'to boys about cigarettes “while our The United States ow han 19 areas ».but there are others in which |influential men rear ack in the stir-vouonts in ¢ical .‘Ndi OAS inmates remained of their own rup of their dignity and smoke the |cuthorized he added”Bat nothing innoiceit.would be about the worst cigar,the dollar pipe and ~chew the ‘known as to what other powers have built or ordered since the war ‘began, will you get another such“desirable ‘merchandiseatb J.M.McKee &Co’s Sacrifice 13 and Japan 8, 2it has cometostay.octunityto buy the season's mnTockpricesas_offered We have just:received a large assortment of Drummers’Sampleswhicharrivedtoolatefortheopeningday.dise of the very highest class,and we have marked everything at .a price that will insure RAPID CLEARANCE.This is positively the most sweeping slaughter seie in é sale you will remember to your dying day.fe This is all merchan.: the history of Statesville;a ener =‘roe Journal tells what tobacco mat Dr,Geo.Rose,a,physician of Dur-i- oy Sada hreiant Eee te eons Sed co ~ham,received a load of shot_in-hiSeeneeeeeerentsacnurueHeaid,and-what OY fhe seeidental plabacesr at hin et“a child and a widow is_a lady ora tobacco?Of course He did,and what-ang-the foot had to be amputated.“Extra Special!— “woman,but most of thein:no longer did He make it for?He made it for “find it necessary.to explain that the us to boil and make a tea to kill the ‘future is “before us.”This improve-lice on poor cattle;yet men and wo-| “ment The Landmark hails as a sign men smoke,chew.and snuff the weed { of progress.Be it known,however,as unholy.as they drink.corn licker,| that’The Landmark,In.mentioning You tobacco worm,please think of these things,does not claim freedom the boy with the cigarette habit and,| from-error.It is as liable to sin as ‘sect a pure example before him.”‘any of the brethren and can be called’There now!That ought to hold to account.for meny offences.the tobacco users for 2 time.When e Be ‘they “smoke,chew and —snuff the| Anent the attempt of Congressman weed”they are not only doing an Howard of Georgia to have Congress “unholy”thing,as much so ‘as.to -jnvestigate the charges of Comptrol-|“drink ¢orn liquor,”but they are} ler Williams that’many national damaging the lousy cattle by taking port comes.from Washington that/“make a tea to kill the tice on poor only three national,banks in North ‘catile.”oe | _Carolina are guilty of charging an,-The same correspondent maintains unlawful rate of interest.The Land-that charging interest on money is “mark:would like to believe that was wrong.He says~the Bible does not so,but it knows it isn’t.If common authorize the charging of interest,or report is true—and the report is bas-at least if it does “I have never seen ed@ on documentary evidence in some or heard of it.’While some of us cases at least—more than three na-who have a weakness for the weed banks-in“one-city in the State may not agree .entirely with the:cor- have made “a ~business of .charging respondent on the tobacco question, more than the legal rate.In’anv all of us who have to borrow money event it is safe to say that if the bank —and we constitute the great ma-, investigation has disclosed only three jority—will warm to him on the in- national_banks.in North Carolina that terest proposition, charge,directly or indirectly,“more PR than 6 per cent.interest,the investi-'*In ass ‘gation is far from complete.every effort will be made to capture ‘St ___ithe Me n bandits who murdered the The new administration’in Charles-Americans,and that if captured they ton.S.C."has-issued an order that will be executed without formality, policemen can’t smoke while in uni-Gen.Carranza properly calls attention form,either on or off duty;and that to some of his difficulties.He points they can’t play cards or cribbage;ouvt that it is practically impossible jring the United States that\ know their own business.but it seems very point:that “protection is rela- to The Landmark that it’is more im-|tive and.that even in the best regulat-: portant to ‘get policemen to conduct ‘ed States outbursts of disorder and themselves properly while.on duty lawlessness may cause destruction of and‘to give full attention to the work |property aad loss of life.”That last for which they are employed,than it sentence ought to strike home.In the is hamper..them with restrictions very best regulated States of Ameri-{ “while they’re off duty so long as they ca outbursts of disorder and lawless- ‘e@onduct themselves decently.The ness,with loss of life and property,| “politeman who is always.alert »and are by no means unknown.Witness | but-zealous enough to do his full duty ,and the outbreak in North Carolina, rather than ‘the rule:and when the sometimes simply because they.are, 0 does all:that he should while ‘foreigners;and once in awhile we ad- on duty he should not be hampered mit our guilt and pay damages.The| with unreasonable restrictions while:President is now asking Congress to ‘duty.“pay foreign governments $42;000—-for+ oe “injury to foreigners in Nebraska in, “The act of Congress defining the 1908.“When these.things oceur in powers of the President to protect well-governed America,fat can we' American’citizens outside the juris-\cxpect in _revolution-torn Mexico?| ‘diction of the United States..express-|How could anybody expect old Car-| ly says that when a citizen is unjust-ranza to establish law and order in all: ly.deprived.of his liberty in a foreign:the Mexican territory in so short a! ‘country,the President,after“inauiry,time?Even when Mexico was gov-| releWab‘is“anréasonaly—delayed,or -re=were bandits and robberics and mur} think necessary to enforce his de-'some scctions of our own country—|* mand.”—_Wonder—how--Colonet Roose- yelt would get around the restriction?life and property are not safe at any, ColiRoosevelt when they interfere |fices,hold-ups~and murders in_big; dence on more than-one occasion that ‘almost every corner.Our law officers|che does.not consider_laws and-the reg-do the best they can,usually,but itis;culations which govern the conduct of impossible to exercise absolute con=* the average citizen,if he chooses to tral over every foot of our territory.| ring thata man who.considers_him-|mand_prompt_action,and see that_all ‘self superior to the law is a danger-possible reparation is made,when| ous citizen when he js placed ‘in a po-an American is murdered in a foreign’sition of power..land.But to demand of Carranza in!or poe Mexico what we find it impossible toTomDixon,lawyer,preacher,pol-;do at home,is not only absurd—it is | itician,playwright,author,etc.,etc.,ridiculous.It is well to think about| born in North Carolina,sent a tele-ithese things—to use some ‘commongram:over,300 words long to North ‘sense and be just—when.an incident Carolina members’of Congress,mak»like that in Mexico occurs. eee eorous recent against the bill oerrenener: w.provides for a national board mj ‘.nk?at W iMecueidorahip-of motion’:pictures.To Authorize Pay ment of Mon-!| eer of-motion pictures is the ey-Due-on Mail Contracts. “most dangerous attack on.American A,bill directing t aan onllibertiessincethefoundationofthe-pariteHE te pe i ee dias‘Yepublic,”says Mr.Dixon.The gen-(mail contractors for mail service per-!tleman is interested in moving pic-formed for the United States in Vir- -tures'and naturally he thinks any in-'ginia,North and South Carolina .terference with them will-destroy the Georgia,Florida,Alabama,°Missis-|liberties of the people.”Since the sippi,Arkansas,Louisiana and Tex-\' Between 10 and Ia.m. AYYa " A ¥) Cy we r e AW eT To ~39c.to 98c.Friday:CHILDREN’S HATSWewillsellLadies’and Men’s : regular.10c,Hose for 5c.10c.to 39c. ad All Trimmed Hats in Millinery | banks violate the usury laws,the re-/the material which God intended to! What Splendid the RAYO Gives! —w wv me Ladies’Coat Suits,season’s latest mod-5,0007yards fine Calico,regular 6 1-2, els;new-half-priee-and-under.78nd 7.1-2ex now:oo es wa J.&P.Coats’Crochet Thread,all colors,Ladies’Underwear,‘fleece-lined, STOR yeeeeae anise 10ce._.wool and cotton,35c.,now 19¢. Arrow Collars,now 2.for......15e.50c.quality now .39c.$1 One lot of Towels,a real bargain 8c.quality NOW sti eclsaee quality,now 4e.10¢.and 12¢.One lot Ladies’Shoes,regular $2 quality,NOW ..7°...3,2.sss 8c.to $3.50 -euttemierss i si Sweater Coats,wool and cotton,Wool and Cotton Blankets,slaugh- Eee tic:39¢.and up.tered to ccc,89en and ‘up, One lot of Remnants,Silks,Suit-40-inch Domestics,regular 10¢. ings,ete.,at slaughter prices.quality,Tow.....cc.oa TE Men’s extra heavy pure Wool Sox,Children’s fine Hose,10c.quality, regular 35c.,MOW....-.,.55-5+19c.NOWBe can ty TS glow is so softandbrightthatyoucanreadallevening without tiring your whilé off duty.The Charlestonfolks to guard the long strip of railway at eyes.{: Be Here Early and You Will Be Doubly Repaid,_ .M.McKee &Comp’y, West Broad Street.---Statesville,N.C. F.D.Richardson,Sales Manager. active—not unreasonably overzealousthe rioting at East Youngstown,'O.,|re10is the most popular- at all times and to know nobody in the.other day.Frequently.in well-|kerosene lamp ever ‘the discharge thereof,is the exception regulated America,we kill foreigners,;made —becauseit givesa clear, powerful,mellow light —because it is easy to clean and light —because it is durable, good looking and Use Aladdin Security “shall demand his release,and,if the erned by the iron hand of Diaz there|Oil or Diamond White fused;he shall use such means,not ders in some sections,because.of the Oil to obtain best-results amountingto acts of war,as he may character of the Mexican people.Tn in OilStoves,it n-some-sectionsof our bi#cities)Heaters. —Charlotte Observer.time.Witness the frequent train rob-|The Rayo is only‘one Dee icti ies,robberies ‘banks anc stof-|Leal restrictions do not bother ‘beries,robberics of banks and postof-|of our many products Sowith-his plans:,He has given evi-|cities,where there is a policeman on!that bring comfort,andeconomytothefarm. Matchless Liquid Gloss ‘d-them:and it goes without Our government-should-of course-de-+f+Standard Hand Separator- »Eureka Harness Oil Mica Axle Grease If your.dealer does notcarryfliese,wfite to ourNeareststation. STANDARD OIL COMPANY BALTIMORE days..when the silversmiths at “Ephe-as from July 1,1860,to May 31,1861, <sus,fearing Paul’s preaching would and in Kentucky,Missouri.and Ten- ‘their living,raised the cry,“Great is'1862,has been introduced in_the. common for those who found their Louisiana.When the States of the} of doubtful morals,to call on the zens of those S:$the zens se States was held-up.'goddess of liberty,tv prevent the in--Recently »people in this section of | erence with his plans and purposes,Aswell's bill is to authorif11poses,As 8.s Q orize the gov-| q @ ‘professes to believe an invasion of ‘ernment to pay this money to the le-| “endanger the craft by which they had nessee from July 1,1860,to June 30,.WAN I ED!~e Diana of the Ephesians!”it has been House of Congress by Mr..Aswell of|SCRAP BRASS—HeavyBrass73c raft:endangered,especially if their Confederacy seceded in 1861,payment|per pound,Light BrassriencetoldthemtheirbusinessofmoneyduebyUncleSamtociti-|Pound =Sak YT “fyFORSALE:©| I or human rights.To the av-North Carolina have been notified of |New and second hand machinery Iindividuallibertymeanstodomoneydueonmailc.ncracts,for ser-|;for sale and all kinds of boilerhewantstodo,and any inter-vices rendered i j 6 |i;y er-vices rendered in 1860 and ’61.Mr.|;room supplies, |Cc.H.TURNER Fights ofall the people;gal claimants.ot H Iredell ’Phone No.74,Bell No.7. is probably known that this side!e :' The Landmark takes little interest |Colds Relieved ‘1 aseball,football,basket-' 80 long as they do not inter-|‘External’‘treatment —Vick’s “Vap.0- en Statesville has a team|the throat and chest to open the pores,then | ark,doesn’t go wild when |rub Vick’s in well nnd cover with a warm | is always|the.home.team.wins.)7}&time—iUieg HICKSVeeSALVELRG!hg an Oey breath,and,in addition,Vick’s is abaorbed | s 6 Phe Lanc “DANGER” iand the like—but it:does not.ob-|Without Dosing CROUP and PNEUMONIA it to these things so long as they).Rome ike 5 tee the|nih and seize *.:5 upon the infant child.Be prepared t ykeptwithinreasonablebounds.In|If you havo tried “Internal”medicines|the life of your little one by havign ‘e Boteconsidersthesportsentirely|without success,we want you to try the|tle of ,|e ,i=={CarolinathenoreSeriousbusinesswh"Sate.Apply ot wet towei see Brain's Vapo=Mentha Salvelf --—+-FOR ———‘ipine «bok:ched |flannel cloth,The body warmth releases |:1atYones,1.eres‘healing vapors that are inhaled with eanh |Croup and Pneumonia,MOORESVILLE. on receipt of price.*“BRAME MED through the pores,25¢,500,or $1.00.For’sale by-all dealers -or sent ‘NY Wilkesboro,N..'C,:3 AW casted f‘ | ‘The Carolina.Motor Co.—Statesville,Mooresville-and Newton—has always and will continue to grant to its pa-./é trons every favor not impractical with good.Jpusiness-meth-. ods.Todo more than this would not be to thebest inter- esi of either party, —Beginning’the first of next month—February |—we will’ put our business on a basis of CASH or.APPROVED TERMS.We realize it is not practical for us or any other concern to do an absolute cash business.There naturally must be exceptions.To take care of the exceptionswe will use pone that are satisfactory and in keeping with safe business principles. This new basis does.not apply to gasoline or new cars,but ~ to everything else in our line—repair work,lubricating oils,greases,tires,tubes,spark plugs,etc.,etc.,etc. Adopting this method will enable us to save considerable expense jn the wayof bill collecting and bookkeeping.Our customers will be given the benefit of the.saving in reduc- tion on prices heretofore charged. x .\ f Motor Company, ° :_“SERVICE FIRST.”as eerie ;STATESVILLE...NEWTON. +fhf se be ie AGEPHDPLAEBAYHMORBY.WE READING 11 Corn.he ah do noth a for me.i tried many,kinds ,of medicine but all to no Tomatoes.avail.,°A end told me about Dr. Peas.:Kilmer’s Swamp-Root,and.as I had Doars tried everything else that I heard of, *nee t bought a bottle of Swamp-Root and a)Apricots.it did wonders for me.‘Y prize it high- "Niller-McLain Supply Co. $4 Z. 0A payee Map «Ova tiek ee09ane0tmp NCO train NG.16 ar.9.vee 1ypepoetSerarainNow26ar.an lace,mt =An From Tay!He.Train No,28 ‘ar.10:00,Jeaves 10:40 a m. Train No,15 i 6:40,leaves 7:05.p,m.Noa,28 and 24 arenotoperatedonSunday perpetuate Tuskegee Institute at Tus- kegee,Ala.,as a permanent memorialtothelateBookerT,Washington,was announced by Seth Low..of NewYork,president of the institute’sboardoftrustees,at a memorial serv- friends soa cured tdi me mere Would Raise $2,000,000 For Tus- ‘thanallthe othermedicines 1 had|kegee Institute.- put together,”A plan to raise.a $2,000,000 fund to5began‘asking me why |well,and |told them about"Several are now taking it.”Ee ypfady-reader,suffer from any|oa ments due to womanly comes as heat i ,Sideache,s98,and thateverlastingly tired. $0,let us urge you to give Cardul aKiavefeelconfidentitafhelpyou,|as it has ‘a million other women inpasthalfcentury.in taking Cardui to-day.regret it.All druggists. (ig:eg i eesogontcaipage(Sfemoen,”in pisinwrapper.N.C.194CANNEDGOODS. .String Bgans. dead negro educator.Mr.Low ‘saidthatunderaplanaduptedbythetaus-tees,white people would raise half ofthefundandthenegroesofthenatiortheremainder.'_«Another Wonderful Recov-ery From Kidney Trouble. For nearly hine years I was a greatsuffererfromwhatmydoctorsaidwasKidneytroubleand-my blood was out,of order;enduring all that.time excruciating pain.in my back “and across my bowels,I was drawn down so thatI could only walk with myhandsonmyknees.My doctor said er than any other shalt recommend it to my friends.—IWhiteCherries. medicine has done for me., Yours very truly,.T,C,CLAY, Marion,Ohio. 750 Sugar St. State of Ohio,©NOTICE -T0-CONTRACTORS!|"Hravion-€oy@———— Personally appeared CIVANCE COOKING SCHOOL. ||Meetings Vance.Clubs —‘Two- Natl 8 of ‘The f.andmark.A *|Celeste.Henkel made a very interest« ‘la few women and girls.‘abou ing “mw.{later turned into a ice,in.Washington in...honor,.of)the. medicine and I Peaches.:3 wish to add right here that after us- -_....Pineapples.XS ing Swamp-Root for two months I be- np “Raspberries.2 an to straighten up and am nowsoundandwell,and feel tike*t mightlivea_lone-time yet_to_tell what-your beforeme this 19th day of December,A.D.,.1914,T. Teacher School —New Store, Statesville,R-4,Jan,17 —-Miss ing talk at Vance school last Friday afternoon.It was enjoyed by quite Her talk was i t.and_the.Girls’Tomato clubs,It was.decided.to or- ganize a cooking club.whicn will beGirls’Tomato club, though all-the members of cooking club do not necessarily have to join the Tomato club..Mrs.I,H.Whiting offered the hospitality of her kitchen to the club and the girls gladly ac- cepted.The first lesson will be given next.Thursday afternoon at 2.30 o'clock.It is requested that every woman and girl of the community at- tend and it is very important that they attend every meeting.°°certif- icates will be given at the close of the school.: Vance school is progressing nicely under the direction of Miss sseula Wet- more;~prineipal,and...Miss...Roberta Moore,assistant teacher.‘Vancehas greatly needed an assistant teacher for many.years,and it is pleasing to know it has secured,one at last.We hope for a two-room school house by next term,Before iong they hope to have a “Vance Busy Day”to clean up and beautify the school room. South Statesville Junior Order council will present to the school.a Bible and flag next week.The patrons of the school and members of the cooking club will serve dinner in hon- or of the orden,The next date will be given later. Last Friday night at V.P.C.meets ing new officers were elected:Mrs, H.Whitine-president,Mr.Carl Cloer vice president,Miss Beula Wetmore secretary,Miss Mae Little correspond- ing’secretary.: “Resolved,that co-education is bet- ter.than non-coeducation,”.was’ithe question interestingly discussed by four boys.‘The’negative was victo- rious.a Mrs.Martha Carter of Eufola has begun her work as.assistant teacher at the Beaver school.She will make her home with her sister,Mrs.Newt. |Beaver,..while-teaching. ..Miss.Mary-Cashion.of.Cleveland has been visiting relatives and friends in this community.Miss Roberta Moore spent the week-end with home folks at Cool Spring. Riler,the small.daughter’of “Mr. and_Mrs._T.R.Clark.has pneumonia. Mr.and Mrs:Henry Py Carter's’baby. Henry Pressly,Jr,has beerreal-sick but is better.: drainage improvements in Upper Coddle Creek Drainage District for Iredell,Cabarrus and *Rowan counties,N.C.,will be received by the Board of Drainage Commissioners up to °%, ‘o'clock,p.m.,on the 24th day of January, 1016,at the atlice of Z.V.Turlington,Moores- wille,N.C.This work consists of about 11 ‘miles of ditch.Plans and specifications are 3tatement and made oath GHARLES W.HABERMAN, Notary Publie,| Marion county,Ohio. C..Clay,who subscribed to the abovencthatthe! same is true in substance and in fact. Mrs.R.A.Lowery entertained élev- ‘en members of Vance Embroidery club ast Thursday afternoon,13th,The af- lternoon was pleasantiv enjoyed by the usual hand-work.Refreshments were |served,consistins of delicious coffee, (ROR ANNUAL CORN SHOW. .Morrison Urges the Organi-_gation of ‘a Corn Growers”As- -sociation —Would Combine *Corn and Poultry:Shows. To the Editor of ‘The Landmark: J want to endorse Mr.E.8.Mill-gaps’article in regard to making therecent.Corn Show,held at the Mer-chants &Farmers’Bank,an,annualeventi—1-am~sure it willbeagreat benefit to:the farmers of Iredell coun- ty.Iredell county will never-have a county fair until.some one makes a terest aroused would be a fine time to start it.Talk about the farmers of Iredell county raising too much corn! If there is a farmer in Iredell county start;and while we havealittle in-|Z Lazenby-Montgomery Hardware Co. ’corre eee a Nr ne ogee T.0ok in upon us.so ape eeAttendtoyourneeds.’teesZealpays. ng sate line.SiaNobetterprices.ye eae Be wise.You are welcome, Majestic Ranges.i QOliver Chilled Plows. who ever raised too much corn,please him,much less too much corn in his crib. It is only-a-matter of time until the boll weevil will be with us and we ought.to begin to prepare for it by raising-more corn and grass and feed-ing-it.to.stock.Mr.Millsaps’idéa oforganizinganIredellCountyCorn Growers’club and making every mem- ber pay 10c.-to 25c.annual dues.is a good plan.I believe every farmer inthecountywouldbewillingtocon- tribute a dime;or even 25c..and if we would set a day—say on Tuesday of February court—and have .a .mass meeting of the farmers at,the court house,when court adjourns for din- ner,and organize an.Irédell County Corn Growers’Association,and have Mr.Dull,the county agent,appoint say three boys in every’township.inthecounty.to try to get every farmerin*his'township join the association, ‘land get-them to pay a dime or what-|= ever amount df dues.we decide on, and deposit same in bank,.we could give a prize to the boy who would se- cure the most names, I believe we could get the majority of the farmers of Iredell to join the club and we would have funds enough to give some nice prizes at --our.corn show,without going around and beg- ging the business men of Statesvilletocohtribute. —: At the same time I think it would be a great advertisement for the mer- chants and manufacturers _to give some nice.prizes-and put them on ex- hibition at their places of business. to pull off one of the best corn,shows ever held in North Carolina, I believe it would be a good,idea for the Iredell County Poultry Asso- feiation to foi in with’the corn grow= ers and hold their poultry show in con- nection with the corn show.It is al- most impossible for any county to hold a county fair and then have a dell county exhibitors enter their birds free and charge a small entry fee for outside exhibitors and get up a pre- let him hold up his hand.I don’t see}: any hands up.It is very seldom you see &Man with too n,uch corn juice in|: By this method|¢ It would be a fine inducement to help c good poultry show.We could let Ire-|; Nails of all kinds. ‘Truck delivery.(,rates and Tiling. Qur best attention.Much shelf hardware.Everything to build with.’ Rooting,wood and metal.,__»Y ours forbetter service. |[eaters—oil,wood and coal. J)avis 100 per cent pure paint. W oven wire fences.r Care for your obligations. Q)d accounts should be settled. ;Lazenby-Montgomery Hardware Co,. te te ” JHOWTOHAVE©A Home Some Day!}.valsJay --It is admitted that every WORTH WHILE — 'man will want to OWN:HIS HOME some «'~1@ day.If he sits down and LONGS for ithe & is not-apt-to-ever-have it.'Butif hereally a6 wants a HOME and is DETERMINED to ~*¢- have it he will most-likely have it.Such a...i.Suv DETERMINATION.backed by HARD and, ee efforts,will insure him the. katy i .Sy ~on-file-at-the office of the clerk of the Superior| Court at Statesville,N,C.',Certified check for.$170,..made.payable.to“the.Commissioners of the Upper Coddle Creek Drainage District,must accompany.the bid.;ghd ail it.reserves,the right to reject.any a!iH +. ey Letter‘toDr.Kilmer &Co.,Binghamton,-N Y. :i mium list for both.If there is-no Lane shore bones Q high an pale pallding Japie enough.available a |aD)oe Ms rter,could rent a large tent and holc e Prove what Swamp-rootwilldoforyoufork of Cool Spring and River Hill|eorn show and “poultfy show under Send ten verits to:Dr.Kilmer &-C lroads,is nearing completion.Mr.Jno:the same tent. Binghamton N.Y.toy.as hambie size (umn will install a stock of soods'or|If any one has a better plan let.us|' bottiae TA Wit ecaui Bane Y.‘|the first floor and the Vance Farmers’|hear from him;but by all,means Tet mall ‘also re aes eee ee i 0U|TIpion will use the second floor for-a!us have an annual corn show...:/ Sto information “Gallins abaet ‘he.Wa (meeting:Place,cei |E,A.MORRISON. .?2 i LS neys and bladder.When writing,be ae |ni ara i oren ae and mention the Sistenvilie ant.|Preachers and Meetings—Good Wear Sulphur in Shoes and Keep Weekly Landmark.Regular fifty-cent Roads.|”Off:Grip. ‘and-one-deHar size bottles for sale-at}carresnandence—of-The Landmark.|Fairmont,W._Va..Dispatch.: —The!Residents.of this-city are wearingalldrug—stores.~.R-1.—LZHarmony,Jan,has been Sulphur in their shoes to keep away Fresh Goods.|The blizzard did the grip.Older residents recall that: Dromedary Dates, cake and sandwiches.. if you havethe DESIRE fora HOMB and >the DETERMINATION to have it,‘this it.~~~ stitution offers the EASIEST and SUREST | I bids.;J,A.CRAVEN, :W.F.SMITH,A. ASO ANS L.DEAL, x.Commissioners.Mooresville,N.C.Jan.11--4t.,SN ted rang Bene ta oy DROOS,WINDOW,MOULDINGS, __.._Mantels,—.Columns,_.__Stairways,Blinds,iime,Laths and Cement.Mr.Builder;I only ask that you “BuyWhereYouCan:Buy Cheapest.” «C.WATKINS,Statesville,S.C.; next to-McElwee’sPlanters’Ware-|House.®t Come in before the opening of our 69th Se.7°0°"a ries-SATURDAY,FEBRUARY 6-—and >; let our secretary explain how easy itis to,- own your HOM:some day:PEAS ek Aaa anda acount St HSFirstBuildingandLoanAssociation:OF STATESVILLE.SheH.V.FURCHES,Secretary and Treasurer. comparatively mild.¢ Bes Pee tie “ag.predicted by _the |20.years ago...when the epidemic of weather man,There has been no real|&?+P swept the country,Dr:George lecld.weather this winter.In fact,|Angel,a celebrated “physician,—rec- lwe'ye-had no zero weather in several ommended at that time that every- i years:‘body wear sulphur in.their shoes as i a preventive,the discovery hav-i Rev.Mr.Goode,the new.preacher|‘h Saran } lon_the Cool Spring circuit,preached |"been made.that miners’employed lat Clarksbury at 11 o’clock last Sun-/'"the-sulphur_mines_were immune| Subscriptions Sanitary Mattress! ‘Dromedary Shredded —|jday.Rev.Mr.Willi the Har-|from the disease.et | Taken to all -Pub-‘ey ev.Mr.Williams,on the Mar-.'He recommended that a teaspoonful|| se 3 a ae,Coconut,‘[mony circuit.will commence a mect lof sulphur be ‘sprinkied in the sole of[ing at New Union church Sunday eve-|h .‘j ning,to continue through the week.reach s oe-and_worn during the_dura-‘Rev.B.H.Vestal conducted a very,tion of REE cs Scores here are i aaafia)"“following ‘this advice..Bote |2 \.iguecessful meeting the past week at,(In the old days,when’a mysterious iLibertv Grove,over in Davie county.|_,;;; ‘Rev.Mr.Vestal-is-a-very-suceessfui Sin disease called “itch”was more \revivalist 3 ‘common than it is now,many people.fe pe fiwhosentchildrentothepublic schools ||"Apple Butter, Apple Sauce,/ Fresh Coconjts. lications. Club | RO OE Y ok Miss:Sallie Reeves 48 suffering2BookSTORE,poe Linith4 paneer dn han bagi oe ©DACEREE Of snsatvetide sroane iy CU.|Sherril&Reece Good roads fever is getting hold of helt necks "0 Diver ida was sewed ca Se jf A BABY BSUUNY st tre—-people—of—this—section—and-right.disease..‘The assafoetida was sewed mess “lan in Phone 123.108 West Broad St |/of ways are being cleared for new [TP He Say eeeinolouimabyt a ey ort ee :;snl roads to be worked in the —spring.|‘ones Fae ae ie ee ::rea ‘DRAIN YOUR FARM.Pe rc ee 5 Mr.Amos York is pushing the good te oe Ss lc off|One-third ies ‘.BR ene work along and others are also much He yee cine Shine maybe aig Ey of Your’—¥Be Good : “3 i <j interested in building good roads.|"°°P ©fs eyOe eka ;BD ;‘ES +Any quantity 4-inch and The time is not far distant when it vhur in the shoes would keep off the Time —is fa ,to Your.. -6-inch DRAIN TILE on ali ‘@ it will be almost impossible to get a BTID-)-_sjenteienapngntansnenmnial BY S t i =wv self.Buy hand Fy dector if we don’t build better roads.|ooking .Into the Hammer By pent im 4 SLprasssssseeal a Good: ana.=;All the doctors will go in automo-|’:‘EY Bed.2 6 a): a te ———:-__—-}biles_and_the Had-roads_will-cut_them|Charges.IB :ee Mattress. “i Common Bricks,.Face The Flour of Qualit %|cut.There are three things that show;The Department of —Justice,to |Ry”ee Ra 'Bricks,always ready for ¢%lup for a community:Nicely painted which the President.referred _the||Py churches,painted school houses and ‘charges made against District Attor-| last.but not least—good roads.Good ney Hammer,is beginning an investi-| roads for rural communities are what gation.“It is understood that thus far} we now need to intersect with the/no one has been sent to.North Caro-| leading :roads through the coufity.lina to make an investigation but such/ If it was a law for every man to work |.course is expected if the depart-| Makes better bread and more the roads on his own Jand it would |ment finds it necessary. y of %to.th d tl ther &result in better roads in the rural!—— ofit to.the-poune than 0 er idistricts.Instead of travel being a/ flour.It is economy to buy.|burder it would be a pleasure.1 DO YOU ¥REL HEADACHY? ea beret ie |Masons Asked to Establish Loan,LOOK TO YOUR STOMACH}¥ |Jt is an unusual thing for:a drug-Fund For Orphans.ty oy ‘.; ee lodge of Ma-'sict to sell medicine under a guaran-5 Crawford-Bunch Furniture Company.Addressing the l sons in Raleigh this week,Acting joo to refund the money if it does.not||R cea :Ce Tr.eee”Yet this is the way the States-The Store That Always Welcomes You.” Ne RONURC UACATIC AEC LIC Our Special Mattress is made of “all cotton.Weighs 45 pounds.Rolled edge,round corners,goodtick.’For full size béd. PRICE......-: DAN--VALLEY «is milled from }$ the celebrated wheat grown in § +the Shenandoah Valley of Vir-<% §ginia.IT HAS NO EQUAL. ‘delivery.: Statesville Brick:Co. Saleteatrepealtpgnner atctertlnetpe ets aidtasaneanesttntateeh ts ny eeapennaeaa op |G.‘WATKINS for “Everything to Build With.”_JFULLSTOCK--LOWEST PRICES+PShingles,Doors,Windows,Ceiling,fF Flooring,Siding,Boxing,‘Mould-ing,Lat s,Lime,Cement,etor,Next Planters’Wh.Statesville. RU U D Je e TE T it ws iOA S || eevee 0 BA L Cary ¢€.Boshamer, +Local Representative,’Phone 125 Black.It.aw. Stop!Look!Listen! WE buy in car lots. WE sell in any quantity._~WE sell the celebrated Gold Medal Flour.WE sell Sweet Feed for Horses _«and Mules : WE sell Sweet Daisy Feed for sm,COWS. WE sell Hay,Corn,Oats and Cotton seed Products. Grand Master A.B.Andrews, recommended that thé lodge appro-'yijje Drug Co.,the popular druggists nriate $200 annually to the .board of ‘ire selling Mizona,the standard dys-Z directors of the ‘Oxford Orphan Asy-|nepsia remedy.——— lum,to be loaned to deserving orphan’”Never before have they had _so boys to aid in completing their edu-jarge a number of customers _tell cation and to be re-paid when able.'them that.a medicine has been suc- This fund.Mr.Andrews suggested,cessful as with Mi-o-na..People.who should be known.as the Andrew John-.few months.ago looked like walk-Fae Sites S!son loan fund,asa memorial to the jing skeletons-have.put on flesh and ”I President of the United States who today are ruddy and —vigorous with QUINACETOL CURES A COLD.~was born in Raleigh :4 perfect:digestion and_good health. 25 CENTS A BOX Mr.Andrews further recommende There is no longer any need for any- that a similar appropriation he made!one suffering or making their friends ‘VJ\PEALL'S(DRUG STORI Goife L.Sherrill,M.D., Wilanswer.’phone calls leftiDr.Long’s Sanatorium or.M.Foard’s residence. UPC MME NMC MLE MIC SICNEC ALE Neh NEYEC3—————— Bitter Wrappers! have the very best ‘archment Butter Paper,/ /.can print your nameid-brand on same.Let us@‘your order for anyintityyoumnieSeeus. for the girls of the orphanage,this to suffer on account of dyspepsia.Mi- be known a¢the Dolly’Madison Ma-jo-na cam always be relied upon,The soni¢Loan Fund.to be loanedto de-|per centage of cures is so great’thatservingyoungornhongirlstoaidin|shore is Jitthe risk to,them in guar- thei?education.erly Madison,who lanteeing to return the money if the was horn in Caswell county in 1772.\madicine di not relieve.And the WE SELL FOR LESS.is the only North Varolina woman aaa badete do.#0 without el |.WE pay CASH for country who ever became the wife of a Pres=)questions.|“ onys yp Corn.and Oats,ae jidentof the United States,Headaches,all forms of indigestion, WE deliver in the city...;hicbeks hefore the eyes,dizzy,feel-) Tien L L |GaN ;“i Rey :lings,and all forms:of liver trouble are meas SORE Hoes free er Me A heme ve ever tnod tor |helped by Mi-o-nu.A few days’treat- ¢who *9 e\constipation ‘and indigestion.My ye one ment should.show considerable gain Phone No,88.—14.Broad St..gerd ee eae tet Wileming in,health whilea complete cure often achilles |“Obtainable:here,|.«LOMOWS rap PY Misia ea 43y Constipation.and Indigestion.fy Printing “Co. -.Saber. De k e i ¥ae Bais tatesparapour Jian | LANDMARK [NEWS OF CURRENTEVENT:|BEGINNING OVER _AGAl “CLARK ENIVOR AND Ownes |{ncidents Gathered From Al |Russians Conclude One.Atta "TUESDAY AND FRIDAY Parts ofthe Country.and Begin Another nflic SET TUT More than 20,000,000 pounds of]ing Reports From War Ris REET |crabs were caught in Virginia waters|-‘i Sie 3 ION PRICE:‘ast year and sold.for $981,807,ac.=Atte bal cs oe me VEAR oocc..cservaees xen oresanie pO heredearars letra issued te”on,the easternfront,the Russians pt ht AAASAAEREDAREES ESD el A ese A OR ie Reese tet appereeateerorinmideenpsitittoninrelg Cn ve.begun.a * MONTHS Maknieessenre4eeeaner <n A bill toestablish a system of Fed-against the Austro-«Hungarians:a LY,~.January.21,1916 eral licensing and supervision of/the |Bessarabian ic Lister Fie re Sd ny Sarena)Czernowitz,capital 6f Bukowina,~~ ———===|}oroducts has-been favorably reported}the initial offensive:of what _WHEREIN ERWIN TOPS GROVEE |‘the House of Congress.wl betermed the “Second Battie? “'$o long as Prof.Godbey of the}If vou are disposed to complain of}the Russians -launched with numer- CG the high pri f coal,take comfort |ous columns four attacks near Top.Gree N finds ~that’~Erwin e high price of coal,je comrotr par “4opor- tr cs ee es on more|rom the fact that you doh’t live in|outz and Boyan,but according to Vi- cs :Italy.Anthracite is now felling in|enna they were everywhere repulged. for himself and the country in grow-/{taly at the rise of $40 the ton.The Russian offensive launched ing 81 bushels of corn on an upland]Mrs,Emmeline Pankhurst,the Brit-against ae Austro -Hungariansin acre in Iredell,than the Alexander|'sh suffragist leader,detained by |pest Galicia ane along the Bessara- who won the baseball championship New York immigration authorities|°}"?frontier na RetoRG See:deserib- site MIP yuntil her case could.be referred tod as the “New Year's Battle,”came :i se for irri-:‘44.3 /to an end January 15,according to thTheLandmarkhasnocauseWashington,was ordered admitted 'y 16,a zg e:Ai ‘Austro -Hungarian war office,withunconditionally,ithe.Teutons holding all their lines ‘on©takes the liberty of moving a vote of}Mr.Britt of North Carolina has in-',Py :+. ‘reduced in Congress a bill to give the |;2e 8 tale |Son Rave |ee tation.So far from it,this .paper thanks to this native son of Iredell for UNUINie eeivithes tothe of ofcetebe5aariviotheofficers—of,,:eesthefinelesson,and the inspiration he |iyo National Guard and the Naval Re-Cig aise aly or wounded:and 6,- has.given the Iredell boys and all oth-|serves of the several States’and the|That.this ends.only....onc.phase of er boys.We especially commend his]District of Columbia.~~"the offensive,however,is indicated or remarks to the corn cub boys in Ire-B ary opens wererd ati the Austrian.official.statement that‘3 who.¢erlin has been informed by the Ger-/Russian.reinforcements ‘are ~beivollandipallthe:-farm boys whe are}nan foreign office that all German’thrown into cast Galicia,The Atenotinthe.corn club but should be._|submarines in the Mediterranean have}trians all along h&ve considered thatTherecordof81bushels,the best|reported and that none was concern-'the big Russian offensive was under; last year,was not the higt:record for een destruction of the British taken with the dual purpose of les- -:ie r Fersia.sening the strain on the Entente al- Iredell.Some of the boys in eer Prohibition of the manufacture,im-lies in the’Balkans and possibly ofpasthavegoneover100.But the 8!)portation or sale of all intoxicating|cnusine Rumania to enier.the war on was the best this time,it was a fine|drinks:or habit-forming drugs in the the side of.the Entente allies. record,afid Erwin Alexanver ceserves Philippine Islands,excepting .native|_While the Turkish war office assertsfeee“|beverages,was written into the Phil-'that the Russians in the Caucasus tll the praise the News eee him.He!ppine self-governmenz bill by the have abandoned their offensive along end the other corn club boys wo won}Senate,by a vote of 35 to 28.the entire front of nearly 100 miles, __}tizes and those who didn’t win prizes}Suit for $5,000,000 damages “has OW!ng to the reinforcement of the Ot- -Jave in them the making of the men|been begun in Buffalo,N.Y.,against ENS,and their ags--mption of @ vio~ Sho"ate:to thake Iredell county;who Glenn H.Curtiss and others associated vial oft a at splees ssn Ae :’with him in the manufacture:of aero-/°'@!communication —Geseribes |the vill be the leaders of the forces that|nlanes,by Augustus M.Herring,who Turkish army in this region as hay- tre to make this county a great coun-|claims to have been a partner of Cur-ins been disorganized =dislodged ;yt tiss in.the early days ‘of aviation.STOMH fY SEECRRSDOSMAGTH:24Une eaety.The boys who didn’:ven prizes iA acidentat RORY due to suffoca-|°°.miles.the Turkish retreat.taking Should not be discouraged.-They-are iia,»was the verdict:of the coroner's!°%the character of a panic-stricken cing their part and if-they-are-sttd¥s}jury-in the case of William C.Lifson,Teh Several Turkish units.othe fe er nee and profit by their Be ee ae eee ee iibilated,hundreds of bodies covering meee ey may be prize-winners fight last week.Lifson,who was 17 che field of battle,:&a ney :Great.Britainhas_informed.the“Text year.But,no matterif they nev=}yearg old,lived at Elizabeth,N-J-linited States through ‘Ambassador er win a prize,if they do their best |Naturally the boy was.suffocated”one that “innocent”area taken -hey will succeed.Only a few can when his comrades piled on him.from-eteamers by ‘the British author- \‘in prizes in any contest,but all of After |another protracted and ities is not being unnecessarily delay-Vaeahe ingk&‘the:Vest ‘bl 7 |Stormy debate Tuesday,the United od hut forwarded to the addresses im- can make the best possible use Ol Senate Senate referred to the foreign yodiately.Mail and parcel post mat-tho talents God gave us;can contrib-|relations committee a_resolution of-{o+which is not classed as “innocent” _=te-the-best-that-is-in-us-ror-wie-gen-|fered by Senator Lippitt for.armed.js.heing-held-forthe.prize.court,.... geal Gdvencement as well as for our|mtervention in Mexico,and the reso"‘The total casualties in the entire; lution’of Senator Lewis for use of German army for the war number 2.-| own advancement;and when we have|the land and naval forces in conjune-537.788,according to an announcement|Tone our best,while others may out-jtion with those of Carranza to restore made in the House of.Commons by the -girip us,we can have the best of all |PCace and order.Nomentary -Under-Seerctary “for laudits—the consciousness of know-|__Extension of the Mann white slaveFsthetwardid“our h act to Alaska,the Panama Canal ; s part honestly-|Zone and insular possessions of the Thought the Iredell Man Was diuithfully and bravely;and.we will|United States,is proposed in a_bill the Prize Fightor.: deserve and receive the —plaudit—by Senator Overman.The act would When Mr.and Mrs.Bert Aréy_of “Well done!”also be made to apply to corporations,!4 |.he Ee eee ar :companies,societies and associations ~°SOUry Were in ba vimore”on:CHE ||Birst of the Belligerentsto Tmustbe faced,Montenegro frontier east”of was -ommunication adds,were almost an-} --nervous-break-down..and terrible nead:_| |-J noticed a decided improvement,and'now J am a well woman.’’—Mrs.ANA | For Peace--Was _Hopelessly Defeated.-Beset on the north,east and westbyAustro-Hungarran armies “andWithalllinesofretreatcutoff,exceptintoAlbania,where hostile tribesmen |1 has“asked! ustria -Hungary.fur,peace,and her. ditional laying down of arms by Mon-senegro was made the basis of.theopeningofpeacenegotiations“andontenegroacceptedthesetermsim-posed by the Dual Monarchy.; the Hungarian Parliamenz py PremicrTisza,and it was met with an.ova~‘ion on the part of the meomvers.ofthechamber,Thus comes the first withdrawal of any.belligerent fromitherofthealliancesthathavebeenghting-with each other since August, 1914,It has been conceded for days ‘that‘he situation of Mon‘snegro*was acriticalone.Although the army ofthelittlekingdomfougnt;valiantly.“ against the Austro.-Hungarians,it unequal;because~of -inferior forces,lack of,guns and,it has been stated;a shortage in commissariatsupplies,to the task of holding.back the armies that had,in conjunctionwiththeirallies,.succceced in erush- ing Serbia.The Montenegrin capital and many est-has-been-granted.The:uncon-!}- This announcement was.made tolf-. BRL PRA Ev hy A SCENE FROM “THE SPENDER”(PATHE) AT THE CRESCENT THEATRE _ ODAY—Lae ce aa aed er et iu aPC my|“THE SPENDER” Featuring George Probert and Alma Marlin in George :; Brackett’s Famous Play.Prices 10 and 15 cents. of its important towns had fallen ‘in- rians,.and the invaders.were well:.on their Way to Montenegro’s chief sea- nort—Antivari.Last accounts had the Montenegrin srovernment ‘at Seu- tari.“The whereabouts of King-Nich- olas is not known. The Department of Agriculture’s annual éstimate of farm cattle in the country January 1,shows 21,988,000milch_cows,-an—increase of 3 per cent over 1915;89,453,000 other cattle,an increase of 6.4 per cent;49,162,000 sheep,a decrease of 1.6 per cent,and63,047,000--swine,“an--increase of 5.3)per cent.RN ear ae Justice Lamar of the United States| Supreme.Court,who.died.afewoweeks} ago,owned property in the District of| Columbia valued at $:50,000-and also| owned property in Georgia. — ~OVERWORKED MOTHER — Finds Health In Our Vinol Collinsville,Ul.—‘I suffered from’a | aches,and was tired all over,totally worn out and discouraged but as Thad | a large family I had to work despite my | suffering.I saw Vinol advertised and |decided to try it,and within two weeks | BEcKER.:We gaarantee Vinol,our delicious cod | liver and iron tonic,to strengthen and |-build up weak,run-down,overworked | mothers.| SP,and prvoide that in all “prosecutions bridal trip a few davs ago,Mr.Arey It.looks like the child labor bill,tol,wife would be a competent witness “2%taken for Jess Willard,the chdm- which our Southern miil men very |against her husband.jpion prize fighter.A Baltimore pa-, siuch object,will pass:the House of}J.O.Welday,State chairman of Coe i Pa aitement last Congress and it may pass the Senate,the Socialist party of Oklahoma and night in the lobby of the Hotel Bel-| i!a filibuster doesn’t stop~it:-The former department head of the Okla-vedere when _a_report:was circulated| ;ae homa City high school,was found a Willard,the champion mill men are.partially to:blame for!dead in his room in a hotel at Okla-'y,,.;fighter of the| the new.trouble that threatens.In|homa City with a bullet hole in his fe was non: “Worth Carolina they have persistently,hetie,:-,,|were found beside the body.His death |j.4,.o ad ~fought -every effort to regulate child|came a few hours before-his pee aoe a cn eesner =eos ee In the last Legislature a bill|marriage to Miss Olive Todd of ape bo-nee the champion.when 2“4 i ae =‘young man fully.six feet six inches,‘was killed by methods that were not|city._.| greditable.One Senator wno opposed ee oe Bee enters of ae to the ee cre and had a con-| :on ‘.._joline,who are believed to have raised;versation with Chief Clerk William P.7 re peed tor it abt of ahaer dis-the price-without cause.a memberof}Farrell.As soon as the tall man had| ust at the methods used against it./Congress has proposed a resolution to/left.the desk,several admirers of Jess.| \And to crown it all was the testimony stirs a ee $1 a allen ex ally Willard,who bee waited aoe time| :gasoline sold for more than 15 centsito sce him.rushed up to Mr.Farrell! a Mh —of,Charlotte,the witness a gallon.This is designed—to-fix the and asked him-if the man he -had-been For ene tae men before the congres-|price at-15.cents a gallon to dealers|in conversation with was the man who sional committee,who not only dis-|and might or might not mean a low-|had defeated Jack Johnson. -<‘redited the men his testimony was|°"ee to Speen as the dealers;young.man turned out to be Mr.B. Peae oe __-ieould_of-course_combine.> ppopaned to:help,bue discredited his _The determination ‘of Canada _to|Carolina,and with him was his bride, wtate,and the South.Altogether the|continue every possible effort to send|who was under five feet tall.When _mill men are playing in hard lines.|aid to Great Britain until the war is|Mr.and Roe Arey left abe motel :“While the child labor bill berore Con-|brought to a victorious conclusion was|%0 to a theatre it was observe that geeiecontust und”The’Land ;given expression in Parliament,first|Mrs.Arey hardly reached her hus- or Rory Bn,e Landmark |§y Sir Wilfred Laurier,leader of the;band’s shoulder.”topes it,will:fail,it:is apparently the|opposition,‘and then by Sir Robert;Mr.Arey,as has been stated,is an __-sesult.of unwillingness toaccept reas-|Borden,the Premier:The two lead-|Tredell man.He is &son of the latePeeekhlemeasures““yers declared that while the war con-_r a pe oe tinued in Europe there shall be no|Wood community.aaa eee 74s .®|TT LEPPresidentWilsonisgoingbeforethenoliticalquestionsfoughtoutinCan-|.:.:iTo Fight Typhus Fever i X= sountry~-to tell the people about the oe Supreme Court of the United|:z=ico Fever aeaational.defence,y ss dismi ;Pie ceniee ee ee ae=er preparedness States dismissed,for want of juris-|Typhus fever is epidemic in.Mexi- jrogramme.:‘It’s always a good plan /|‘liction,the appeal of Robert Kitchens.',:p a ee h ;‘29.and according to the reports ,re-to give the people the facts and ity eal C 0,ea yeti ote eee ieived bv Federal officers at El Paso. viay be expected that the countryiGeorgia,inrefusing to hold teeny bexas.there are probably 100,000mee;Y!'Georgia,in refusing to hold invalid!.jceg j ms 5 “twill be much hetter informed on this {his conviction and sentence to death}pee te ony to keep the ‘fever Yiatter when the President has given for the murder of a white man named out of the United States.It is doubt- them his reasons for urging the in./Brantley.The appeal to the Federal!+.)i¢this will be entirely successful,:a =)s jeourt was on.the ground that negroes|+.,vodka Sela r7¢rense’of the national.defence.-It is|were denied the rieht to si he,ut if the disease crosses the Rio ca Sjwere denied the richt to sit_on.the.Gyands-it—willbe —sonfined:to the‘tated that Mr:Bryan;-or some other jury which heard Kitchens’case.border. *speaker of the opp:sition,may ‘fol-|Frank Guinn and J,J.Beal.two*American —physicians,-armered in fow the President and ‘Oklahoma farmers who,as election of-'si}k and rubber against the infectingresemtthe),_;:.’:. ‘ther sid cee \fcials,were convicted in the Federal ‘ody vermin,are prepared to go into r side.court of ivyeventing their intimidating vee pa haeee to combat the enidemic with a :voting.under the,the methods used lately in Serbia,ac- Still Haggling About Mexico.)crandfather putes of the Oklahoma)cording to an snpeunvehdnt by ;Dr. Rénablican Senators mz 4 :170 stitution.have been pardoned by “arlos Husk,‘chief surgeon of the Wednesday's testing of ies ciree:resident Wilson.The President,\merican Smelting &Refining Co.. relations committce -of their purpose|ind granted the two eae respite’which normally employs 50,000 mengsieceniupthe.ficht-for action on the |Zhich would have expired February 6.south of the international border.Drs estontion-in--Mexico._-The Democrats|At the time the alleged offence was!Tichman and Olitsky o-Mount Sina? were equally as determincd that no)committed the Oklahema grandfather |iospital,New York,with Dr.Husk Raptalative:action.should be “taken at clause had not been declared unconsti-|and a number of other physicians Mai atiee and that the vroblerns in.|Utional and the men acted in good|./ill.form the expedition,which wilt bc “wolved should be left ts the President.|{ith in enforcing it.financed by the Guggenheim interests:‘coeeannsnectneneessereFormorethantwohoursthecom-|Carnenie Hero Award‘2 nhs ;5 ir PO £ards.eymittee discussed behind closed doors|*©2 Last Deecmber I had a very severe cold anceeresolutionsandproposals;At the 12th annual meeting of the)enn down sick in bed.Feet twe"aa S wants |re 3 _Cee bottles of Chamberlain’s Cough pmedy anc!@ send troops to Mexico to co-operate |Carnegie Hero Fund Commission at ‘was ‘onlyaveryfew days anil twawithGeneralCarranzainmaintainingsompletelyrestoredto-health,”writes 0.JMetcalf,Weatherby,Mo.If you.would know¢rder and running down the murder.|Pittsburg,Foe‘ers of American citizens.Senator Bo-|Were recognized.tah of Idaho and Senator Lodge of;medals were awarded;in 13 cases Massachusetts were the principal|bronze medals.Nine of the heroes#pokesmen for the’minority,while jiost their lives,and to the d isstorsClarkeofArkansas,Wil-|,See ete nee antsoeSenStonedefendedtheattitudegaanofthesepensionsangregating;administration.Thus far the|?’:7s9 4 year were granted;to the“majority leaders have succeeded |in dependantsof four of the others who 7“eventing action on any of the reso:lost their lives,-sums totaling $3,000, $submitted to the Senate in the |to be applied,subject to the direction Jcss. ‘heavv-weight.prize world,was a guest there. |“the Gist of ‘It. acts of heroism| In four cases silver|‘he aie of this remédy,ask any one who ha:ased it.Obtainable everywhere. TS alealt my Gowans being more pene-}trating makes it preferable.DE simply rub it on yourroat,chest or parts affect-@f and it fs sbeorbed thra ‘week:jof the commission,in various ways,the skin,stopscough,croup) Smmmmmmamenes |were:granted,In addition to these andcolds romps.Re:resident Wilson has definitely de-|money grants,in one case the sum of ing congestion and fever. le |to.take,the stump in an effort)$2,000 was appropriated for educa-|be ay by mae tsutthroughhis“preparedness”|tional purposes,payments.to be.made Wikeforpaniple.and teal:ame.While his official itiner-|2s needed and approved;and in six Teed Cowans because ‘hot been announced,itis un-|casés awards aggreguting $4,500 were Guvwansiatnorepandtreting®that he will visit several of|made for other property’purposes.We GOWAN MEDICAL CMiddle..."Western|Payments in these cases will not be |Concord,N.C 0. 7,f bee aes a4Arevolver-and several letters jton¢after the renort had-been circu-> ‘tall steoped from the lift and walked)fy The; —Arey.who had registered from Northj- .E.Arey and was reared~in Elm=;~ All possible ef=!'4 W...ttall,Druggist,Statesville,N.C. to the hands of the Austvo -Hunga-)"=~ Queen QualityRice,whole grain and uncoated,3poundpackage 23c.,1 pound package 8c. Lima Beans...i..eee ress ‘ Yellow-Eyed Peas.Mixéd:Beans .........- Pink Beans Black-Eyed Peas ...... EVAPORATED FRUITS. Extra -faney Peaches, value,for Fancy EvaporatedCB.beet he te eee Evaporated Peaches .....2% California Prunes California Apricots SS .Ib. 2c...lb.“MISCELLANEOUS,~~ Whole Grain Hecker’s wheat Flour Cabbage Cream (Cheese Head Rice, 10c.value,for ....-.. Mountain Buckwheat Flour Prepared —Buck- 10c..Pkg. 2c.Ib. 28¢.Ib. The Robert.Bunch Cash Grocery, “The House of Better Values.”:) ‘’*Phone No.229. Ib. lb. Florida Oranges 30c.per Dozen. Grape Fruit 3 for 25c.*Lemons 23c.Dozen. Maccaroni Spaghetti oli.cece es Postum White HouseCoffees!White House Coffee -1 Ib.canQucenQuality.Coffee,steel-veut,put up in 1 lb.cans,Shc.value.for...vs.ceene OSC,Gold Ribbon.Coffee;1 Ib.can..24c.Dandy Gup Coffee,-1 Ib.-pkg...18¢.Ten Penny Coffee,1-2 lb.can..9c.No.1 Bourbon Santos Coffeeinbulk.”We grind ©thisfresh.as “you need it andeuarantedeverypound;sic.— value fOr:wc ese ee ee reece COCsNo.1 Blended Coffee,25c. value “fOr ..cceeeeeecees No.2-Blended Coffee,20c.value Se vaieeyes y «+16¢. Arbuckle’s Coffee,per pack- APO.ce wtnaerey oy 19C. 33.c ..18¢. sees Pa *V oneStar”& Ancw,all steel,electric NINE+parcan|OUR-DAYS. Clearance lightedtrainfromMem-—Be phis to Texas via ; Cotton Belt Route Leaves Memphis 9:30 p.m. .Arvivee Daliag”fewerAstiveeFt,Worth 12:50noon The only solid trains botween _ Meraphia cand Teras CottonBeltRouteall theway “no change cf cars,no miss- ing connections.Morning tratnleaves Meraphis at 9:40a.m.Trains from the SoutheeactconnectatMemphis, Low Faves Winter Tourist Fares daily ©to many points in Texas, Louisiana and New Mexico; stopovers and limit of May3h,1916.All Yeaz Touriat Fares daily to cettain Texag points;%Wdaylimitstopovers. Send for illustrated book-lets,and get information about low fares from your town. H.Hi.Sutton,Dist.Pans’r Agent,’"i 109 W.9th Sc.,Chattanooga,Tenn NOTICE OF SERVICE OF SUM-|MONS. North Carolina,Tredell County.: In Superior ‘Court.Before the Clerk. ~ James Hampton,Maggie Hampton,Clarence Yampton,Matilda Hampton,.W.A.Evans et ils.v8,George Hampton.' George Hampton,the defendant above’nam- 4,will take notice that un action entitled as \bove han been commenced in the Superior jourt of Iredell county,North.Carolina, be- ‘ore the clerk,for’the purpose of selling the and of John Hampton,deceased,and dividing he ptocreds thereof among the owners there- if3,.and the said defendant,George Hampton, will further take notice that he is required toappeardéforeJ,A.Hartness,clerk of the Su’ Statesville,N.C.,of!the T2th day of,Fs sore} oe.and ‘answer or:demir’tothe petition in} id ‘action,or yerior Court of Iredell county,at his)office inj;%|DAYS.=| he will return through|made uptil the beneficiaries’plans forSpeakinNorth)the use of the wards have been ei"proved by.ite Urea renrasheseSoRSAE eae i *.‘genes§ bers careat the:ff ‘will’apply’tothe:.lie demand in.#atd))com+5PissanARTee: a [apie foe "the "yeh 4 valet 4 NINE|BARGAIN-DAYS. ——Is-on-and the crowds-eres:oe are here buying th ey i good things we have _ priced specially for this event. all ast week :and “The Selling Will Continue & there will be special attractions in.every ~department.| & NINE __.BARGAIN | aw Ramsey-Bowles-Morti-. sonPyhit 4‘ ‘ NINE toticv taints Wh Bt Tri *, :otay { Ry t Si a a Ae « Me 1.C,P.Moore and’“chil an,whoansrelativesin Statesvill =Se,icdovell to their hom¢Dowell county. weTowNNeill,Wmonths’in Towa,°ot inéd to States--ville-a few days ago,And:are now attatfarm,near Mooresville. Mrs.E.M,Sentman and ‘little ‘daughter.Miss Sarah,spent Wednes-_day.in’Charlotte."Mrs.J.W.Marshall is in Concordspend“a week*orlonger,;Miss Lois Sherrill:went to Char-}jlotteWednesdaytovisithersister,Mrs.J.is Caldwell.Mrs.BE.M.Land,who spent)sever-al weeks ‘with her parents,Judge andB,F,Lone,returned yesterday to her home in Goldsboro.Mr.W.W.woe of the vicinity of.Statesville ects to leave in a.few spent several’ -month ee eee to .spend a tem,of that body and is now a can- pen op A.Lazenby of High Point!didate for.Lieutenant..Governor..He|xc on Tuesday and Wednesday withhomepeoplein’Statesville and.the county.Mr.W.K,“Clement of |Mocksville| was a Statesville visitor yesterday. Notice of New Advertisements. “Special license must “be paid—J. M..Deaton,.sheriff.Suite of officesills,“Furnished rooms wanted,AddressRooms,care The Landmark,Mares by express,—Henkel--Craig |_Live Stock Co.|“Fresh milk cow for sale-—C.A.! Dulin.Clay peas yanted.—J.W.Allison: for.rent.—N.B.} tte ‘Norma Conger,daughter ofMr.T.J.Conger of Statesville,and Fig fo Wien NU Se EVE Neil f I and daughter,up.their residence in Salisbury,where|3, iMrs.M. _tage of Miss Conger and Mr.~-McCanless.}p eare mars _fatarday ver Son fy keOnM,,re Mi on:“Was a,oe aay theNational”‘olBdecouplehad.expect-the home’of the bride evening in ‘¢ lease from her work-at Johnson City.| mony.performed immediately.Mr.and Mrs.McCanless have taken'|°! Mr.McCanless is superintendent of | streets,The Salisbury Post:says |** getic,and has’made a faithful andefficientcityofficial.His bride,who}° is very attractive,was for some years| in training “at the Whitehead-Stokes| LSanatorium..at..Salisbury,from.which|*¢tshegraduatedasanurse. ~Miss May Courtney Oates,daugh-|scterofMrs.W.D.Oates of Charlotte, and Mr.Henry Neal Pharr were mar-ofriedintheSecondPresbyterianchurch of Charlotte Tuesday evening.|Mr. Pharr is a prominent lawyer of Char- lotte.was for five terms a member of|sc the State Senate was president pro-|| ot is a native of Statesville,having been born here,when his father,the late|*Rev.Dr.Walter W.Pharr.was pas- ‘tor of the First Presbyterian church of Statesvillé,in the 60s. There was a good attendance of Daughters at the U.D.C.Lee-Jack-son.-talebration,held at.phe=-home of Rr:Adams,president of the Wednesday afternoon. ly local.chapter, tvere in charge.of the programme,a which opened shark a vocal solo.“Sol-|, diers’Farewell,”by Eirs.;W.R.Me- |Lelland. sketch of the life of Gen.Lee Mrs.J.B.Gill read.a sketch of life of Gen.-Jackson. Bunch,B., of $6. of $6. but Miss Conger could not get a colar gone Mr,McCanless was thereat the time |*)~and it was decided to have the cere:|of $5. \seription of $3. |$6. tion for = ame2 of one ¢of the Charlotte chapters,n "|The ‘elebrate.“Anniver-Mrs,niepserved delicious refresh- of:ederate Chief-ments,Berend Hibae ‘talns=-Soctal Affairs —Mar-Collectionson:Visiting»‘Nurse Fund;Aa Collections reported”since the listublished9ofcollectidnsonshbscrip- Alexander Bro.,50c.,haiance on subseriptionS$.lL.MeGanlessof —-Salisbury,!.¢s¢.Benevolent and Pollet”AssoclattomM,“36;~bat-2 on subseription of $12,1.50,balehen:on subseription Brady,-J,—A,,-$1,balance:on subscription $4,‘balance on i pubserinyion Crawford-Bunch Co.$2,balaned on sub- riptian of $12, itz,R.O.,$1.25,balance on subscription co J.C,$1.60,balance on subscription6.7 Henry,R.F., Iredell Hardware Co.,$1,,balance on Bubr ription of $12. $2,balance on subseription of Imperial t i |(ADVE aN’My.McCanless:is popular aud ohare sotecistn afHe Company,$9.balance on |(RTISEMENTS in this column 10 cents ryng,Mrs,B.F.,$6,balance on subscription 12 Lewis,Mrs.W.G.,$1.50,balance onisub-% Lazenby,Miss haura,$b,balance on sub- ription,of $5.Mayberry,D.,»-$2,-balance.on.,subscription of Marvin,Miss Annie,20¢.,balance’on be ription of $1.20, Nicholson,W.T., $4.Preasly,Rev.J.H.,$6,abalance oh Subserip- tion of $12.Raynal,Rev.C.E.,,$1,balance ow bubscrip- ticn-of $6;Steele,J.C,on.sub-ription of $24,iWilson,H.C.,$6,balance on 312.Woodward,Mrs.H.B., ription of $6.Metropolitan Life Insurance ‘Co.;'November and December work,$29.50.Mr.I.N.Paine,milk &Sons,24,balance subscription for tuberculartient,$3.08.J} Bloomfield Manufacturing»Co.thé use of a}house for the meeting held in Bloomfield week- for several monthsThedrugstoressold all supplies needed:in this work at actual cost. W.#B:Hunter For Treasurer. To the Editor of The Landmark: I am glad.to know that W.-H.Hun-|||Mesdames B.B.Webb and J.B Gill/ta.of Concord township will be can- forthe Democratic _nomina- Treasurer of Iredéll county. He has been a life long Democrat, idata Mrs.R..0.Leinster read ais a substantial farmer and a man an lof good business ability,well qualifiedhe: “The perel|for tho.office,rreccgnized as a leader in.everything He has always’been L.C.Wallace,trustee,will sell land |or iginal tribute to Lee was read bY |theat tends to the moral uplift of his February 19,:Notice of action in Superior Court. i.A.Hartness.‘A mintte of time wanted:=tinee| berger.=‘Fresh goods.—Sheérrill”&Reece.) Flowers.—Polk.Gray Drug Co.,|local agents.|Today..tomorrow and Monday at. the Lyric.Sandwich dainties.—Eagle ~&Mil-holland.|Put in a Myers pump.—W.E.Mun-| lay.A tin roof.—Statesville Tin Co:Stalk ‘cutter.—Iredell Hardware Co.|‘Oranges,grape fruit and“lemons.— .H.P.Grier:cormmunity.His faithfulness and’loy- $1,balance cn subscription| pa-| for produce on the local market, Green Hams,18¢,to bc.per Ib. ~Shoulders,”12a per tb: ‘or grain on the local market; Oats,6Sc.per bushel, pound was paid for best grade cotton. MARKET REPORTS. Statesville Produce Market.The following prices”were paid -yesterday Winter Friers,12c,per Ib.Turkeys,45¢2°per Ib,Hens,10e.per Ib." Haus,24¢,.per dozen, Roostera,6c.per ib. outter,Ibe per Ib,Beeswax,25.per Ib. Green Hides,11c..per lb. Old Hams 18 to 20¢,per Ib,Sides,12¢,per Ib, Red Honey,8c.per pound,Sourwood Honey Comb,16 to 18¢,per lb, Graik.The following prices “were paid yesterday Wheat,1.35 per bushel.Corn,(new),60¢.pen bushel,. Statesville Cotton Market. On the leeal market yesterday ‘12c.per Seed cotton,5.25.Gotton seed 57c,per bushel. F |-F ‘OR RENT—Sulte of offices adjoining Dr.“T. HORSE S,.MARES. ast WANTED—25_to "30 bushels ‘seed “Clay Peas, per line.No ad.taken for less than 25cents,Cash must accompany order.) D.Webb's offices.N.B.MILLS.Jan,241-—-2t. \ND “MULES —_We.have press car of 28 Mares.We w have over 225 head of Horses,MaresiMulesandeansuitmostanywant.CallM%see them.HENKEL -CRAIG LIVESTOK£0.:Jan,21—2t. received by e on SAL2 _-Freah“Milch |Cow,"Phone 915- Cc,A.DULIN. -Attan,21 J.W.ALLISON.Ydan..21. 5.00,balance on sub-LOST —Diemond Ring.| |WANTED~Just a minute of your time,| 3, Reward for return toTHELANDMARK,Jan,21-—It*. st to read this Ad.of mine.60c,to shoe a Horse et!around, seo LINEBERGER,he’s easy found. Jan.-21. B WANTED—One or two furnished rooms for pacioennceieitcicaadleniniesaversedenen ES BIG LINE ef new geods at THARPE'S 5 FE SPECIAL—See Big line“of "Laces ‘and Embroi- light hiAddres Jani 2 keeping.Apply quick with price.ROOMS,care.THE L.ANDMARK.ey 7 and 10c.Store, ‘OR SALE._"Second.hand Fords and auto-mobiles.at,a-bargain.CAROLINA MOTOR co.Jan,18-—2t. dery at THARPE’'S 5 and 10c.Store. WwW AN TEDL Oun ss lady for office work. ‘tie *-naeLee Over all ne>dmumortal,livine, "this And in every clime jalty-to-the-Demoeratic--party “should twin for him the office which he seeks. 'f-believe’no Demoerat—avill_make .a imistake by casting his ballot:for Will Of deeds the blo,grand. Let us then togetherBandourse ' acine s children The history vet to beWillblazenforththevirtuesOfotherswithourLee.;| Preceding the Lee-Jackson pro-gramme a business session was held.1 during which it was decided to raisetheannualdues’from 50 cents:to 151 |Hunter. ca at 5c. |they are all gone.—ad. DEMOCRAT. —ad. SMITHEY & ses FRALEY—have lb.Come and see them before 10¢.Dippers only Bes,4 dozen \Clothes Pins for 10c.;5.cakes:Seap! 5a Other |—goods just as cheap at SMT YrQc.(Laundry or Toilet). "RALEY’S.—ad.ota The Robert.:Bunch Cash Grocery Covi cents.“It was also decided to discon «Clearance saleon,—Ramsey--Bowles-|tinue serving refreshments atMorrison:Co.;mectings.The entertainment,com-|‘The Spender at the Crescent Thea-| ter today.How.to have a home some day.—|First.Building and Loan Association! of Statesville. Save your steps.—Williams Furni-| ture House.~~-Lazenbv-Montgomery Hardware Co.,; _an_acrostic,——Rest.on.a._sanitary mattress.—Crawford-Bunch Furniture Co.Annual.furnitue clearance sale.—Statesville:Housefurnishing Co.oe yourself.—J;-M..McKee &|0.:: Change of Farmers at.Orphan- age—Barium News. Correspondence ‘of The Landmark. Barium,Jan.19 —The ’heatingnlantbeinginstalledattheOrphans’Home:will be completed next;wéek,“An:infant of Rev.and Mrs.W.T.Walker was buried here Saturday.Mr.Jesse M.Arey of this vicinityexpectstotakechargeoftheorphan- age farm February I MiRD.Mc-' Laughlin.the former farmer,will ‘move to Mooresville.‘Miss.Emma Blount of Feversis.visiting her-brother,Mr,A.Mac.Blount..Mrs.-A-R.Blackwelder}ofConcord is visiting her father,Mr.J.A.Lippard.Mrs.R.W.Hutchingsand:-son,Robert,returned tohomeatSpencerafteraweek’s visitwithrelatives-here.Miss Pearl Brant- ley is visiting her sister,Mrs.R.D.McLaughlin.Miss:Victoria,‘Hudsonsnenttheweek-end at Gibsonville.| “Mr.Jo.Hartsell is ane relatives| at-Mooresville...Mr.John B..Ross of| _Charlotte-was here one-day this weekonbusiness.Mr:James Foster of Davidson spent|the week-end with»his father,Rev.| W.C.GC.Foster.“Miss Isabel liams-of Washington,D.C., ©withher children at ‘the orphanage. -Social:and Personal ‘Items— Spelling Match. Correspondence of The Landmark. Harmony,Jan. cousin,Miss ‘Nellie .Castevens.-Mr..and.Mrs.Boon Turner Mrs.Powell spent Sunday with Mrs. Turner’s mother,Mrs.°Ida Gaither.|Mr.Pres.R.Weatherman,one of the}Harmony |High School‘:students,~spent Saturday and Sunday with Mr.‘Bristol:Tharpe.Miss Louise Lank-ford .will leave today for ,Boone,where she will take up her musiccourse.Mr.Jay:H.Campbell of CityPoint,Va.,is visiting friends and rel-‘atives near Harmony.There will be a spelling,match at;cae school house next Fridayi John Blount,a colored man ofaecounty,wandered from homewight’c coe while in delirium®ia.He had not beennideteeedTearsisfearedhewasdrowned‘died..from.exposure. Habits.of Beden:fet b titlecxereine a@prey {pehtct Tablets high-food as a three or fourbutverymuchbetter _lof shoe trees. their| Wil-| :was a} --1..-figitor-at-the-Orphans’Home-one day last week.Mrs.E.W.Lumsford of|‘Asheville spent a few days this week| and| 'mittees will hereafter provide’a brie?‘literary programme for each mecting. |Coffee and wafers were served at the?’ iclose of the meeting. The Daughters urge that all veter-. ans desjring crosses of honor Memo-| irial Dav make application at once to; (Mrs.Adams or Mrs:-J.-H.Hilt,secre=;Ttee in Bankruptcy will sell at public auction, hearts Wednesday mornihg at her} to Mrs.Dalton Kennedy.a_recent|® bride,and Mrs.H.A.Millis of High |" Point,sister of the hostess.was played.at six tables and Mrs.W.|1 A.Sample won the score prize,a pair}. Each:of the guestsof jw honor-were-given Howels,A salad course was and flowers.Mrs.Lawrence gave a second party| played and Mrs.Eugene Davis won!the prize,a darner-set.i,A large number of ner friends att ‘tended the reception given by Mrs.R.i .Clapp Tuesday afternoon at her’«home on west Broad street in honor} of her guest,Miss Elizabeth Gitt,of|Hanover,Pa.The guests were met at the door by Mrs.C.V.Henkel: Mise-Emme-Kerrand-their-cardswere? ireceived by Masters Robert Clapp and ||James Gray.The receiving linein the jnarlor was composed of Mrs.Clapp, ;Miss.Gitt.Mrs.M.R.Adams,Mrs.rClarence Clapy of Newton;and ‘Mrs M.Gray~Receiving in the dining | ‘room were Mrs.W.F.Hall and Mrs.| R.L.Poston,ushering from the din ing room to coffee room were Mrs iT.Fow White and Miss Rose Stevha-| ny Mrs.D.S Thomas and Miss Lou: 1 Camphell received in the coffee | an and Mrs W.H.McElwee.and| iMrs.J.L.Sloan:noured the-beverage,| which was served with cheese wafers| bese Misses Katherine Brawley and| Katherine Kincaid.Ice.eream and, leaka were served in the dining room|ibv Misses Mary Thomas.Margaret| Sloan-and:-Virginia-Henkel,The din-| ‘ing room and hall were decorated in 17—Misses Rebec-vod,the parlor was in white and the} ca/and Katherine Rollins gave a par-|coffee room in ty Saturday night in bgnor-.-of.their|‘occupied the center of the dining table.|pink.‘Red carnations| lIvy,pink roses and white:narcissus were used elsowhere. Reported for The:Landmark. The January meeting of the Fort} Dobbs -Chavter,D.A.R.,was held | with Mrs.Zeb.V.Long.at her home | on-Race street.The attendance was unusually large and much business|was transacted.The yearly dues| were collected -and election:of officers | held,all’the old=officers .being re- elected. Mrs;Kugene havis was appointed by the Regent to serve as her alter- nate during the Continental Congress, which meets in Washington in April.Mrs.J.Cleveland.Fowler read a short sketch on “Old.Fort Dobbs,”from the Round Table,the Chautau-qua Magazine...Mrs.C.V.Henkelread:-interesting paper on the ori-gin of the name of the Morganton chapter,Lakhs hy ”and.a.stir-seatid!patrioticpanér iret.byMraeonneseitthe |lreal estate of the above mentioned [athomeonBeilstreet,complimentary |situaate in.Davidson.township, mand-embroidered||red served,[ere |The house was decorated with ferns |Mo[poles toa stake on vativantt:railroad S.Te theWednesdayafternoon-in honor of Mrs.|r tess,lying in Davidson towns‘Hi of ‘Tre Millis and Mrs.Kennedy.Bridge Was|cou and | |Hiseaa the |WANTED—10,060 bushels of good ic shell- Corn.Will pay highest market STATESVILLE FLOUR:MILLS. Jan.dt. SALE OF RE cash ot EALESTATE. lIn the District Court “of the United States fortheWestérnDistrictofNorthCarolina.In the matter of J.H..Reid,Banirnpt,In e@ccordance with an order entéredeboyementionedmatter,the undersigned Trus-in the on aye SATURDAY,FEBRUARY (19,1916, Mis.E.Ne Lawrenee entertained at|at-12~0'clock -noon,_2t=the Court House doom tin Statesville,N.C.,the folowing de:vibedy rupt, Iredell county, nd more particularly deseribed as follows,to- it: “Beginning at A...T.@ O. orth 88%degrees W..140 potes to a post o2k;2 4 poles to a stake,Mcor rrison’: re ison's corner;thenee with ¢ W.aa)=poles ToT nye 5A 4¢reg,.moye beyinning,co ty. 8 OF SALE-—Cash. ntion of the Court. T9TG: Lu.C,“WALLACE,Trustee in Bankruptcy. ©.Sale subject toonfirmye,This January 17, ___dan, be "MON AMOUR="The Suectheart of Peefames.”* You Have Another Chance The success last Saturday of our Gistribution through the stores named below of our regularO6e.novelty,Trial Battles of Rieger's new Flower Dropsperfume for 2 cents was sensational,On account of the re-markableinterestsh wn by theladtes,we haveextendedourspecin!introductory offer.You have another chance tomorrow to get. 10¢one of these25¢ToialBottlesSpecial Yes,thisis the new,superior kind of Tees thatall your friendsaretalkingabout,he perfume that is different.gWonderfullylasting—retaining all the sweet,delicate fra-grance of the real flowers.Subtle,seductiveandappealing.Not like the ordinary per-fumes you are familiar With but.differentfrouanythingyouever.have seen ‘before.ee Perfume ki $1.00 per ounces .Any quantity desired. nber,this special offer ofatrialbottleforpeetS10peuhas talesoy f hi cnimoyel 57) California Peaches to:close out| Th railroad,ata} e game|stake where the public road.crosses and runs} std} "ied Must td use shorthand and willing to work.ons must be in writing and address‘he Landmark,Statesville,i‘ ce,where employed and salary .expected.dan,18, SPECIAL on Rugs and Druggets af THARPE’S 5 and 10c.Store, y Capital $100,000. THE FIRST NATIONAL,BANK *LEGAL RATE,, fe Re ,ie ALL LOANS”MADE?!24%} AT THE.LEGAL~ RATE OF INTEREST ONLY.:taaye ah :hale Statesville,N.C. Four Per Cent Paid on Time Deposits. U.S.=Depoditory: OST—Belt Pin.Reward for return to B.F.RUSSEL boat -IredettHerdwage-Co.Jan,18->2t.:j WOOD—Cut stove-and heater lengths.Prompt GAITHE Jan,11-408} |FOR RENT—YVhe .,Nickolson house on Bell|street.DORMAN THOMPSON,executor. SPECIAL dex spe same byhandedto the solwave|r deliver ‘Phone 393 Black.ALEX. Jan,7. SAL on TableTHA5and 10¢. and Enameled : Ware.-Store.NOTICE!| *in the county doing business un- "have not paid |1es will be!Nicaata!Pay All Januar and save yromnpily 2J.M.DEATON,Jan.21+-3t.Sheriff. \ ||| po e | * The Lyric Theatre | Presexts.each day.film productions that areselectedaftertheirmer-its have been’investiga- ted.For that.reason |)you never see an inferior |) photoplay at this thea-||tre.ff you are not see-ing them you are miss-ing:a-treat,__Ask—those~-that--know.----We...offer Today The noted dramatic star, Laura Hope Crews. WeIn her recent New York “success; § {}|i+ With Miss Crews ins theleadingpartthisdramayan.a whole season.at || the Lyceum Theatre,New York.Weare sureyouwillenjoythescreen production. *Tomorrow _ An uproarous Keystonecomedy,two reels in }length,featuring those }|funny Keystone laugh-| producers.In addition |,a fine:two reel drama. Monday ‘Miss Martha Hedman,the-dainty and captiva-ting Swedish actress in a five reel comedydrama,‘ ““THE CUB” This story of the experi-ences of a cub.reporter.||on a big Metropolitanpaperfurnishesmanyghsandthrills.Youshouldseeit.The admission for’anyoftheabovebeand10¢.,, it hi sv OFie Steel wheels with Staggard$Removable Dust Proof Wheel:Bearings:One-Lever_to-Control_Whole Machine. (9)Double Edged Knives’(9j-7°". Few Castings.IREDELL HARDWARE,co MPA Y, Sioked and Channel aiut weAutomaticStalkHook...«a: No Wood...« “BLACKBIRDS”|| nj HE The Williams Furniture House Long Laaf Kiln Dried a;ca WELVE G Flooring, Weatherboarding and Casing are best | and cheapest,because they stay where| a are nailed and cost you less,mon- Pine oe WATKINS,Next to et ee eeL‘Planters’!Warchiiise,Statesville,Nic ORSES,‘MARESthystables’“with“Mares:4nd>¥Horses.to trade,fr een pet Conk,ag,tite.C,B.tas DA Few of these Cabinets left,at a real ee Bargain.‘ Good many other articles at closer: out prices. |Mules, wo!lateih AY. 4 ANE Pine,Cedar,Cypress and Tin, Y Mand,arGitar ast"C.WATKINS,Next to McEPlanters’Warehs DUNE;:Statesviille, Céiling,Boxing,| Ip MULES—I4 31 hae ieheadgood”Pforses,|ans ‘havitin ¢Lov/of hee young|sent’same*to’imey ae 1916,/or NIELS. ‘DEATH OF “MRS.ROBBINS.Sons Plotted o Be Parents and : =ster.’ 7 January 21,1916.RemainsBrought ¢to fing Kit Trving and Herbert’Updike,the Burial —Bible Reading—Kill-|sons of Furman D,Updike,the Chi- IRRENT NEWS.)~ing Big Hogs.cago millionaire,who plotted to kill ae Gorreapondenee of ‘The Landmark,their father,mother and sister,ac- Here and There in iy Jan.19—The last few days cording to Herbert’s confession to the the State.oan maaan eetee ‘more fully that a police,are in jail and will pe exam- county Republicans will |are right in tho-midstof winter's cold,med later.“It is alleged that.Irvings}--—~ eM tion F who is 32 years old,is mentally un- Pebruary 19°"to liey:erase:Phe..utue Sehes in the sound,and That Herbert,19 years old, legates’t Stata and congres-|brooks are looking through glass hot ‘De reeee tts..Precinet_meetings |windows,and the ion are dying ‘on|Was led abeSe eee Me etete 1 be held February 12th.slmast "every Bir that an injury to his spine when he0-g{Mr,C.,W,Williams killed a hog is‘Waile Bolin.one of three prisoners a ia was a boy accounted for Irving’s de-day that-weiched-386-pounds.Mr,J signs against them.‘They said they 4escafromYadkincountyjail pel ei ParU rac Stee -nee cat ‘hedreer!hoped a surgical operation might:re- éad :F ‘istore his mental balanee:Irving,ac-sence.He said the weath-ag’and Mr.L.(Myers killed’one that : nd to cold to keep dodging.weighed.some ‘hing over 500 pounds.cording to the police,wanted to kill The hoiie of Judgé Frank Daniels}"yh.Lona Robbins,widow of Mr,|bis father because he feared his pa: it Goldshgro was practically seateny Tad.Robbins,died in Winston-Salem |"e"t pes,are at Wantt ta Oftebyfiuesdaymorning.Most of|\ionday of paralysis:Her remains|™¢mbers of the family than ni “houstWold effects —were saved.)yore broucht out .o the home of Mr.,ee estimated at $5,000,fully cover-|7,Q.Blankinship’s—yesterday..and|_.Mr.J.J.Farriss,former editor of by insurance.were buried at Union Grove church to-the High ‘Point Enterprise,is men- The traStees:and facultyof Mere-day.Rev.J.G.Weatherman conduet-|Roned as the probable successor of Dr. College,Raleigh,have issued in-|¢q very appropriate.funeral exercises,Bradshawy deceased,as postmaster at ieChaves the inauguration of }ys he always’does on-such occasions.|High.Point. —pipe-.time,quick as thegoodnessof Aen wee ‘firm setinhislife!‘The ee ee t—and <=bite ane naresT ne ae Get on the rightemble-track soon as youie bindUnderstandyourself’how much you'll like RINGE ALBER theseeeoreat Jjoy smoke ward Brewer as president |Tore wore quite a number of friends|npr ne the college.The inauguration will |and relatives present to pay their last!\NOTICE TO PROPERTY OWNERS. é place*February 3d.tribute of Fresvect to thc dend.There}~Notice is hereby given to the owners of the ca aa and:Jeff.Dorsett,Guil-|are some Sour or five eiildren surviv-|property,abutting ‘on the Street Lmprovement rd coun .x ‘hi as a.sister Of|District héretofore laid ovt by ox finance dulyneg#des under sentence to jing.Mrs.Robbins wa ceased by the:Be {Aldsrman of the CitBaieintheelectricchairsintheState|Mr,Willie Mit chell of this ed by the Board of Aldermen of th ity ison today,are renee until Feb-|We with to tall the attention of |being Mulberrysection.of Statesville,sajd street Improvement district ary 28 so that Gov.Craig can in-|those who are in reach of Mt.Ver-|tien ef Broad Tt stands toreason, dooen!tit,that if xxmenalooveree nation,all over the world,“*BeWaichyourbentpreferP.A,that it must we ns It’o easy to change.tho shape have all the qualities to odandcolorofunsalablebrando3niot“the Prince Albert satisfy yourfondestdesires?‘/|&mi Prine ,itoimitatetheflavororPrinces©-Men,getusrightonPrinceSes.Albert tebacco!Tho Albert!We:tell you this patented.processprotectsthat!tobacco will:prove better Street,between the inter and the inter reet with said’Mulberry Stree thure .Bible readi 7}ym of West End Avenue with stigate!application for commuta-|non churcl.to the Bible reading,which said Mulberry reet;that sald Street -has been the pr eacher =will hold)there next!duly paved througheut the length of said street ’~week,beginning M nda the 24th.Sola ement district;and that the report of R. “In Asherille last Saturday EL.rer on ae ~ms Greenlee,City Engineer,was duly filed with cClammy,“an employe of the There are getting to be s0 many dif-|Ite Board of Aldermen at the regular meeting Southernrailway company,was crush-ferent doctrines in the country that |of said board on January 7th,1916, 2 t ye!Notice is hereby further given that the as-ed by an engine and died a few days {it will be interesting and instructve t >j >‘sessments for said street improvement will be er.The engine wes started while|to meet and hear the Scripture read|een a at Meester eeamactes es Wrovide cClammy was at work on it and he ena Se by these rever aie Palled by the charter-ofthe.City-of Statesville,on €a eS +themen—such as D.W.Poole,L and |Friday night,February 4th,1916,8 o'clock,es Ty,} Bee eos Seibe®on ce that Jay Gv ene T.E.Redmond and ita theou of Eee nies ee ‘Alde a ed ‘a >than you can figure out,j ut 5 es e Laylorsvillie scou nea .<ae (City of Statesville,in the Commercial Nation-NS RRS ‘ch .others,some of whom have mad the el Bank building,when,and where all property A it *S so chummy ‘and fra-ne :7 of,A.T.Allen,a/native of Alexan- der county and superintendent of the Bible a life study.My friends,if Vou |owners are directed to ‘appear und show cause,»why said assessments should not be grant and inviting allthe ible |if anytaarehuntingaroundthroughtheBiF eavepory graded.pchacls,ai ee to find a few verses of Scripture to|pre!order of the Board of Aldermen.time.Can’t cost you more suit the way you ure living and want .D.MOORE,Cierk and Treasuver.’than 5c or 10c toOM your . onde of :‘a :Be aaanationforStateSuperintendenttolive,instead of taking the plain;Jan,at,1916.'blic Instruction nea ..word as it is laid down,snd trynge to!Goyer op >OWNERS.| A corporation for the manufacture |mould and reform yourlife according |NOOTICE TOP ROPE!RTY O sabi -a-pellagra specific has been char-|to its teaching,you had better pick up|<Notine”is Reveoy given:we Cecowners of she} d-by the State:It'is located in!your Bible and go-to-this meetingwand|Hroperty abutting on the...Sidaswall Inpasoves | k countyand proposes the manu-jjct these gentlemen.straighten you}raat District.hajabolornadwial utr berordinnpee pare of a vemedy for pellagra and lout.|City tesville,said Sidewalk Improvement endant diseases and to dispose of |District \the sidewalk on the north.side pe Mroducts created through the man-|Three oe.weighing five.‘SiS treet-from -the intersectionof Mul bearings!3 ae Bxy Prince Albert everywheretobaccoissold~in toppy redbags,Sez tidy red tins,10c3handsomepoundandhalf-pound wntinhumidors~and—inthat classy :a ¥crystal.glase pound humidorwithsponge-moistener top thatkeepsthetobaccéinauchgreat Copyright 1018 ry Street with saic eld Street’to the ISTE ctnre of this remedy.age seven pounds,were born,Monday,to|pnerey ection oR Cw att ArmAstd|f By Pens trim? Col.W.H.Chapman,reyente agent|)J.L.Mills of Wallace,Duplinj Street:that said sidewalk has been paved!:: ‘Greensboro,has heen notified that enue:{throushout the length of said improvemen R.J.REYNOLDS . }‘district,as provided by the said ordina he willshettransferred to San Fran-brent Re Pee InemCiey TOBACCO COMPANY e Board of Aldermen of| e,at its regular meeting|eo.Webruary 1,and that Col.T.H.|MOTHER !DON’T TAKE er watheCity of StatesvilynowinRichmond.would ,CHANCES IF CHILD’Ss lon January <th,1916.‘him.Mr.Vanderford was 7Pariancertorcoe1otieeisherebyfurthergiventhattheas- i:Greensboro for several :TONGUE IS COATED.eens (or weWcwerk will me made by the| mths:}hefare ha went to.Richmond.rd or Anermen,as provided by the charter the City of ile.on Friday night, °He is from Salisbury.If Cross,Feverish,Sick,Bilious,Fenrua:Ath,1916,ataB o'clock,at the off The prend lodge of Masons,in ses-.,of the Board of Aldermen,in the Commercial| nin Raleigh,elected A.B.Andrews,Clean Little Liver and Bowels.National Bank building,When and where all By virtue of a decree of the Superior Court eat}3 aS 0 pre perty oWners ein Cer ted ave directed to ap-rant d the edingofRaleigh,erand master;Claude |,A laxative jotty eves AIT not ext and shawase,if any,why sald OS0%hgieg”Rk ckaushin,administrator ofp.Pridgen,Wilmington,deputy |tomorrow,©Alldren simply Will no ments should not be made.‘A.J.Bass vs.C.S.Bass and others,1 will & Winston-Salem,N.C. ee SALE OF VALU ABLE LANDS. ‘.take the timé from play to empty their}By-order of the Board of Aldermen.NoyNa SN Oe re irrandmaster;George .S.Nonfleet,Recs which L p 2 Hg Mf ith |rier ot MOORE.Clark and Treasurer,|Sell at public siuction to the highest bidders, ston-Salem,senior grand deacon:|DOWe'S,which become clogged Up Wi Jan.21,1916.-‘at the court house,door in Statesville,N.C. pry A.Grady;Clinton.junior’grand|waste,liver gets sluggish,stomach —on 2 Ae TERMS:C H Y deacon:Leo D.Heartt,Raleigh,grand |S°ur.NOTICE TO PROPERTY OWNERS.|SATURDAY,JANUARY 22,1816,e AS - Hreasurer;John C.Drewry,Raleigh,|Look at the tongue,Mother!If coat-otice iw hereby givch to the owners of thewat If @'clock,.m.,the following lands in)§e 1 :‘7 p ee Notice is hereby given to the owners 0 ey ing t t i ry and secretary.ol wen SOUL child is listless,cross,fe [property abutting on the Sidewalk Tmprove-aeere ca.eae in the Haith-|! verish,breath bad,restless,doesn’t ment District heretofore laid out by ordinancestil>;Alde ,cox line}thence wes to 158 poles to a dogwood,| i.counsel for Mrs.Warren,.under jeat heartily,full of cold or has sore!Lduly passed Pe ia eeenae oes G Barriager's corner;thence west 62.poles tence of death for complicityin the throat or any other children’s ailment,77.70,being,the aldewalkion|the Sekt side of1t Barringer’s line;thence eouth 80 eAee of her husband.savs he will |give a teaspoonful of “California Syr-|Piet Street from the intersectién of Davie ’.Barringer’s dives tlaniee ;coe ie of Figs,”then don’t worry,be-|Avenue v-ith said Tradd Street to the intersee-{€8 HS ire carr ae ae Judge FE.B.Jones.of,Winston-Sa-|::fe a 3 Our repair department.is the most com-ec ecieae completely equipped automobilo repair shop in this part of the State.Special tools and time-saving devices enable.us to turn out a job in much less time than the average shop._ Our mechanics are experienced and when you bring:your car to our shop you are not ees ik the Governor to commute the sen-Tradd §ad z m ltion of Water Street with said Tradd Street;19 to life imprisonment and he ap-cause it is perfectly har less,and in that said sidewalk has been paved throughout |less,“ex 1 1-2.acres conveyed to.trus- few hours all thi tipati hi 5 5 to th e t ja Tew hours a 1s constipation pois-|the lereth of said improvement district,as,tees Shiloh M.EL church,South. Bree Dewenabers not to cree eon sour bile and fermenting waste ided by the said ordinance ;‘and that the,2d sinning at white oak,Hoover's line,|against the woman.The ’provided by the said o ce;anc a 2d.i K, iw y report of R.L.Greenlee,.vity Engineer.was\and corner of Lot No.3,it being Bass -believes Mrs.Warren de-}willgently move out of the bowels,and ied with the Board of Aldermen of the City of,mer:thence S.88 1-2 degrees cust ‘160 poles_the-death penalty...but she you have a well,playful child again.|statcsville at its regular meeting A thorough “inside cleansing”is oft-"7th,1016 ould have a square deal and ‘her’|Notice is hereby further given that the as-!c :| re should he considered on its mer-ae eo ae is nent kG It should eeete for said work will be made by. “Indeo.Jones’request is reason-|¢‘the first treatment given in.ANY |Ronrd “of Aldermen,as provided by the churte s |sickness.lof the City of Statesville,on ry onight,| Beware of counterféit fig “Syrups.|Vebruary ith,1916,at 8 o'clock,at the office © en January.to stake,Lenta line;:thence S.39 1-2 poles to| i thence”north—88 s to stake,S.Hoov ihense with his line north 45}“st-to the beginning,eontaining 34| ye or les:rinning at black oak,near graveyard, 3 : Bich Point Mrs.Janie Child-|of the Bourd of Aldermen m the,Commercial 4 4 See eee .:vner,‘thence south 29 poles to stake,;.a z me Breet =e = |fred 2 32-caliber revolver twice:ASK your druggist for a 50-cent bot-|xational Bank building,when and where all! ariGe e thevies nouth 88 1-2 depres ‘paying for guess work and time thrown ;‘. A;G.T.amonds,both shots going |ttle of “California Syrup of Figs,”\property owners interested are directe |poles to pir Lentz’s line;thene .5 P ld.The shooting occurred in ‘which has full directions for babies,mnt stot ans Jif-any,why si jteath 29°poles.ta stake,Hoover's corner away for lack of experience.-‘We guaran- fer ‘sho.Mrs.Childers,a hand./chidren of ot aes ae rele Look|BY omer at the lard of Atlermen,eaeeeoe aomeyoungwoman,claimed_that.La-ips plainly printed on the bottle.Look;D.MOORE,Ciera and Treasurer.Ith.Beginning at a hickory,§.Hoo tee all repair work and make a specialtyof ee :a0 fh re:in—Bass line;thence south 45 4 poles to white oak,corner Let No.Eidson lot;thence south 8&8 1-2 de- onds_had jkeqn,annoying her withcarefully and see that it is made ee Jan,2116 ee =. She is separated from the “California Fig Syrup Company.”‘NOTICE TO.PROPERTY OWNERS.|:i!‘attentions.repairing lord Cars. husband,She says Jiamonds’pur-|'ier :x >IE DPTY ND |Res 5 ;;st 160 poles to stake:thenre north Coenofhercaused”the ‘separation from |*OTICE TO PROI ERTY OWNERS.Neues ef ae Reeth te he Soe ee les to stake,corner lot No.2;thence sro ths er geetes er husband andshe —determined—te+—notice is hereb property abutting onthe Sidewall._Improve-|ia),93 ..9-degrees west 194 poles —tobe=-B +}-#——22srebygiventotheownersofthe|rict “heretofore laid out by ordinance i Bier ceils him.Lamonds fled when the lady |property abutting on the Street Improvemeut !Board of Aldermen of the |#'0ning.containing oA Re ate less.'‘ai oO ina O or.omp ae1idSidewalkImprovement|hth,Beginning weewrstone™ta Hugh Ply-.t 79 eeotbusy..with her,.weapon.Mrs..Chil-‘ders’parents live at Davidson.NASER District heretofore laid out by ordinance duly sd by the Board of Aldermen of the City|1'striet being the sidewalk on the west side of| tof Statesville,said street improvement district |Muiberty Strect from the intersection of Water|thence south,36°.1-2.poles to stone;thence ee ;being Mulberry Street,between the intersection Street with said Mulberry Street t6 the inter-|West 130 polés.to stone;thence north 83 1-2 p .Wood Thinks We’re Openi°f Broad,Street with said Mulberry Street,und ‘cection of Front.Street with said Mulberty {Toles to—beginning,—containing—371-2-acres, “SERVICE FIRST.” the intersection of Walnut Street with said Street;that said sidewalk has been pa imore or Tess. ‘é to Attack.as ry Sivcet,that said atrect Has been duly|heeeenS ut the length of anid improvement dlis-|.6th.oe S stone,ne P.Morton’s Moor esville,.‘Statesville.Newton.¥::ait the length of said street-im-trict,as provided by the said ordinance;and ¢r;thenee wit iis and Bass’line north cy q¢provided b i me ‘aT ETT LCLEE ART SMa RA ler's line;thence east 130 {poles jo stone g Major,“Geperal Leonard Wood told!and that“the report of R.that the report of R.L.Greenlee,City Engin-es east 20 poles to’stone,J.C.Plyler's |ae he enate military committee that|!I,Greenlee,f-i Engineer,iki bed filed with |cer,is filed with the Board of Aldermen.of|co thence with Plyler’s line north 87 de-|———_—$—=pn —y -sonrd-of-Addermen-at-the-rexuler—meetines of-Strtcevilte at its reuler meeting-en-s west 60 poles to stone in—his Hf —oe mreeeWitynae.uid se Be ey 7th,ree Fa Tth,1916.).<Plyler’s corner;thence’with |FE "Ty ‘q,-otice is hereby—further piven that.the’as-e is hereby furtherviven that the es-tween J,-C.-and.W.D.Plyier south 35 7 Pp ti <ric ym Vy hi Yi :inizedforeignarmy,despite it:1 street improvement will be)cessments.for said work will be made by the to stone;thence with W.D.Plyler's lite!fac ice Cc 1S ear.aabuttingproperty,a rovid-i Board of Alde-m uipment of forts,mines and subma-“¢bythe charter‘zouth &6 degrees east 63-4 poles to stone,his}Me gua that the Oceans =by le,on lof the City of J 1 Frid:cht,or:the ,,:5 :: eer,oe the cerane formed no iday t,Februc Ry ith,1916,o'clock,TE‘6ae rz a ate 1916,at &o'clock,ra suka Sac :Eien Eee cae a,ae é ai ee s ae ee Se,See ae Berious’barrier to invasion,He de-jin the office of the Board of Aldermen of the of the Board of Aldermer tn the Commercial rer;thence .with his line north 84 le-|eed sar-or's an G S xe ee §be .red that in the country’s present |“iy,of ot a eae a the \Orn Taet a Nation-ional Bank building,when and where all)gy Past 50.poles to Gecinene containing e e «e <a ank building,when here gpert ry A tt are directc ap-mee ,¢g m, e of utter unpreparedness for War awners are directed to appear and chow cause,eaberty owner sted are directed to.ab-/10 acrea.more.or less.‘ce if ners are direct to appear and show cause,rand show cause,if any,why said ussess-Terms—One-third cack one-third i :trained force of 150,000 meh could !if any,why said assessments should not be’ments should not be made.BE ee reece on caesuta me tte Not screenings or offal,or ‘;:ene nade,pee er eae rarl Oem ine WGA ar rat tnd one-third in’twelve months.'r eee.me,=ee Ee By order ofthe Board of Aldermen.;{pa C.ey Voorn coe ‘Froanurer.Dee,21,9915 R.B.McLAUGHLIN,Oud Beck SweetFeed.worthless by-products,but Se-,arm $8e@ .|C.De MOORE,Cierk and Treasurer.Jan.21,1916:eye aa Commas iOnel:1 ]t d f dLittleNedSweetFeed.ected feed scien--Events of the European war clear-|Jan,21,110. ;‘ATICR T —pPRPT?AUNEDG:TRUSTER'S.S i}LADateerecteeknllte:NOTICE TO PROPERTY oWNen|NOTICE TO PROPERTY OWNER ee oman aff Manna ite Chick Feed,__‘tcaUly,Blended ee eae nen totice Bt ie by”RIV m tothe owner of the ss,:ae ae Sous Yaiore:Ba tyes encanta ty ,A.”Youn and ;:=ee Mage "t if ipped had apnea feted Calli,|abutting ova ae by malas amen Di ae‘:the Domed a ou RACES AUGS ;4 tentedC eS kiJive’Si '4 eeuve-the Gem Seratch Feed.DY a ouse wit hap . a single expediton of 98 |aeec nega aera Imorowernent (iat beingrecorded in ook 75,page 41,af|B_Tepe on ey ioe reconds of dees in the officeoftheReg||Gem Sweet Dairy Feed.integrity.tween the intersection o from nersection of Tradd if...of Deeds of Iredell county,N.C..default¥ainst submarines,mines and being Court Street,r id Court Street and the Street with said Water Street.to the interree-hterscreenofbarbed-wire|Center Street with lintersecti of retingg Stree ith aai ena tts :7 .‘iving been made in the payments of the in-:@ every available landing ute?eo oon Meet ee)tree Mh i eal Court ‘tion of Davie Avenue’with’said WaterP Street dite Iness.thereby secured “the Uanerese ed ®.Street,that said street has been ,duly paved that said sidewalk 1 heen paved throughout |.Mi erephasizinghisconviction‘throughout the length of said street improve-the leneth of {improvement district,as pro->*°tee will,on 4 |0Ca epresen Ivé. £troops cannot be improvised to ;ment district:and that ’the report of BR.1.vided by the said ordinance;and that the repost <SVTURDAY,FEBRUARY 5,1916,i {Greenles,City Engineer,was duly filed with +-¢R.+.Greenlee.City isnvineer Board of Aldermen at the regular meeting |the L of Aldermen of the Ci regulars,General Wood declared}filed with at 42 o'cloek,m.,tell ‘at public auction,tothe ‘Phone.125 Black. of States-bidder,at the court house door in Punaamenty!basis of any policy of|ae fecldipserdponWoanuarviqehnelo cae tit i ;’7 :;:4 ‘16..at its regular meeting on January 7th,sville,N.C.,ash,the 5 he =gate national defense must be the |Notice is here further given that the as-|yos¢“mS iva ville.ot ao ced hye er Colon.ae :peebiebnaies spencers beacheaeeeeoeee jsessments for said street improvement will be Notiee:i nieat : iereby further mziven that the as-Besinning ata »in the center of Brook- rid work -eili be rondo by the lyn treet 3ruc ‘leming’s corner -thence|4!A};T ‘readby,the charter south 22 degrees enst 265 feet to a stake,said }HANKE {]L FOR R DE!4 Fleming's corner,thenee north 42 degrees west :‘:e fect to a sinke in eentcr of Brooklyn ¢2 ba treet,Wits Mi corner,-thenee with center | is provid-|sessment i 8 DAC ok sey euffrage.goes an made against the abutting property,toh for military service.Such |ed by the charter of the City of Statesville,on frat or AleleyhadbeenadvocatedbyGeorge|ay night,February 4th,1916,at 8 o'clock,.-f the City ofton,he said,and if it had!the office ae ae wt ee '{:aa e e Commercial Nation-.rival Al i »Cr predadoptedCanadawouldhavebe-‘3;Rank building,when and where all property >;:prt rt of the United States in the |eted to appear and show eause, when ‘nnd where all af add ateeet N.62 dewrces east 186 feet to]{}1 want to thank for theic trade all who traded with <ine this year.Inedirectedtoape‘the beginning be ts ;:efearheanvemei|beginning,containing one acre.more or|1,the year which begins tumotrow when you need anything in the way 1812 d*“assessments should not be nd show =muse,if an 3‘seoneocooneemennntniamsnmnanmeer 1 nent o ";1 7 :ntlAt’\By,order of the Board of,Aldermen.ae “an oy the be made:Aldeirmen,haul ee id ae =soar ag Bt Jewelry,ae a ware moped ridg,eG oe wate ane on :Build New Radio Stations C.D:MOORE,Cierk and Treasyret.C.D.MOORE,Clerk and ‘Lreesurer.‘glasses,T want you te come to me. Jan.21,1916.21,1916.ne of the final steps toward linke |--si \a Se \ Bete vorcther by:arent chain}NOTICE TO PROPERTY.OWNERS NOTIC E TO PROPERTY OWNERS.THE BEST COAL!,R.F.HENRY ee Jeweler. pless stations:was-taken Wed-é Notice is hereby given to the owners of a Notice fs ay:when,Secretary Daniels of the tii oes Tae ie ee Faia orees fet ie vs e i hereby’riven to the owners of the |mutting on the Street Improvement ”}It ig time you are ordering your ——ae te Dae ee heretofore laid out hy ordinance duly i fuel for winter.The best coal for i TRUSTEE’Ss SALE.OF LAND.“NOTICE TO CREDITORS. ippr'roved contract with the passed by the Board of Aldermen of the City .by the ard of Aldermen of the City 4 :Having:qualified ‘as:“administrator of —the :élegrap Company ‘of San States .ille,said street improvement district 1 street Improvement distriet |General use is our celebrated .-BY VIRTUE of the’ppowers contained in alestate of 8.D.Moore,deceased,I hereby no-ws BCOyfor«Le equi ont of:the ving Broad Street,between the intersection of 1 Street.hetween the interscetion of.::deed of trust executed by M.L..Cowan ond/tify all persons having claims against his es-4 “i quipme C NC |Mulberry Street with said Broad Street and the Meeting:Street with said Broad Street and the 1G :‘J lj ;.|wife,Alice Cowan,to David J,Craig and the|tate to present same to me on or before the npn tla now under con-|oy ae a OL ete mile ot Col-recetion of Mulberry Street with said Broad}i renuine Jelco eee or.Live ‘maaians to.secure the it;PN,Gay.of Janus ry,1917.be ae ‘‘iy oat San ero Cal.,Cavite ste it said Street has been duly pave t:that said Street has t hl {debtedness therein mentioned,said deed of .B.McLaughlin,Att'y.Adm strator.as Wank 8 Cie ete Poapl ,He Saas aweait |jthronghput,a ne af e are pron izhout the rennet nt ao eee Powhatan Blue Gem aeshele sere fh TOON 35,hens 604,of “Jan.4,1916.Q \a, ?y paRees ¢and that the report o 5 i and)»that ihe.report the records of deeds in the office of the Peg)Sy SieSAEW AARON UEANTON MONE a A oer tion of:Riess erations owithin |Gremlbe,City Engineer,was daly.fled with |nitice?whee GUE:daa hth |Pennssylvania Anthracite ister of Deeds of Iredell “ounty,‘N.G.,deel)|‘EXECUTOR’S NOTICE.‘a :us t.year will pave theway for |';en a ge int ite regalat Piet teks Board at Aldermen at the reaular meeting:fpirlt nacing ther ay in ‘he payments of the!’Having qualified ag executor of Miss Sara,-i arte ef of saic dion Jar ith,1916,f-#=‘'‘‘‘omurmicxtion from Washing-|Notice is hereby Pere Mente Ja,ot board on January “ith,1916.|Run of Mine Steam Coal,.|]indebtedness thereby scoured,the undersigned|Smith,deceased,tkia ix to notify all perion® lotiee trustee will,7 who have claims against said estate to pre- Bate is hereby furtt e that the as-only to the.instlar possesssion sce wear evrWee street fhyprovement-owill ;ae wai ai veat eet wn be i |ne URDAY,ERSOUANS AS SUNG)TEE a ee eeu ta teetanypointin‘the world [ade against the abutting nroperty,1s provid-inst.the abutting property,as provid-We also handle Oak avid Pine at 12 o'clock;m.,sell at public auction,to”the }January 4,1917,,or this notice will be pleadeybeareceivingplant.[Feday night,Febru:the one rem ee ed by the charter of the Gity ofStatesville,on|Wood,and do all kinds of hauling.|highest bidder,at the court house door in/in bar of their recovery,All persons indebtedy5,at 8 o’clocks |Priday night,February 4th,1916,at,8 o'clock ‘Statesville,North Carolina,for cash,the fol-|(o,anid rained ill please make immediate‘in’the office of the Board of Aldermen “of the ii the office of the Roard of Aldermen of i Movik ig household goods a special-jlowing dedéribed lots,bowit:i.lpvedtlement..;4 z2lify.fEYhavejust|[City of Statesvilly,in the Commercial Nation-|City Mf Statesville,in the,Commercial”Ne Two \lota:Nos,7 ard 14,Block ©,of the ft:PARKS:Statesville:R-7, !Bank building,when and where all propert fal B ink a =good merchah-os here are dihectatto-a eC property tank building,when and where all pré (Cowley prdéperty in southeast Stutesville,60 Jan.4,isto Executor of Sarah Smith,)y appear and sh pin 3 hex ,4d SO eeNeaUa ee eee eeeeea ere aadeciment a ee |tial A eneeens afeet iP clone out _if y.why sald -Asse.seaeriti BOWIE.Bot!be|eeanys ae Siete FS SUnY,aeeee cote |Holland Bros.|ieee oy ples,ates aed te casepreterit ony “NEWSPAPERS —»All *you want It will poy,i jee We-thast 4 (made,{Depot ‘Phone No.7.‘apof the Cow es property,registered:in 10¢.«hundred,“Worth this to before you’buy,They |ART ecmn liaptdicgot By 0%‘Me,(it thy Board cf Aldermen,|»}Ml,couaty,ith,Also,good to put mde carpets and "ti bales ie Clerk and ‘Dreasurer.™ere‘D.OORE,Clerk and Treasurer,ot Residence:‘Phot No.310Bleck.ale 2 65.DAN at RAIG,the walls,;"toTHR L AND:” tee '5 ['bE ‘neJon,21,19 ee Se Yes ds :.manent aterebaatoes by:hapa dng",nani et ea”y's Work!_Clean|——Bowels’W ith “Dodson?s Liver Tone.” 's{spoonful and.if-it doesn’t straighten.you right.up and make you feel fineandvigorous,I want you to go backtothestureandgetyourmoney,Podson’s Liver Tone is destroyingthesaleofCalomelbecauseitisrealBBlivermedicine;~entirely~vesetable,when.it comesPie contact)therefore it-cannot sulivate or-make“hile,”crashes ainto it,you sick,;it up.’This is when you|1 guarantee that one spoonful ofawfulnauseaeehr|Dodgon’s Liyer Tone will put youryouareslupgishand=“ahi shiggish-—liver to work “and ¢lean|d.out,”if youreee,is.torpid your bowels of that cour bile and i ‘constipated or_you_have|copsstipated waste which is clogging i e,dizziness,coated tonzue,ur system {fd Makirg you tect breath is bad or -stomach sour,!inizerable.I guarantee that a-bot-try a spoonful of harmless Dod-|tle of Dedson’s Liver ‘Tong wit!keep n’s Liver Tone tonight.'your entire familv feelirg fine Zor-Here’s my guarantec —-Go to any months.Give it to your children.Iirugstoreandgeta50-ceyt totils)is harmless;docsn’t gripe and vheyofronnieiverJone.Take a dela its pleasant taste. done.of the’sty ight fod apne nuicksilvermercuryor"frones. EF Community Building. pebene PH.ecto MARK | FRIDAY,January 24,19)bg |THE TIVE STOCK MEETING. alert taes —ecmemenmaneni,Summary‘of the Programme oftheMeetingatSalisbury:rina Week,i Correspondence of The Landmark,? Complete programmes of the State},live Stock Meeting to ve heldin Salis-|bury January’-25-28:inehisive,havebeenreceived,and those especially in- terested in entering in’the ompnetss tion for prizes may receive one by in-quiry ef the county ageh A:briet yroutline-of-the-Ey oe eeenforthe.benefit of those who may.not.have the complete programme. Especial emphasis is being’placedt on.educational exhibits—poultry and; ooultry products,cured meats,ercam- ery butter,dairy butlers farm:butter.commercial.cream,market milk,full eream cheese,home-runde cheese,¢ot- tage cheese and on the bovs’and girls! stock-judging contest.The prizesaregéenerallyliberalunixinerules such as to induce exhibits and make the whole instructive ae.interesting. e Rien THE,CHILD,LA\LABOR BEL, Summary of“the WN‘Measure yap is Before Congress. The labor.committee of the,House of Congress,reporting.the Keating|. bill to regulate inter-State commerce in certain products,with the recom- mendation that the bill pass,made yy one change ef moment from the almer bill of last Congress,.whichisedtheHouseby4voteof235to ..fhat-is.the introduction of a sec- of-ehildren—below.the standard:ingi- sated in the bill,im mines,quarries,| factories and manufacturing estab-} Aighm ents from which goods are pro-| shinment /in_inter-State |>,shall be prima facie —evi-+fence that children were emploved in|whole oF in part in-the-productionpoods. The bill provides “that no producer,| manufacturer or dealer hint shin «qdeliverforshipmentin.inter-Stat commores,the prod:ict of any mine or quarry situated in the United States, which’has ‘been produced ‘in whole or in part by the labor of children under| the ave of 16 years;or_the product | “All prizes will he.awarded en the seore-card basis,criticisms of all products will be sent}; it each individual,so -products MAY wai f. entries.for™the) must.be in} than Tuesday| Prepay alli, Sallsbury, srizes are offered in each of be improved,All laniey products ¢ontest\Salisbury not later jnoon,January 25th. hibits and address to W. Three sed,and also.forFcuredhaconinthe home-made meat 98e,75¢. See window displav of these Shirts now on sale. SPECIAL PRICES ARE CASH. —_—PHONE NOs" RELL a.nee SHOE ee 1.50 Eclipse Shirts,Special Sale Price‘$1.00 EclipseShirts,Specia!Sale Price » “FOR SALE!+wrt 300-acre Aléxiuder Caunty Farm,near school antl churches,near- est railroad station six miles,fronting on both sides of public road,soil and location well adapted for fruit,grain and stock farming.Over two hundred fruit trees.Two-story,six-room dwelling,two tenant houses,barn and out-buildings.Well water- ed by branches and springs.150 acres in cultivation,generally level-and productive,balance in woodland which will cut over onehundredthousandfeetoftimber...Bargain at $17.00 per acre. ‘Seventy-eight acres one and one-hglf.miles from Statesville,ad- joining the State Experiment Farm.Forty acres in cultivation,level and productive,five of which is branch bottom,balance in woodland.Three-room:cottage,small barn,two branches,Well located for dairy and truck farming. For further information call on or write, ERNEST (.GAT GENERAL:{NSURANCE,RENT- ui 9 ALS AND REAL ESTATE.PHONE 23.OFFICE NO,1,a BUILDING. The Statesville Realty &cso cal==INSURANCE! As a great many policyholders do not.seem to know thattheir-insurance will be void:under certain conditions named in the contract of the policy which they buy.We deen it advisable to mention some of the causcs under which thesame will be renderedvalueless,viz:: =1—Vaeant-or-idic property for tonger than 30days—apply to— your agent for.permit.\2—Mechanics making additions to,or extraordinary altera- “tions in or on property—always get permits from agents. -8-—Proper ty upon which there is a mortgage unless notice of same is”given—apply to your agent.4—Any change inthe title or ownership,or interest in proper- ty insured other than by death. 5—Assignment or trans fer of proper ty to another. 6—By any increase in the hazard,notice mist be|given. 7—The-taking of other insurance without notice.; ~8—=Keeping explosives onthe premises without permit other ——than kerosene oi!.9—Property encumbored by chattle mortgage.; Policyholders should read lines 7 to 80 of the printed contract °---~of-their-policies,—_It_is_impossible for_arents-to-know-of these-de=—ficiencies unless notified:-Call on us for any INSURANCE infor- mation.“WE INSURE ANYTHING INSURABL fm? J.F.CARLTON,Manager, *PHONE 54.2 STATESVILLE,N : es 4 “¢ e C.. im woirht. B28 ounces per .ae;nuesas BliS vears of age who has ft-o'clock—-Wednesday;—danuary—2 i Jn jon exhibition will aid in Tearnin Bicred of Dairy products of four pounds | will become’the property of |tion of exsGov.Kitehin. entries Will!nq thatif t vidence from cotton man-| d ifacture dicated great atention: ciation,all other ‘ned to.the exhibitor.or eeted by the exhibitor,One per-| 1 moy make entry in several differ: ent classes exeent..that one entsering| market milk shall nae compete:in the mn mereiirial eream’class;3 or one en-oTatte shall not exhibit.mar- Exhibits of butter shall con- sol at Eetwo J=p ound prints.Exhibits| 24awree.separ ate pint.bottles of.cream| ‘He ee amijkioasts proviowt fonday mornmp,ard from a oss.than:three-cowa. ho?market milks te pints daken ye’'s milking.f “or apre-checseshalt~consist-ef aweneesofatjennonepoundeach| lmode from sour milk without reunet.| The competition onjakidean.exhibit ofiressedhen,best.con dit i ‘showing,commercial eg own and! i ‘and Grsts in 1s of the Amoriz then Anterican e exhibitswill be receeiver of single birds of 4h@ eae (White Orpingtons end iTangshans.The exhibits of An :and other than American shall consist 6f.a pen of fiye,oné and.four females.The entries of,¢ shall-consist of One dozen entered eording to color and graded exti firsts aecor to condition Extras weighing from.26 to dozen and firsts from4to26ounces.All-antiies in this evoup must be in by if o’clock Wed- y morn ing. eekre stock judging contest is open 8 any hoy or girl of the State under not attend- jed tho Agricultural Coll “PrZ ‘will be given to the bes ndividual fudge in each of these clasces—draft ‘horses,beef cattle,dairy caziie.sheep fand swine,Trophy cups will be By owardad to.teams representing the. f [arnt Life schools.The individualhvrizeswillconsistofsetsofbookson Bitive stock or of animals.of the class adeed,—Here—is-en—ex@elent—oppor- gitunity for boys and girls to ia some p exnerience as well as win a p:ThiscontesttakesplacebetweenndM1 Phe fr om _Monday st finished and 1 bird for| and of -other Also.separa} ne addition to the programine. iwhich has many features thet will he ief.interest to vou,there will veo sal |Wednesday afternoo.of nure-bred Ama eatile and “another Thorsday afternoon of both>pure-bred 'erade dairy cattle.Thes jefford:an excellent oppor for {lcarniling the values of good live sto! Bins judged by those-who-wre-< “of tarminy,~~Tire—his”£V7 Fandtheplacingofthe:icontest yal: u :|noints of the animal that are con most value from the stan noint of the breeder and produ i i Bring out your products and make this a short course in live stock farm i ito be useful-in your own commun \A little study now a make work easier and more produec- will enable:vou to itive in the future. |For those whd eannot,attend and BY ONTARIO expect to make exhibits twill aid—y oi |Certificates of Deposit Issued by this bank bear interest from “date at the rate of 4 per cent per an- num.Savings Deposits 4 per cent, ‘credited quarterly.i" ‘Checking Accounts either large or small cordially invited,: We want your business. ph q People’s Loan and Savings Bank, OFFICE RS:,2080 H,BROWN President. Cashier. in getting them there and broperly en- itered.or for those attending will aid jin getting comfortable quarters reasonable rates.Any other informa- ‘tion you may need,just let me know, | atat ‘as T pm ready to Serve you the best:G.E,DULL,|possible.County Agent. |Payment as An Act of Grace. President Wilson has asked Con- igress to appropriate $42,080 for in- jdemnities to Greece,Austria =Hun- rary and Turkey on account of inju- ries to their subjects in the South Om- jaha (Neb.)- riots-ony February 21, 11909.He and Secretary Lansing join- ed in asking the appropriation “as an act of grace dnd without reference toitheliabilityoftheUnitedStates.”iThe smounts recommended ate $40,090 ito.the government of Greece,$800 ito Austria-Hungary.and $230 to Tur- |key.|Secretary Lansing says in his|port that approximately 1,200 Greeks, ieee dziven from the city during the |,Which grew éut of the shooting lof a policeman by.a Greer whom the,|officer had arrested. \LTI OT EE TSO FE Bad Cold Quickly Broken Up. Martha Wilcox,Gowanda,“LT fitst used Chamberlain's CoughAtthgttime || |Mra,|writes: ‘Remedy about eight years ago.I had a hard cold and coughed moat of the time.It proved’to-be just what Tt needed.»It} broke up the cold in a few days”and.thekeoughentirelydisappeared.T have told ‘thanyjofmy.friends of the good I received through{using thid medicine,and all who have tet tt‘BB speak of.it ino the:highest terns.’Obeninahte | »Neyer:: ithe classes of dairy products mention |o'¢]octhecuredhamand) shall consist af three poultry will in-| each |t <fouk andi> sales will,‘ id- re- N.¥,! of any mill,cannery,‘workshop,facto-| ry,cr manufacturing establishment | Scores—and-judges"|sthioicd inthe United”States*“whieh! bas been |produced;in—‘whole-or—inj by the labor of-children -under|ithe age of ‘14 years or bythe labor ‘of children between the ages of 14} years and.16 years who work more! €X-lthan cight hours~in any one day,or Eaton,Tiaore than six days in any one week,| por 7 o'clock.post-| hour ofafterthehourof. imeridian,or before the ante-merdian.”In the report much attention wes ziven.to the testimony offered —for} Southern eetton’mills uacer the direc- It was.stat- are of employes,although} made by .these in| Carolina that they permitted children under 12 years of) inwe to work 11 hours.a day,while ini |Nor th Caroling there is-no factory in-| tgspoctic on,| ;to the petitions from ‘mill op-} eratives which had been trahsmitted|to.the committee the «report:.stated! }seomod “vor y elear in the tes- ecahy touawo!Mr.David! r of 9.textile -vublication| to the wé admission was North and South =oh. wiotte,;that these petitions were ed under a,mis EEERA RACE the | antement obtaining an jehat the bill contained 2 “PG-year imi?Leer employment”of chitdrenin-tacto-+ ries.=2 | Omer se ens at ee tetON aR sville Reeord:Austin.Fost er,| armer-ahout.20 years:old,sin.Iredell county, ine,was arrested in Winston! ed with the larceny of, Mc a youn? uw ho.liv Davie 1 IE.AT.WITHOUT FE AR OF DIGESTION OR SOUR, ACID STOMACH! nstant Relief!,“Pape’s pepsin”Ends Your Stomach Trouble Forever. Wonder.what.upset --Which portion of th damage--do you?W er.’Jf yousstomach is in a revolt; if sour,gassy and upset,and wha you~just —ate-—has—fermented —into: stubborn lumps;head anil) aches;belch gases and f and: ‘eruetate undigested food;,breath; tonrue--eoanted—just take a—lit- stomach |theyour food did tion providing that the employment; mm Your cares inEonitor e-Mothers ing the aches and painsefthefamilyfromyouthtooldage,are lessened _when you use this old and trust-worthy remedy—«© Sloan's Liniment ;Ska ee Mothers:“Keep:a bottle.in your home” my Price 28c.,50c.and.$1.00 fe } pe s r s mn Bo o o o n n HO SeeTCOE Gorham’s Sterling Siver |: R.H.RICKERT.-&SON} Ts all that could be desired,We havé it in Knives,Forks and Svoons of all sizes andin -gev-.. eral Gifferent designs,at the ag prices.We_have Catalogues and price ne ve will es glad ‘to give you, TEWERERS: ,don’t both-|& ile Pape’s.Diepepssin and in fiye ran | ‘utes you wonder what became “of the | indigestion and distress. Millions of men an know that it is need stomach:A—little.I sionally keeps this delieate o ulated and they cat their foods without fear. If your stomach doesn't of your ral Jimit without lion;if food is a damage d women todayHayPeaDaa Xa.:favorite lib your so est,surest,most—harmtiess-retief—ts Pape's Diapepsin,which fifty cents fora large case at drug stores.It’s iraly wonderful-—it—di-/4 ts food and sets things straight,gently and-easily that it-is really, istonishing.Please,for your sake, don’t:go on and on with a weak,dis-! ordered stomach;it’s so unneces: c take-care+} rebol- 1 of a help,remember the duicl em.i : ‘Lyyyft i 3“ it eecostsonly) t SSESTIITISII7F /Commerccial National Ban OF abdleobatsaS ey N.a et 0031,500.00... rks. Capital Stock.Paid in Surplus and Profits ScuatsetSMembersofFederalReserveSystem.“ Your Baniking fisire solicited and BeKe“every accommodation extended.to de-. positors consistent with prudebank- ing methods. Four per cent.paid ontime andsSavings | Deposits remaining on deposit three months or longer. Sa OFFICER “W.D.TURNER,“4.MORRISON,D.M.AUSLEY,=G.E.HUGHEY,-canta Cashier, Prrterttressetsse testessessess ay' 7 “Roses,Nareissus,| Hyacinths Three lovely Elowers inbeautifulBloom,ready to|be sent out.the moment your order reachesus.OurGreenhouseandstorehavetheappearanceofsummer, and leen you enter theseplacesyouforgetthatthe weather very ofteniis play-ing around the zero mars.We have choice Flowersthroughoutthecoldweath-erin as beautiful variety as summer.Ours is.aFlowerPlantpreparedtoserveyoutheyearround with the utmost satis-faction. Yak Lindley (n,|= GREENSBORO,BH.9, Polk Gray Drug Co Laecal ‘Agonts. . |. { |ADVERTISERS will please bring! \change of copy early.No change of! ips guaranteed after 12 oreloek to-| orrow,>| fe s r e ee e s 7 Soo TsetSses it TEFET ITT VITeT SITSTSBSISTTIISISSIISSTATIONE 5 coe-YOU SHOULD SEE-OUR ~RS DISPLAY OF QUALITY STATIONERY.) By the Pound,his Box and in Correspondence Cards, All the newest designs and” colors. ete le Drug Comp’vs Quality Presetintiontsté: ‘SteTeessesece sessosssTITITI Tt StPIsIzIFIF TIITTITTSTTTT OF es i s .SPOTS ET eT Teeeee esseseo ieee } Timber Boundaries! We are in'the market for STANDING TIMBER. Write or phone us,+ 3;0YCE LUMBER CO.Geo.H.Myers,s PHONES:QEfige ‘ce and Manager.. RESIDENCE eee That’s what I always try to give.‘If nob ‘satistied.call again..Timeis money,Why not buy yourself some for 1916.Ihave time from $1 CO up. B WOODWARD _ pe n s Beeocw a te.Oke Ol PU ag Saeco coset ata yin herrea eran tSMONDAY,JANUARY THE 24TH, AIND CLOSING ©|| Saturday,January 29th.Just 6 Days Duration.| :nen nego:aah {J We have in stock quite a lot of broken suits,odd pieces,ete.that will ue| be marked down in many cases to ONE HALF REGULAR PRICES. \ A substantial reduction on everything we carry.in stock.aa ERMS OF SALE CASH. _~~NO GOODS CHARGED AT REDUCED PRICES.| ‘We intend making this’a great money saverto our customers.Come._ and be convinced.Se are.=es : Globe-Wernicke Book Cases,Talking Machines and Records are ex-We cepted from the above sale.ee Respectfully,seh re Statesville House Furnishing -Company. Paneaee a By a TES THE LANDMARK yers are responsible for the failure of I justice..Peiene ee er any 1,1916.But.talking about lack of courage PERIDAY,levatl on the part of newspapers to criticise |. judges,it does not lie in the mouth of AFTER JUDGE BOND.b law to talk about | = |OPORTO TOO :one who excuses mo pon courage.Where is the courage of theHisFailuretoEnforcetheLaw|(omge oon?It requires no cour-| Cited as An ‘Excuse For the age on the part of a mob to take a/ .Goldsboro Lynching —Some|negro from jail and kill him.The | *\Remarks About Courts and|members of the mob know there is Sa not one chance in a thousand that they | Lawyers and Mobs..will be called to.account.But the, >The Wayne countypeople ‘who make|white man,who has influential friends | excupe for.the recent lynching in that |and connection,who is almost certain :s to escape punishment,or at least the OB O E RU I B U E S } =AT : MILLS &POSTON’S STORE. We have collected from all departments of our store many Remnants and broken lots of ‘gounty seem disposed to make Judge|"vhmnent he deserves,‘for his of-desirable Merchandise,which we have put on sale at great reduction in price! ;‘hha ”y :°e °e,°e : Bond ‘ithegoat.”:A.Goldsboro law-|fences—when do you hear of mobs Dress Goods,Silks,Ginghams,Outings,Suitings,Boys’Hats,Caps,Ladies’and Chil- yer,writing.the Raleigh News and |executing the-law in a case like that?||.ed :3 :4 - Dbserver,says that at a recent term|You don’t hear of it,The mob sei2-|e dren’s Trimmed Hats and all Fancy Millinery,-Ladies’Suits,Coats,Skirts and Silk Petti- ed .;;:the def less—the class wh ;.°.°= of.Wayne.court it was in evidence,|¢sthe defenceless ene nished if left |B coats.A splendid line of Ladies’Silk Sweaters and Scarfs that sold for $5 and $6,will ina homicide case,that’the defend-to the courts:Wh bs_tak.:°°°°°.> _Jant followed his victim,a considerable iio exectiting white oe ees ai be included in this sale at practicallyhalf price!Just the thing for_early Spring wear! distance and’shot ‘him down;that the are almost certain to escape if left Rugs,Blankets and Bed Comforts—all these lines are included in this Remnant Sale. +,.!to the courts—then we'll believe a 2 i “defendant was allowed to plead guilty|oy has some concern for law enforce-One case good quality Apron-checked Ginghams at 5c.per yard. manslaughter and'was given two ment——but not until then.- *‘Svears on the roads.In another case |:See taEe |Y a ‘:; ,ones on ————ours TN TT T TC aa ‘ vat the same term the defendant,who Warren’s’Break Ma Hurt :.cay &z Cc):Cc)RE. -eR cruly,1 .oF =hs?c IN nf TE E S TE E S { «had at his victim from pie Judge Allen.| “wasallowed toentera plea-of-second-}—aoe eee cept degree murder and got off with five The North Carolina —delegation—GOuasPi CASHRASMUSSEN NTN except Congressman Doughton,who pom wes shat of a negro who had eee eee nereg Pres THE ALEXANDER.BOYS,to be but the beginning.The rhedelt FEEBLE,AGED WOMAN . aiyears.A third case at the same +:So illed_a-white-man,shooting his_vic-ident Wilson by appointment at A ::°°o- tin -ty the back.He was save White House Monday evening to urge oo _boy hasa long life before him.If he Ss d h D t ‘i the sok by the He was aes from,the appointment of Judge Allen to the The Iredell Alexander Who spends it all studying how to make Says Vinol Made Her Strong ‘an WIC ain 1eS tee a ey tee ofthe court to the Supreme Court bench.The Congress-"Grows Corn Surpasses|the his farm richer and-moro.productiv Grand Saline,Texas.—"T am anaged|p ==ee jury was a clear direction not to re-men were accompanied to the White Alexander Who Won_a Base-he cannot hope to learn mere than a rand «if long time “was weak -furn.a.first degree murder verdict.A House by Col.P.M.Pearsall of New,304)Ghamni :a -Base-stall part ef the lore that is there bad feobleb eVir I restoredmy health When you want some- “verdict of second degree murder was Berne and Mr.T.D.Warren of New ball Championship.for the seeker.But if he so spends it 8 ra oth 10 that I feel almont young thing for Sandwiches é returned and the.sentence was 24 Berne,the latter the chairman of the Greensboro News.his.suecess will not reach one high pin-await eee doing all my housework.,Ly * “years,subsequently reduced to 20,Democratic State committee.Tt the:We wonder-whelher it will teritate naele and then.decline,but will stead-Ofq'people who are weak and feeble --—WE HAVE—-——ESR : “Phe lawyer who wrote the News and talk of the delegation for Judge Allen o oo et will irritate jty mount upward until the day of should rs Vinol and know its merits as Deviled Ham.” Miikeategr-cides rot_neme—Judeo-Bdnd Chairman Warren,according to the the Statesville Landmark for us to his death.And when he disappears Ido It is the best medicine to create P d M . as the.presiding judge at this anne Washington correspondent —of.the COmD ate Erwin Alexander,of The from among the living he will leave,aeeenigth Pid for chronié colds 1 have otte eats, Spat from anether-source it is learned Greensboro’News,told “the Presi-Landmark’s county,to Grover of the behind an accomplishment that ought’ever taken.’’—Mrs.FANNIEE.RODGERS.Date Nut Butter that he was the man and it is charg-ent that in addition to being a fing S2me surname-At any rate,Erwin,to endure as long as men till the soil)~“Vinol,our delicious cod liver and iron Peanut Butt ; ced by another writer that his charge lawyer Judge Allen was also a good if he is a regular’boy,will like it.To in Iredell county.He may never have’tonic,is sold on our guaratieeto benefit é utter, re jury in the case of the negro Politician.The President looked sur-2°?oe the con oy OOP eas a oe applause of eae and his!or your money will be returned.Olive Zest,x :i who had killed a white ;rised.but said néthing.At this o>spectecmar an.achievement 25.picture may never be in all the papers;|2 :ae .a °:P ‘was saved ue .ae He he ain Representative Britt changed snatch the world’s bas<-ail champion-but neither will he ever know the emp-|-F.Hall,Druggist,Statesville,N.G Sandwich Olives,* SuSE that he would be properly pun-.the subject by interrupting to pay ship,but the qualities that are requir tinegs of a suceass that brings no good |Pimentos,etc.:‘ ished,was a stronger appeal for the Judge Allena tribute as a Repuvlican ca ote 1 conve Berne the same.“Each to-any one but_himself."—’PHONE 89 arena than his counsel made.|m yee of the delegation.”Son ae heen out ater than aoe Batter ~ e lawyer -writer takes a fling at.She correspondent says this re-00 tne BECO Oe ES r than (Gas Frony Storage Battery Caus-|°}FS oe eT eea bi .Ab ne ~‘anybody else could do it;and by com-x ‘mis :|Milhi ll d the newspapers for not criticising ™4tk of Mr.Warren,which was con bining SekIn work with muscular ef-ed Submarine Explosion.|Kagle &oland. er judges for failure to enforce the law sidered a bad break,caused much talk ,sie f :‘: “aid intimates that .the papers are 2d it is feared that it may hurt Judge ‘°!t each achieved his.end.Can any:Gas generated by the new Edison more be said for Presiden:or bishop,storage battery and ignited by a spark “afraid to criticise the judiciary.The Allen.It is not customary,in urging oo oral,ot foatik ce | oe of course\)doesn’t read the appointment of judges,to mention Cr renerate reany ee whom the of unknown erigin is held responsible Takeoff yourHat toThe Myers!” Landmark.If there is any one politics,but evidently Mr.Warren world calls great?:for the explosion on the submarine DEST PUMPON EARTH.‘a ‘thing on -which this paper talks thought that political ability ‘and par-But Ervin Alexander has an added -2 at the New York Navy Yard Sat-|nt an eng pap:F list h spe ::|tb 4 “atraight’and clear,we think it will he ty service ought to count for these distinction oye the great pitcher.urday,ina report to Secretary Dan-,AUes itted shee it is the failure of the one of ME a of other offices.ee nee See ay ie pin-jels iby the board of inquiry.This oe ;ane dges and the courts to enforce the.!f Judge Allen loses,however,some \f,.»of fame.He may hold his own vestigation was preliminary to that!Don’t overlook the fact thatati w.This paper has again and again Of his friends’may blame Mr,War-for a few years,and gain adulation now being conducted by he.naval \root is the best roof you caa ite H.:an charged that the failure of the Tn.of baseball enthusiasts and mucn mon-court of inquiry to determine ~the.any bd dir We do all kind A éourts,which includes juries-and-pros-os :ey.But sooner or later his glory is cause of.the disaster,in.which.five on any building.We doall kinds ééuting officers as well as judges,to’po ohigang bound to decline.Another will rise to'men lost their_lives and.nine were se-of sheet metal work. enforce the law.was responsible dc Glenat Wo tern Wet there 1b TS icant reall pias)Dar andhe will be forgot-|rigusly injured..As only one of the)St t ill Ti (aye wiessness and lawlessness includes,0né ee disease that science ‘hus |‘©?eva :the world will be no wiscts!survivors Was in a condition to testi-a CSVIe In 0.:ern lynching.been a eto cure in al}Its steees,and that "0 richer,no happier becax:s<ne lived fy the-report is regarded by the Sec-‘OHONE 65 Don’go through 1916 without In the f:f th :s Catarrh,Hall's Catarrh Cure is the and achieved’eminence in it.Grover retary as i lusive is 3 ing inaM P Com-e theface o e courtrecord cited |only positive cure-now,known to the |Alexander is t iy his li i er retary’‘as inconclusive..‘putting na yersrump.Vom 9h Malis Galdaboro laweyer,its not sur-|mmrateae fraternity,Cararth bela 8 con:je eTinata man.ean follOW tha eeteavon waveakepositive:assure!4490.Di plete stock on hand of pumps : 18 that the Wayne folks offer)tutional treatment.’Hall's Catarrh Cure to.the sort of s ad h ra y OW the explosion gave the positive-assur-|4x20 Dressed Bucket Cedar Shingles!and repairs forallmake jumps.ee . the failure of the courts’as an excuse |1*taken Internally,acting d'rectly upon|of success that leads not'ance that the Edison storage battery Headquarters for plumbing and for taking the law in their own hands;|the,blood and mucous surfaces uf the Only to flattery and personal fortune,‘was not at fault The same,Cedar your,water bucket q A P BEOE ‘ haan .5;system,thereby destroying the founda-|but to substantiz iev hie eee ee ite acco hasta ;py .wator supplies..sale é it is,not surprising that they.lack’t t tt tial achievement for his}is made of.Government statistics ’i fidence in the courts.But one ‘won-tlent Critengih br buitsing “uh the pa-icountry as well.as for himself.|The city cotincil'of High Potnt.has|show.that 63 per cent.of the Shingle W.B.MUNDAY.Phone 55.~. how much this Goldsboro law-Sa work.the mrunitars har tn doing ‘at ah pene eefirst |voted to reduce the cost of electricity roofs in the United States are of Ce-eT ls r Rad .}.1 ye Ss 2 °ar .1G iG *.’i: yho comp ains that newspapers!faith in its curative powers tliat whey og Phi doladead peal aiees that!to consumers from 8 to 6 cents per dar wood,‘They won't crack norsplit.NOTICE TO CREDITORS,P 6 ne ert 4 judges;-has done to|offer One Hundred Dollars:for any cane +,hates “a hi #a swift years |ilowatt hour,C2.WATKINS,Next to McElwee’s)roving qualified.as administrator of the es- ‘eeenoiy ti 1 ridges of justices;tectimontals=to ture,Send for list of,-re e has.showed Iredell |SS Planters.Warehouse,Statesville,N.:C.|tato of Mrs.$.°B.Moore,’deceased,I horeby ine to get his lo.Address F 7,CRENRY &°CO,,Tot jeounty that 81 bushels of corn can be|Granulated Sugar at.SMITHEY &=duu (notify all persons having claims against said Hp him;and whether "0-5.21)peuseiate,98 7 ean On eae of e Sprat SN8-A|FRALEY’S for $1.65 for 26 Th.bag.BUILDING?CG.WATKINS.fertnte:tepresontsametome On er eiD oy asi r Sold by all Druggists,Bo.f success ?ell,perhaps,but/2 Ibs,Jackson Square Coffee,roasted)Beenie Gl ra|)RB.McLaughlin,Att'y,“Admii ‘ye uch the law-,‘Take Mall's Family Pits for constination.success,all the same,And it ought and ‘ground,for.only 25c.—ad.BUILDING?.C..WATKINS.Bet Meterne A ev 4 de se ag x a “bombs -were—dropped--by——the rere—— STATESiMetagmistaontea 1 iciorenanntetenSVILLE,N.©.,TUESDAY,JANUARY 25,1916, —————————ao Damage —Inflicted-—~-Fur-her Austrian Success in Mon- enegro—War Zone News. Two German air raids on the coastofEngland;the capture of Monte-egro’s two principal seaports by.theAustriansandthetakingbytheGer-mans of trenches from.the French near Arras and in the Argonne for-est are told of in the latest.officialcommunicationsof.London,ViennaandBerlin,=First one German aeroplane and 12€“Hours Tater two German”seaplanes +flew-over_and-dropped:-bombs-or-thecastcoastofKent.England.’Nineaero-plane,One man was killed and two -men,one woman and three’children were ‘injured.Some.damage -was done to property.The raid-of.—the seanlanes was without effect,appar- ently,the London war office declaringthatnodamagewasdoneandthatno-easualties had been reported.The air-craft in both instances escaped,al-though they were fired upon by theBritishgunsandthesedbyBritishaviators.: Antavari and Dulcigno on the Adri- atic coast’of Montenegro,have fallen into the hands of the Austrians,whichleavestoKingNicholasonlyafew..miles of front ‘on the sea and gives to“*-the Austrians command of:the’coast ~from the Gulf of Triest virtually to *the Albanian frontier.- Vienna reports that the Montene- grins continue to lay down their arms and that in addition 1,500 Serbians have surrendered in the past fewdays.although a semi-official commu- nication says that a considerable por- tion of the Montenegrin army has de--clined to-surrender and that _fighting -has been resumedmountaindistricts, Heavy fighting has been in progress in’France.a French advanced posi- tion on the road between Arras and Lens being attacked by strong Ger- ...manforces.The infantry attack was preceded by mine explosions and w violent bombardment and the:Ger- mans captured a first line trench on a.front of several hundred yards.French counter-attacks were immedi- ately inaugurated and a_portion of the captured trench was retaken.TheGermans,however;at the close of the day,occupied about 200 vards of.theadvancedtrenchwhichformed4sa- in the -..Hient-in:the French ines.<The British forces’}in’Mesopotamia“™goinr to the relief of Kut-el-Amara“are being hampered by bad weather,nevertheless fierce fighting with varv- ing,success is being indulged in withtheTurks.General Sir Percy Lake, the new British commander-in-chief, reports that the casualties on «both‘sides have been very heavy. The Russians are continuing their advance _againgt-the Turks -in--the Caucasus.~Petrograd-says the Turks fre making a preeipitate retreat intheregionofErzerumandthattheRussiansarecapturingprisonersand ammunition and other supplies.The roads are strewn with Turkish dead.The Russians also are on the offensive‘against.the Teutons south of Dubno. THE STOCKHOLDERS M EET. Annual Gathering of Corpora- tion Shareholders. —=—Phe-stockholders-of the-Statesville- Buffalo Shoals Bridge Co.met in an-nual session Friday at the Commer- cial club and heard a very.gratifying report from its secretary and treas- urer.The company is~now out-ofdebt.and its toll brifge over.the Ca- tawba river is earning a good profit.A 6-per-cent dividend,to be paid Feb-ruary Ist,was.declared..The stock-“.+holders-re-elected:the following board. of -directorss Osborne”Brown,C."Vv.Henkel.Wm.Morrison,L.B.Bristol, D.-F.Jenkins,D.M.Austey,-Eo B:Watts.Isidore Wallace.N.B.Mills,R.V.Brawley and G.&.French.Mr.Henkel was re-elected president.Mr. Brawley vice president atid-Mr.Brown secretary and —treasurer. tion of the sale-of the bridge to—thecountywasleftwiththedirectors: _...The stockholders of the Ramsey-Bowles-Morrison Co.held their aniu- al meeting Saturday night.in the of- fiee-of-the company’s store on Centerstreet,The reports of the officers showed a very satisfactory businessthepastyearandtheusualdividend was declared.Directors were re-elect- ed-as follows:M.E.Ramsey,J.-F. Bowles.C.8.Tomlin,J.C.Fowler, A.P.Barron.W.A.Thomas and W. H.Morrison.Mr.Bowles was re-elect- ed president,Mr.Morrison.vice.presi- dent and manager and’*Mr.Ramsey secretary and treasurer, The annual meeting of theholdersof.the * Stock Co.was held last week.Satis-factory.réports for 1915 were heard and the preserit officers were re-elect- ed. stock) Income Tax Law is Valid. The United States Supreme Court has upheld the constitutionality of the income tax,Chief Justice White an- nouncing the decision in.the case ofthestockholdersoftheUnionPaejf- ie Railroad Co.,who had sought to en-join the company fram paying the.tax on the ground of the unconstitu- tionality of the act.‘The point thatthe.'statute.was —unconstitutional be-cause labor,agriculturakand horticul-tural organizations were “exempted,was held to bo,answered,by the decis-ion under the!corporation tax law. In Steele Creek,Mecklenburg coun-ty,the barn of \C.B.Kimbrell was |ea with four horses,five’cowsandalargequantityoffeed.Origitoffirewehovh,chan Cfgt fierce}... The ques-|_ Henkel-Craig Live’ Southern Power Makes Final Proposition “a the Southern.Power Company,ha ence to the proposed bridge across thCatawbariverat.Lookout.In a lettetoMr.N.B.Mills,chairman of th hoard of Iredell commissioners, Lee says:«“The Southern.Power Compan of erecting a steel ‘bridge across th ‘Catawha river’below “othetanyaa 000. the:Southern Power Company, grade the road to the bridge on eithe side of the river.In making thi agreement I am actuated by th friends in your county and in th my company should contribute thi ward the construction of this:bridge in the ight of the ciréumstances,a be asked to:eontribute toward thi bridge.We further understand tha this bridge wil]be free to all and no open for,80 days,subject to the ac county.”This is the final word Southern Power Company,The Land mark is advised,and unless the com missioners of Tredell and Catawba ac bridge with the Power help.There has been talk,The Land mark is advised,«that the river,ete.,etc.This paper knows no thing about that,but it that forcing.big corporations, side,entails long and expensive liti gation if they choose to resist; something by it. hav:Catawha.as we understand it, would pay a third.The.difficulty i other bridges.Private citizens put*up the money and built the othe the public benefit,will naturally ob another -bridge,which would be fre and would naturally cut off busines from.the—-bridges They are willing to sell these bridge suggestion has been that the countiebuythemand.continue them.as.tol but it is said-the lawv.does not.pro vide-fora county _operating-a tol bridge,—It-is_much to:be hoped tha nothing...All the bridges individuals.Soe A Change at the College. been in charge of the departments 0 domestic science and art _at~States ment ond:Miss have chafge of the denartment.” Miss Henkel.who is assistant su nerintendent.of schools,in charge o domestic science work,has Monday of each week.This day,which the-col lege pppils have off from-regula studies,she will give to.the work a the college, the teachers of the county meet:a thetollege,they will be given instruc tion>there, and Shelby. Mrs.B.F.Long left yesterday fo by the members of the “Committe of One Hundred”today,Mrs. being:chairman of the luncheon com mittee. of the “Committee of One Hundred, zation to further School movement.the Moonligh From Charlott Women’s Clubs,being a “member o tion. Planting Shade Trees. many shade trees.on ©the willow oaks,alias water oaks—whic is most commendable work. the trees planted a year or two ag died and these are being replaced an others put out.The trees should b times children and thoughtless growfolksdestroythem.:*A:shade,tree othestreethasahardtime‘until it i to Bridge Across the Catawba. Mr.W.S.Lee,vice president.of made a final proposition with refer- Mr. will agree to pay one-third of the cost Leekent. point tobe selected and" agreed unon,provided that such one- third-shall -not-exceed-the sum-—of-$5,- It is my understanding that in arriving at the amount to be paid by that conerete piers,abutments,steel work rand roadway shall be-taken into-con-sideration,and that each county shall strong friendship which I feel for.my county of Catawba,but.I do not think sum of money,oF any other sui,to- a toll bridge.This offer will remain ceptance by the county commission-ers of vour county and of Catawha from the cept the proposition.there will be no company’s|and the average cost was 43.4 cents company could be forced to build”a”bridpe-on account of destroying the ford of the does knoweven when you have Jaw and right on your and they don’t usually choose to.resist un-less they think they can accomplish The commissioners of ‘Iredell and practically agreed to pay a third each for this bridge if the Power company in the matter of iolls and with the who bridges,with no hope of gain byt for ject fo the counties helping .to build now in.existence, to the counties for less than cost.One bridges until the tolls pay their cost, arrangements can be made to®build the new bridge and at the same time take over the other bridges so as to protect_those—who-put up—the-money for them when the counties would do should be free of course,but they should not be}‘ free at.the expense of a few private Mrs.Jno.C.Wakefield,who wad ville Female College,has’had to give| up the work on account of her health. To fill the-vacaney Mrs.R.E.-Clapp has taken charge oft the.art depart-Celeste-Henkel-will domestic science A model kitehen will be|town,5.C.,fitted up there and onee a month whenJ*tion the call to-the Mrs.Loneg’s Visit to Charlotte Charlotte to attend a ‘luncheon given Long Mrs.T.W.Lingle,chairman has called this meeting for the pur-pose of forming a permanent.organi- Mrs,Long will go tomorrow to Shelby to attend the annual council meetingoftheNorth\Carolina Federation of the finance committee of the Federa- The city authorities ard@ setting out streets— Many of nurtured as much as possible the first,be unusually T¥ge,year,or until they get a start.Some-!are 19 prisoners in jail awaiting trial. big enough to in a way es itself,vat Amity. THE RIVER BRIDGE AGAIN.|A ROWAN BOY THE WINNER Company Same Family_Leads ‘in Corn S|Growing—Result of Boys’ Corn Club:Contest. Ledford Hall of Rowan county;13 years,old,won first prize in the 1915 e|Boys’Corn club’contest.He producedr|141.4 bushels of corn-on an acre of ejhis father’s.farm,five miles fromSalisbury.The cost of production was $16.98,of which $2.41 was spent y|for_ferilizer.The average cost per bushel was 11.2 and the profit wase{$125.46."Young Half’s brother.Dud-sen Hall,won .the championship.in, The winner of the second prize’inthecontestwasJohnHughWorsleyof ocky Mount,Edgecombe county.‘He raised 143.5 bushels on his acre at a cost of $50.32—-84.17 per acre.While his production was slightly in excess of young-Hall’s-the-cost was “morethanthreetimesasmuchandhedidyjnotkeepacompletehistoryofhis sjerop,hence his second place“in_the: e|{contest. As a result of the work’of the e|Boys’Corn clubs during.the year 1915,reports sent in by the boys shows|that 70,040.4 bushels of corn were pro- duced by the 1.308 boys.reporting.»,|Fifty bovs made 100 bushels.and gabove.The average vield of these 50 8 we have made other developments in}boys was 111.7 bushels per acre.vour.county.which will of necessity be of great benefit,and we should not As an indication of the interest of the boys this past year,37 3-10 per s|cent of the boys enrolled reported, tiegainst 21 3-16 per cent for the yeart}1914,an increase ‘of 16 per—eent for the year.Ninety-five out of the 100 -jcounties in the State had boys enroll- edyin the work,and 88 counties out of ‘the 95.sent in>reports.-The-12.—-re- maining counties of the Staté fromwhichnoreportswerereceivédhad-|only a combined total membership of ii.: -|‘The average.yield of all the con- testants was 538.5 bushels.per acre -|per bushel,; According to the latest statistics, there-are-in-the-State-about.3,000,000 acresvin~corn each year,which yield-'a total production of '60.000,000 bush-els,If the adults would grow:thecropwiththesamezealandgetthe same average results that the youheg--jer set does.the yield would be 160,- 000,000 bushels.te: CONSIDER NEW BUILDING 1|Pfesbyterians to Count Cost 4 e|Sunday School Building ‘and New Church—Church News. s}-.Sunday morning’s service at the First Presbyterian church was a con: gregational meeting to consider build- ings.The church is very much in need of a Sunday school.room and # Sunday school building,separate and apart from the present church build- ing,has been considered;and-a new church,to embrace accommodations for the Sunday school,has also been suggested.At the meeting.Sunday =morning the following committees, i recommended at a:meeting of the men on the previous Sunday,were elected “|by the congregation to take under con- }|Sideration the matter of buildings: t{..Finance -committee—F,A.Sherrill,D.J.-Craig,J.-M.Deaton.W.-W.Tur- ner.W.H.Morrison,R.G.Poston,£. B.Watts,J.E.Sloop,Bb.B.Bristol,T.N.McElwee,H.0.{8teele,W.L.Gilbert + Building committee—C.-M.Steele, J.A.Brady.V.Henkel,J.T. Montgomery,W.T.Kincaid. Thedge is also an advisory commit- =tteeTrom the Sunday school,composed 4ACf the following:J.AxBrady,W.P. Moore,R.M.‘Rickert,Mrs.E.B. f |Watts,Misses—-_Mamie—Adams---and -|Margaret Turner.ven “The building ~committee=wilt—eon- sider plans.for a separate Sunday school building and a new church and Sunday—sehool building combined,and estimate the cost;the _finance com- mittee will consider-ways and means to finance the proposition.The re- .;sult of the work of both committees ff)will be reported to a congregationalYjmeetingtobeheldwhenthecommit- .~;tees are ready to report.and the con- r{jgregation will pass on the reports.t|Rev.Dr.H.M.Parker of George- fn,S who has under consider- pastorate oft;Front Street Presbyterian church of.|Statesville and Little Jo.’s church at Barium,is expected to be in States- ville next Sunday to look over the field and-preach at Front Street church.‘ tiMrs.Reavis.Burned. Mrs.Jo.Reavis was painfully burn- ed a few days ago at her.home in Concord township.While sweeping around an open fire her broom eaught»jifire,and her skirt was ignited from the broom.-Mrs.Reavis ran to the back porch and managed to ~extin- ¢/guish the flames with water,but’not e|until her hands and.face had been,{painfully burned.Her underclothes, which were_hot burned,protected herbodyfromtheflames.:¢|Mrs.Reavis is:advanced in years,‘but her conditioh so far has been fa-vorable to recovery. Big Court Docket. Indications are that the.criminaldocketofthetermofIredell.Stiperiorh|Court,which convenes next week,willbethelargestinfiveyeats..While all0themagistrateshavenotyetturned d jin their warrants,it/is known that-theenumberofcase’ready for trial’will At present there r e Ss Ss e n,The most iniportant case to be tried isnthatofHouston.Overeash,who isscharged.with the murder of his wife 4formerly lived at Eagle.Mills,in Tre- BEAT STATESVILLE TEAM. Mooresvitle Wins Over States- Ville in Basketball —Moores- ville News,: Correspondence of The Landmark. Mooresville.Jan:24 —The Moores-ville High School Basketball team de-feated the-team from Statesville in a ffast game last.Friday night,thescorebeing.19 to 13 in favor of the locals.The home team has lost only two games.this season.out of—nine played,which is a most excellent rec- ord.considering the fact that basket-hall has never before been playedhora.—Only-a--week=ago~the=strong team from Monroe was defeated,24to.22.The-next--game will be with the Winston team. Mr."F.R.Colby of New York has arrived to assume the management of the 5e.and 10c..store,Mr.G.L.Lam- hert,the formersmanager,-having.re- signed to become general manager oftheCulp'and MeNeely store., Mr.and.Mrs,J.G..Lambert —and daughter,“Esther,’have returnel to High Point after a visit of several days to Mr,G.L.Lambert.Miss El- la Cornelius’of Charlotte is here onavisittoherparents,Mr.and Mrs, G.O.Cornelius.’ Rev,L.W.Blackwelder of High Point will be in Mooresville all next week doing.mission»work in.the in- terest of the Episcopal Church,being sent out by the Board of Missions of that body. Rey.R.C,Davidson returned Sat- urday from Huntersville.where he has been assisting Rev.J,M.Bigham in a meeting.:dM...C-Sohnston-4eft...this—-week for Atlanta.where he will make head- quarters.Mr.Johnston will repre- sent the Walter.A.Wood Machinery, Co.Mr.J.F.Dorroh of Gray Court, ,former resident,is visiting friendsere, The Death Recotd—Mrs.Hol- man’s Funeral. Mrs.Eunice T.Nicholson.wife ofDy,J.P...Nicholson._of..Lewisville,Forsyth county.died Friday,follow- ing a stroke of paralysis ‘received Thursday.Funeral at Lewisville Sat- urday.Surviving Mrs:-Nicholson-are her husband and two sons—L.F.Bar- nard.of Greensboro and W.C.Jack- son of Winston-Salem.Dr.Nicholson dell._.Mrs.Nora Alexander Woodward).wife of Mr.John D.Woodward,died‘Maturday at her home in Charlotte, aged 49.She is stirvived by her hus- band end:two children—a girl of 14 and a boy.of,ten.Mr.Woodward is a half brother of Mrs.J.H.WyckoffofStatesvilleandlivedinStatesvilleand:Mooresville when a boy.The,funeral..of.Mrs.Sarah _E.Hol- man,whose death was reported:inFriday’s Landmark,was held Satur- Mrs.Holman was a member of theBaptist.denomination afd the funeral service was conducted by Rev.Chas. Anderson of the Fitst Baptist church. assisted by Rev.J.F.Kirk of*Broad.Street Methodist church,The inter- ment was in Oakwood ‘¢emetery. Mrs.Holman’s onlv child,Mr.Luth-er Holman of Williston,Tenn.,did not arrive in Statesville until Satur- day evening.The funeral was post- poned from Friday until ‘Saturdaywiththehopethathewouldbehere for-it,but he missed railway connec- tion at two points and did not ar- rive until after the funeral. Little Hope of /Determining What Destroyed the Persia. abandoned -hope-of--determining what destroyed the British steamship-Per-sia;-sunk—in-the-Mediterranean-with-a} loss of at least two American lives.Austrio -Hingary and Germany having disclaimed responsibility for the disaster and.affidavi ing passengers being inc sive,| one avenue of information remains open.This is through “thé”British government,which has in its posses- sion affidavits from members of the erew.The affidavits have been for- warded to London by a British consu- lar representative at -Alexandria, Wey pt.s The opinion prevails-that if conclus- ive proof that the Persia was torpe+ doed was contained in the affidavits mention of the fact would have béen made before this time by the British government.Unofficial dispatches from.abroad indicate that Turkey may admit that one of her submarines sank the Per- sia,but the State Department has no official information on this point. Stole Car and Abandoned It. Mr.H.C,Wilson's Ford roadster was stolen from his garage at his home.at.Bloomfield Saturday night and taken to the vicinity of Stony morning in badly damaged condition. morning in a badly damage condition,The theft of the car was discovered Sunday morning and tracks in ,the mud ‘showed that two men had ‘taken it from the garage and pushed it totheTaylorsvilleroad,where the en-~gine was started.It was evident.that the ear had gone.in the direction of.Taylorsville and ,»when the.telephone was.put into commission it was learn-ed that a Ford had been run againstatelephonepostandputoutofcom- mission at a point about a mile this!side..of Stony Point.Mr,Deputy Sheriff Gilbert and.Mr.H.H. Yount went to Stony Point and iden-tified the car.It was so badly dam-aged that it ‘could not be brought toStatesvilleuntilyesterday.)Officersareatworkonthecaseandarrests may follow. he held talNorth Carolinians.Rancombe,county leads:the:State}je joe rented a’house on Mulberry:1 levee. from the-river. few-persons-were er_points. were ginned eompared on the same date last year. In Behalf of“Laymen’s:Mission- ‘Wilson,|at least once a year. of each year is the week suggested tobeadoptedthroughoutthenationas MERCHANT DIED IN STORE. Two Deaths,at —Taylorsville— One Very Sudden. Correspondence of The Landmark. Taylorsville,Jan.24 —After a lin-Robert L,HinespassedawayFridaynightat10o’clock Deceased was Surviving him arendtwosmall-boyshythis:union,and two sons and twodaughtersbyhisfirst:marriape.ThedaughtersareinKentueky.-His fa-ther.Mr.Foote Hines af Concord,fivehrothers—-Messrs.Killian.Frank and Hevry of Statesville,Gharles andJeffersonofConcord-—and three sis- ters,Mesdames Ellie James of States- ville.Louder of.Concord-and.Jo.Gond- en of this county,also survive, frmeral.was conducted by Rev.J.W. Saturday morning at~-10.80-and the interment gering illness.Mr, at his residence here, 40:years of are, his.second.wife Watts at the residence was in the town cemetery.Mr.J.C.Jones,,‘ from Hickorv.two aveeks bought Mr.J.C. before he expired. passed, Mrs. Mrs.L.L.Moore:was For the Debate. University News Letter. Three hundred and twelve highschoolsin.98 counties of North Caro-lina have enrolled with Secretary~E: R.Rankin for the approaching con-tests of the High"School Debating Union..The.triangular debates willStateonMarch31st,and the final contest for the Aycock Memorial:Cun will be heldinChapelHillApril14th,-. The contests of the-Union from firsttolastwillbeparticipatedinbyful- ly 2,000.student:dehaters,and the to-will number 75,000 throughout the audiences with an enrollment of 13Robesoncomesnextwith12 and Guil-.ford féllows with 10.Alamance has 9andMecklenburg8,Johnston,NashandWakehave7each,Gaston,Iredell and.Union have °6 Durham. each.Cleveland, Cotton Ginning Report. -The_ninth-cotton ginning-report.oftheCensusBureau,issued yesterday. announced that 10,766,202 bales of the 1915 cotton cron had been-ginnedofsurviv-|to January 16th.That-eompares with| j 14,915,850 bales,or 93.8 per cent of the entire crop ginned prior to Janu- ary 16 last year,13,582,036 bales,-or 97.1 per cent,in 1918,and 13.088,930 bales or 97.0 per cent in 1912.The av- carage quantitiy of cotton ginned pri- or to January 16 in the last ten yearswas12,231,494 bales,or 95.5-per cent of the erop, In—North Carolina ary Convention. At the.call of Rev.A.L.Bridge- man of Greensboro,secretary of the Laymen’s Missionary.Convention of North Carolina,a number of the pas- tors and laymen of the town met with Mr.Bridgeman at club last night and organized a local organization for the purpose of work- ing up local interest in the laymen’s convention to be held in Greensboro Mr.E.Morrison was elected chairman,Mr.J.A,Brady vicechairmanandMr.W.L.Gilbert sec- These officers are to appoint five committees to have charge of va-rious\phases of the campaign,, the February 9-138. retary. lined by Mr.Bridgeman. Pay-Up Week. -Fifteen,to 20 merchants met at the court house last night to discuss “Na-tional Pay-Up.Week.”In some Statescampaignshavebeen’made ‘by mer- chants and others in an effort to get everybody to come in and square-off February:21-26 “National -.Pay-Up Week.”hearing the plan read,there was gen-eral discussion.of it and it was decid-ed to.try it out,and committees wereappointedforthispurpose.© who cameago Hedrick’s grocery store,died suddenly in the.store Sat- urdav evening about 6.30‘o’clock,Hecomplainedofapainaroundhisheartat4o'clock and it became more se-vere but he worked on and did not call a physician until a few:minutes He lay down on a counter about 10 minutés before he The physician thought thetroubleneuralgiaoftheheart: ceased was in his Tist year and is sur- vived by a son and daughter—Mr.Ol-iver Jones of Des Moines.Iowa;and|M Grace Facker of Jacksonville,Fila.His-daughter is expected to ar-rive today, 'called! Charlotte todav by the illness of her mother,Mrs..Torrence. Beaufort, Rockingham, Rowan,Scotland,Vance,Warren andWaynehave5eachenrolled. day morning at 11 o’clock at the home eee tee : of her hrother,Mr.W.D.Torner-|—Flood Damage.in the West.Floods.in the West the past.weekdidmuchdamage,the worst seeming-ly at.Yuma,-Ariz.The Colorado riv-er flooded the Yuma valley as the re- sult of the breaking of a_government Business houses in the mainstreetwerefloodedtoadepthoffour feet and many of the older buildings wereWashed away o.badly:damaged.Residents“were sent-to the-hills-back A large territory in the vicinity -was flooded.The loss atYumaisestimatedat$1,000,000,Aidrowned-and—themayorofthecitydiedofheartdis-ease as-a-result of exertion. _There were also serious floodsCalifornia,Minois,Arkansas and oth-Flood damage_in Chicago ;eo and vicinity is estimated at $1,000,-The State Department virtually has]900, 709,754 bales with 855,367 Commercial BRIEF ITEMS LOCAL NEWS, oe Sates tice—The’Civic League meets this 2ternoon,at 4 o'clock at the Commercial“club rooms.oy : —Sparta Star:Allen Reynolds,whohasbeenlocatedinIredellforsometime,has removed*to State Road...~ -—Box suppers:Beaver school housé,.hursday evening,beginning at.8o'clock;Bell’s X Roads Friday night. —It was reported that Mr.W.H.Kimball had smallpox.This is anerror.He has la grippe and is better—Mr.G.H.Thomas has sold hisgrocerybusinessatthecornerofWa:ter and Tradd streets to...Mrs J.Dea.Cox,who has taken charge,4. —~Mr,Grier Hunter has taken a possitionwiththeJohnston-Belk Co.and. will be in the clothing department;-~Mr.Hunter has recently been in Win-ston-Salem,j —~The-date for Mr.R.B..McLaughslinintheChautauquawintercourse ~~has been fixed for Friday evening,—28th,at 8 o'clock.His subject 49.“The Charm of Nature.”:ao —Supt.R.M.Gray spent last weeltvisitingamongtheschoolsofDavidesonand‘Coddle Creek townships,Mr:Gray will conduct a public teachers’.examination at the court house Sat- —urady.~;placa §;~License has been issued for thamarriageofFranklinM,Grant and -Miss Thelma May Sills,Richard Wil« liam Menser and Miss Della Johnson,Charles Cleveland Campbell and MiieC..Bowles,ee~-Dr.M.R.Adams was called “to,Mocksville a y.the.BS.cera well known lawyer and leading citizenof.Mocksville,has many friends in'Statesville—and—Iredell;-who-—will.gret to learn of his illness,—-Miss Hattie Flow of DavideMiss.Eva Alexander,formerly.of _Birmingham,Ala.,but more recente-lv of Davidson,and the niece ofFlow,and Miss Margaret Satterfie‘of Tampa;Fla.,have movedto Stateasville--and..-are--occupying-.BurkecottageonMulberrystreet, «Rev.John A.Smith,‘who was”stricken with paralysis in Charle:at8.C.,Sunday a week ago,as told inTheLandmark,-arrived home.lastnight,accompanied by ‘Mra.Smith,who was called to Charleston ~week.i still helpless,|Mr,Smith's general conditionis imp ~—Mr.W.W.Moyle,a new r tor ftom:Dr.M.R,hens seyhisfamilytoeeerom.lotte.Mrs,Moyle,who has beensinceSaturday,will .eturn to Charalottetodaytomakearrangementsforthechangeofresidence... —This month’s bulletin of the AtelanticLifeInsuranceCo.gives Mr.J._A.Ballentine of Statesville creditforhavingledallsouthernagentsofthe.company ‘in personal-busines:during the past year.Mr.Ballentineisnaturallyveryproudofhisyee.ord and the recognition given it.byhis-companys-- “An effort is being made by for~mer members of the Mechanics’Bandto__re-organize -the.band within:near future.A few years agobandinstrumentswereboughtwithmoney”collected from the public and abandwasorganized.Then.the Mechanica’band--was-organized,with instrumepurchasedbyitsmembers,and foratimeStatesvillehadtwogoodbands,But both were.short-lived and:forsomemonths.there has been no bandorganization“in Statesville.~~ Change in The Landmark Foree “Mr;J.-Paul ‘Leonard,who-has:with The Landmark ‘about 18 yeariand_who-forthe past-nine vine tonsdonethelocalreportingonthepaphasresignedandwillseverhiscon: |nection with the-paper early --mmonth.Mr.Leonard:-is a.capablenewsman,as.our.readers will testify,and has-done good work on the paper,The Landmark gives ‘him up with re.gret-and-he has the paper’s best::sesforsuccessinhisnewfield.He will”engage in the piano business with hisfather,Mr,J.S,Leonard.‘They will’restablish-their busines in-a front roomoftheMorrisonbuilding,corner west Rroad_and Race streets,-eMMr.P.A.Bryant,who has beewithThe.Landmark about 14°years,and who formerly did the local.ne:work onthe paper but has for sevyearsdevotedhimselfexclusivelythebusinessend,will again take ap.”the local news end.‘Miss Nannie Joy~**ner will take a place in the office agstenographerandgeneralassistants~*Mr.W.W.Moyle of Charlotte is’new man.on The Landmark’s mechan-?ieal foreé,filling a vacancy made by’the retirement of Mr.H.L.Crouch.”. Mr.Blaylock Enlarging Hi Creamery.% Mr.H.H.Blaylock,who has beenoperatingasmallcreameryathisdairyfarmnorthoftownforayearorlonger,maar spi butter his Ckcreamandadditionalcreamedintheneighborhood,hasdremgad:to take the cream from one or moreofthenorthIredellcreamrouteswhichhasbeengoingtotheCataw=ba Co-operative Creamery at Hickory,Mr.Blaylock is now purchasing’new:machinery for the enlargement of:plant.and hopes to be ready tocreamfromtheroutesearly * movith h eristiveWiththeco-operati yoperationatMooresoni.Blayldck’s private plant:in.opera’at Le he the:Tredell dairy farmers:rience--little droubbie incream,—SB; oe great deal about the “‘de-'5 ”and‘take it from us,re,all the poor are deserving.Noanispoorifhecan:help it.—Every- Held,error;decision reversed.Nu- Bae ple are poor b use ‘they ire too trifling to work and this class is not deserving.Many are poor be- use of misfortune‘and many more “are poor because they Nayen’t capac- ity.to earn more than a bare living 4 hardly.that.The honest.poor, who do the best they can,are the de- pperving..a, they're neither honest nor industrious pend they’re not deserving: ss Mr.John Skelton Williams,comp- Stroller of the currency,appeared be- ore the rulésicommittee of the House f Congress last week in support of ‘the Howard resolution for an investi- Gigation of charges that some national anks are charging usurious interest. -_$Mr.--Williams-said he had-received Beans complaints:of usurious interest charges and.that individiials;who are jcharged usury will not,asa rule,pros- »Mecute because they would be _black- -filisted and could not receive further loans.He recommendedthat he be given authority.to prosecute in such %cases and that national banks be re- quired to publish at the top of their x reporis in the newspapers the amounts ‘of interest.charged on their loans..“I ¢beljeve that pitiless.publicity will stop ®the practice,”said Mr.Williams,and he is right.The publicity will do more to correct this evil than any one >thing that could bedone. & The Landmark commented in the Inst.issue’on the remarks of the Goldsboro lawyer—Col.John D. «“Eangston —who made a—quasi-de- \jsfence of the recent lynching in Wayne on the ground that at a recent term of Wayne court three negroes who “few vears’imprisonment,the fault be-iKing laid at the door of the presiding iota.The-Landmark expressed a moe to know whether this Goldsboro‘awyer had exerted himself to preventjustice,whichthesemiscarriagesof .:used his influence to get his legal :i brethren to help in this reform,and _..-whether he had considered:the-respon-igbibility of the lawvers-for these-mis- carriages of _justice.._The anestien ‘has been in part answered.Mr.W.“j8Thomas Bost,who visited Goldsborouatoreporttheaftermathofthelynch-iBine far the Greensboro News,sayst“Col.Langston is not a capital punish-{kament advocate.He won’t prosecute men charged with murder.”Well.‘now,what do vou think of.that?Here 1Ris a lawyer who won't prosecute in a csmurder case.Many lawyers who make jit a business to appear for the de- -fence in canital cases refuse to prose-‘acute in such cases and make a virtueiRof-it..They have that right,but +when they take that position their in- jfuence is all the timesagainst the‘death penalty and the tendency is to igpave criminals from what the:people very often think they justly deserve. 'Snurderers to the electric chair.Col. ifLaneston says in effect that failure }do-so provokes lynch Jaw and that«there is provocation.when the law iefails.Paes =<.Readers know that manv words and “phrases in our language that are con-gidered modern and slanry are neith- S3@r new words nor slang,but are real- y-very-old-and were used -by the blest writers in the long ago.»Thisintwasbroughtoutintheveryin-teresting lecture of Dr.Black,intatesvillelast-week.-He said that his--firstvisit_to_America,or ateastwhenhehadbeenhereonlya marked that he had escaned something fy “the skin-of-my_teeth.”-. “Oh,Dr.Black,”said his comnan- yon,“how quickly you have picked up ur American slang.”:3 Whether Dr.Black embarrassed the “Yady bv._explaining the origin of the quotation he did not say,but he re-“marked.that_of_course_his Statesville‘eauditors knew that;he was quotitg rom the Book of Job,King James s Statesville audience,but by no—all-ef-themi-would—have-cared0havebeen.called on to.locate thatmotation.and if they didn’t knowtheycouldtakecomfortfromthefact‘ethat they knew as much about.i!as#the average:audience;for it is a well-known fact that comparatively few@ncoplereadtheBible(which is.the “finest literature in the world.taking sit as_literature-onlyand—aside from_its relivious character).and.many 2'who do read the Book skip Job,which=¥s-among the —most—interesting —and}best literature in the Bible.The “skin of my teeth”.quotation,which is re- ,garded as slang.is found in Job.19-20.It Was used when Job was hav- who called to comfort:him in his mis-éry,but who were such poor comfort--ers,like unto some even in this day, “pthat they annoyed the old man wntiihecriedoutinexasperation.“Miser-“cable comforters are ye all.”Bildad.the Shuhite had reproved Job for his eo and impatience and Job,“€omplaining of his friends’cruelty,“told them he had sufficient misery.itas.pity he craved.-It was in thatanswerthathesaid,“My bone cleav-¢eth to my skin and to my flesh.and I ‘,am escaped with the skin-oy my teeth,”:commonly used it is quoted,“I es- A taped by the skin of my teeth.”Take “~ymote that Job,who is the author’oftheremarksofarasknown,says :gteeth.” ©.Gov.Craig has named Marfh 3 as|date for the execution of Sam.P. sty and Mrs,Ida Ball arren,under sentence of death for the mur-"der of Mrs.Warren’s husband. ihe Bad Cold Broken Up.i ‘Mra,Martha ileox,Gownnla,”NW.tea:“I first’used Chamberlain’s CoughRemedyabouteightyearsago,At that timehadahardcoldandcoughedmost.of theItprovedtobejust:what I needed.Itidinafewdays,and the leapita cost of county government’in But others are poor because; “4yere-tried forhomicidegot.off.avith a. sAnd yet while he refuses to help send | ‘short time,in talking to a lady he re- sion.‘That was-a~compliment~to($2:42;-Stanly 36th _ing the debate with his three friends,| -,"T am escaped by.the skin of my| ’I have told mang |' Iredell’s Per Capita Cost is the‘Highest in the State But the County “Has Something to Show For It,. University News Letter.:Our issue of |January 19,1916,contained a table showingtheper the various States of the Union in 1912.Here it appeared t the av- erage cost of county government in}North Carolina was $2.99 per inhabi-tant,against an average of $4.99in the-country-at-large:~The-per-eapita- burden of county government peslargerin36States: Elsewhere in this issue is a_table showing the per capita cost of gov ernment in the counties of North Car- jolina in 1912,..These figures -are-tak- en froma 1915 Census Bureau bulle- tin on county revenues,.expenditures and public properties.They were re- arranged in The North Carolina club headquarters to show the rank of our counties in this particular. The per capita cost of our county governments in 1912 ranges from $1.- 36-in Yadkin.to.$6.91in Lredell..Yad-kin is not the poorest county in the}\State;~in--per—capita..country..wealth| 71 counties are poorer.Nor is Tredéll the richest county in North Carolina; in per capita country wealth 10 coun-) ties are richer.In country wealth per| person they are not very far apart.| Iredell with $377 ranks 1th,and! Yadkin with $314 ranks 27th. Iredell a Progressive County. Tredell invests liberally in public! education and improved nublic roads.| two elementary factors in progress and prosnerity.In 1910.only six counties in the State had less.illitera-.) }¢y,among native whites;and on Jan-, ‘vary 1.1915.more than,two-fifths of| \the entire public road mileage was im- Inroved—295 miles were graded and! lo7h of these miles were ‘surfaced.| Only 12 counties made a better show- ing.{ Iredell invests in the medical inspec-| ition ef schools.It is one of the 15) lcounties thet.employ rural school su-| inepvisors who keep the club work of the boys and girls smoing with effect-|liveness and multiply many —times| lover the valyueof every dollar spent|jin .publie édueation.Aside from the* ;20 cent school tax,waich is uniformly| } __jBare all too frequent;whether he had |levied in all the counties,Tredeir rais=fjedbylocaltaxationfor (1912-13 nearly £20,000.The county..spent nearly $5,000 for new country lschool buildings,had $62,385 invested| lin rural school —property.and 66 of ‘the schools were equipped with mod- lern forniture. |TredeH tewnshins voted |for{Ne SateseiNsMi TINS Ts aT the county will join Catawh.in build- ing a $15.000 bridge over the Cataw- {ha river.For many yeers the county’ jhas sunvorted the work in farm:doem-|;onstration.! Iredell has heen ,big ways in law and order.progress ‘and prosperity and is reanine reward in better schools,better churches,in- creased population,new farm enter- rrises,live stock s ‘tations and si- ‘los.cream routes all-over the oounty and a creamery,Jarger business for ithe trade centers,-enenter prosperity| and larger social outlook:' New Hanover Ranks High.| New Hanover stands next to Tre-' dell in per capita cost.of county gov- investing in brave,' ernment.The rate is $5.27 ver.in-«: jhabitant.New Hanover employs a! whole-time school nurse,keeps a food| “Snspector busy the whole vear around:* has a modern abattoir,reduction {nlant and well equipped meat markcts.| ‘The children in the city and country Ischools undergo medical inspection: jand the county has more ssnitary clos-| lets than any other county in -the State.The city and the country are,lenjoving the fruits of these invest- tments—-better health,clean--homes,! ,and a low death rate.i In the table to which the News Let- iter refers,the per canita cost of oth- ley county covernments in-this-seetion: af the State are reported as follows:| \Surry.which ranks second—next “to} |Yadkin—in Jowest cost is $1.38; ‘Burke is fourth with $1.52;Wilkes} isixth,$1.64:Ashe seventh,$1.65;Da-}ivie ninth,$1.86:Davidson 11th,$1-| (89:Rutherford 18th.$1.93:-Randolph | i224,$2.06:Lincoln 25th,$2.10;Alle-|whany 26th.$2.11;Alexander 28th,| $2:27--Union-89th= $2.37;Catawba 52d,$2.74;Haywood55th,$2.83;Cleveland 57th.$2.84;Al-| tamance.65th,$3:McDowell 67th,$3.-| |19;Guilford 47th.$3.19;Cabarrus; iSisty $3.74;Mecklenburg 82d.$3.76; |Forsvth 88d.$4.01:Gaston 84th,$4.-|12;Anson 85th,$4.30;Durham 89th,| 1$4.69;Rowan 90th,-$5;—Buncombe|i91st,$5.20. |Per canita cost.not comnuted for)|Avery,Caldwell,Mitchell,Watauga,| |Hoke.Robeson and Cumberland coun-| ties,because of changes in boundary | jlines since 1910.|a {Death to Americans is the Cry' |of Mexican Revolutionists.: Death to Americans in Mexico and: jgenernctin of their proverty.as well| as war to-a finish against Carranza,| was determined upon at a formal coh-| vention of the.Mexican.revolutionary| \leaders,held‘in November at a ranch| jnear Cordoba,Mexico.Present and} lioining in the agreement are said to} j have been representatives of Villa,! |Zapata,Argumedo,Higinio Aguilar,| ithe.Cedillo brothers and many lesser| |chieftains.- |-Meager reports of this gathering| leame to the State Department long} |2go but they were not made public.| |The massacre at Santa Ysabel.attrib-|{uted to bandits led by Villa officers,is? ee “‘to*have been perpetrated in| accordance with the rebel convention|lerder.{A.|The Carranza authorities have been| fully advised concerning the »move-|ments.of the rebels and have been de-|pended upon by the Washington gov- ernment to take every possible.pre-caution to prevent the threats againstAmericansfrombeingcarriedout.They are believed to have the situa- tion fairly well in hand now,althoughthechiefswhose~delegates ‘met ~at|Cordoba:still are in the field,,‘operat-|ing more or less openly.y Plies Cured tn 6 to 14 Days 7 Your druggist will refund money”if PAZOINTMENTfailsto’cure any ie ot Itching,Blind,Bleeding or Protruding Piles in 6to14ThefirstapplicationwivesKageandRest,~+AO MME neg ays na me ont K |THE COUNTY TAX BURDEN. schools in % ‘efit of every improvement recommend- ;paredness speech Saturday,January Y HNC F SOLDIERS’HOME .erenceTrusteesAdjustComp Report Shows HomeSanitaryCondition, The board of trustees’ofdiers’Home in Raleigh,session last week,among ©passed.on-complaints.of —-thmanagement.The complaint waibyC.W.Small,an inmate,was backed.by a few others; was given a aexpenseswerepaidtothehome:relative in Aue ve 7 catthefurloughhecan_re’+Home or be placed on the petition list,as he desires,Be |4Thedirectorsmade“a thorough in- vestigation of the conditions at the Home and:believe they have reachedabasisofadjustnrentthatwillput’anendtotherouchsailingtheinstitu-tion has recently experienced,©says the Raleigh correspondent oF “the|Charlotte Observer.It was generally|agreed that numbers of the veterans are aged,enfeebled and ‘consequently der bond of $2,500 to appear be- ‘|and answer to the chargeof“illicit|distillin{turned by aJacruaivetlia: ,conspiracy”cases,in which Mr,Mc-Ble and childish and hard to pleasé;and the| determination of the managementis|to maintain conditions that will meet|the approval of the public generally. The complaints by the Stat®Boar|ot-Internal__Improvements,throughChai¥man Alexander Webby asto thé’finances of the Home ‘were gohe'into,| the crux of the whole matter’heingthattheauditorsfoundthat-Superin- tendent snecified supplies on snecifie datesLineberryhadpaid‘more for|was feeling il and took all kinds.of than the newspaver market quotations justified, tach no the newsraper special importance to ‘this.asquotations«probably The directors seemed to at-| did not reflect the Raleigh market and | ‘Superintendent Tineberry that he nrecured the aveilable rvrices. W.P.Wood,himself a who is in cle manarement himself as ments that have been made and lieves that the whole matter has bec4 thoroughly 2a It must he report of Mrs. tic science inspector Poard of Internal Auditor and State veteran est of the-fiome.-expresses ud.however,that:tho for insisted : sunplies at law-| ast touch’With the daily | well pleased with adjust-} be-)) nently adjusted., Nettie W.Price;domes?" the ‘State! Improvements,| shows the Home to be in bad sanita-| There were bed.cbues, water |(ies,dirt and smenerally wre’CST:“Mrs.Price took charge of the Home for 80 days and tried toatheseeonditions.,with some Rut when returned later she Says,Was as ‘se.She gays the ,ot that tima)-*had 2 morth -and his wife,ea,hed heen shsent.’No ve of the -housekeep-ondition was about as well could be.Conelpding| renort,she :i “With preper clean bed to slee \ it.:Main.wellenrepwh ry-eondition, improv oT 2 Vvthewane Yq wha«iscaiprem—aepeerennceeeh ys *,clean clothes. y environ.; well-bak ich ern be-given with 327 appropriation, enced dict tne Stat onda bright,‘ lj soldiers will he and beyond eriticism. of them ecannnt ba satisfied, eould be mannged so that vi those who inspect e's better contentel Although|.all yet:jf 5 anc stitution fied.” In the statement of the board of in- ternal improvemen Alexander Webh,the chairman, “The reports of ouditors are suffi the Home eould eo run-withinthean- propviation made by the Gencral As-! sembly and give the inmates the ben- SAYS!s.Price and the! cient to.show that: ed in the report.“Jt must be admitted that.the State Hospital for the insane at Morganton gives good,wholesome food,well cooked and well served, even to the extent that these insane! people are furnished with clean table cloths.and clean napkins,_together with their éisthing,af an annual ap- ‘ted the ith of j corded in the offic ,iredeil county,‘th iwonld know they ought tobe.satis-};y ‘signee idle Creektowaship,adjoining the lands—of—J.i fol- jlaws: Allman’s corne toy ;iejthenceN.89 dexrees W.47 poles to a stake, ;Alman's_corner; jpelcs to the beginning corner,:containing 38 Thos.C.McCoyeinthereven ore a United States commissioner "the indictment being re-Federal. grand -rea.Fla.The case is a sim-ilar one to the Arkansas “moonshine was formerly taken into custodylaterreleased,Judge Boyd hold-ing that the Fort Smith “duthoritieshadnorighttotaketheAshevillemanbacktoArkansas,The caseis|}f}->set for heating before CommissionerT,D,-Shelton in Asheville:today, The warrant was served on McCoyinAshevilletendaysagobutthefact:was kept .secret.McCoy is —wellknowntomanyStatesvillepeople.Hehadhepdquarters:.here fora...time while he was\in the revenue service. WOMAN AVOIDS OPERATION | Medicine Which Made Sur-| geon’s Work /Unnecessary,© Astoria,:N,Y.—‘(For two years I tonics.I was get-ing worseevery day. I had chills,my head would ache,I wasalwaystired.Icouldnotwalkstraight in myback andI had pains in my stom-ach.I went to a‘o4|doctor and he said Imustgounderanoperation,but J didnotgo,I read inthepaperaboutLydiaFE.Pinkham’s Vegetable Com-pound and told my husband about it.I said ‘I know nothing will help me but Iwillirythis.-f-feund ee improv=ing from the very first kettle,and in twoweekstimeIwasabletositdownandcataheartybreakfastwithmyhus- band,which Vhad not done for two years. because of the pain |- J am now in the best of health and did net have the operation.’’?—Mre. Joun A,KornicG,502 Flushing Avenue, Astoria,N.Y.Every one dreads the surgeon’s knifo andthe operating table.Sometimes;nothing else’will do;but many “timesdoctorssaytheyarenecessarywhen|they are not.Letterafter letter comestothePinkhamEaboratory,telling howoperationsWereadvisedandwerenot| performeds orf if performed,did no goed;|but Lydia E.Pinkham’s Vegetable Com-|pound was used and good health followed.| If you want advice write to!Lydia E.Pinkham Medicine Co,|(contidential),Lynn,Mass.| MORTGAGE SALE OF LAND., BY VIRTUE of powexs contained in a mort-! faune executed by J.b.Alexander and wife,| Clemmie Alexander,to James W.Brown,dat-!ch,A.D.,1918,and res! of lexister of Deeds of | Book 36,page 473,to sec payment cf a note of even date with gage,the undersizned mortgagee and as-{ will sell the followir scribed Jand| ry,to-the bh st bidder,for af public ou leash,at the Court Louse door in -Siatesville, N.CG,at 12 o'cloek TUESDAY,FEBR on UARY 15,1016, to-wit: A tract of land lying im TredeH county,Cod; 1.Alexander and others and bounded as Jeginning:at a doxyood near a henee S.44 +Sam.' e W.61 poles te a stone, corner ji thence S.1 degree W.8 poles tot ke,J.1.Alexande corner;thence $.-89| E.98 poles to a stake in Allman'sdine:|thenéé N.9 1-2 desrées W.33 1-2 poles to at stone in center of the road,Allman's corner;} 1-4 poles to a Crs.lad thence N,.4 degrees.W. brorriation of per econita cost of shout ;feres and 83 poles more or less.| $167.while the Soldiers’Home has en appropriation of a ner capita cost of about $240.With this comparison must be something radically | wrong in the management of the! Home.”|} nere The President’s Itinerary. President Wilson plans to speak in: Pittsbure,—Cleveland,——-Chicago, waukee,Wis..Topeka,‘Kans., trip he will take to lay his national) defense programme before the coun-{j0")try._He-expects-to-teave-Washingtonatedin” away one /Iends of 'Voogs;2no January 28 and remain week. “Preliminary plans for the second; trip,to be made about the middle of next month,already are being consid-ered.his journey rrovably will take| the Presic and if pdssible he will swing through the South-te-stop-at-Birmingrham-andBolllessonscarmeri_thence with other cities.’ Pittsburg will hear whe first.pre- 29,.The President will go to New}, York January 27 to speak at ban- quets of the Railroad Business Asso-|.ejation and the Motion Picture Board|- of Trade. To be healthy at seventy,prepare atforty,is sound advice,because in thestrengthofmiddlelife-we too often forget| that neglected colds,or careless treat-|ment of slight aches and pains,simply / undermine strength and bring chronic (JAMES W.BROWN.Morteagee,{ {MERCHANTS &PARMEf MilKan-de sas_City_and Des.Moines-.on_the_first/as Bs i dexlentasfarWestasDenverjtoa ‘;Dewey L.Raymer,Att'y. S'BANK,Assinmee:|D.TURNER,Receiv. ALE OF | Jan-ih,1h6-By W. COMMISSIONER'S SALE HOUSE AND LO. _BY VIRTUE 6f a ioe i decree of the.Superior| S¥rit ina certain spe-|Hampton.”Clar-|tow,Matilda ex parte;thé,on {=f 21,1916, + »doar of Iredell| lot or parcel ofa.situ.fire !adyitHouston et als.,towit:the north s y of §7 and runs the with s'line norih 10 degrees west to Cemetery tine;thence jorth 8h east with said Cemetery line 50 feet| ce;thence south 10 degrees east to a!the north side of Chambers’streci,| ake Mm the citors’corner, de stake i side of said Chamber;street to the beginning,|and being the identical lot of land conveyed to John Hampton,deecased,by deed of ®.W.jSteele.See Book of Deeds No.24,pive 94;oftrecordsofIredellcounty.|This lot has on it a good’five-room house| and is a good leve!lot.t | A.Scott,Att'y.Commissioner.18,1918.i MINISTRATOR’S NOTICE. Jno.J Having qualified as administrator of the es-)tate of Mrs.M.J.Leonard,deceased,late of|IredeH county,North €arolira,this is to noti={fy al!persons having claims against the estate, of the said deceased to present them to the‘un-! devsizned on oy before January 18,1917,or this notice will be pleaded in bar of their recovery. J,PAUL LEONARD,~~Administrator of Mrs.M,J.Leonard. Jan.18,1916: weaknessforlater years.: To be stronger when older,keep yout.blood puresand rich and active with thestrength-building and blood-nourishingpropertiesofScott’s Emulsion whichisafood,a tonic and a medicine to keep your blood rich,alleviate rheumatiem andavoidsickness.»No alcohol in Scott's, Scott &Bowne.Bloomfield.N,J, ‘“‘DANGER”’CROUP and PREUMONIA: Come like-a thief in.the night and seizeupontheinfantchild.Be prepared to saveaglifeofyourlittleonebyhavingabot-tle of ae '’ Brame's Vapo-Mentha SalveFORieCroupandPneumonia. Price 2he.,60c,ahd $1.00,tigbyalldealersorsentpéit-pald IE BICINE ("6 if aWitkestiordy N. ” ADMINISTRATRIX’S NOTICE. .Having qualificd “as administratrix of Carl H.White,deceased,this is to notify all,pérsonshavingclaimsagainstsaidestatetopresent them to me on or before January 17;1917,orthisgtigewill,be plead in bar of their recov- ery.All persons indebted to said estate willpleaserakeimmediatesettlement.£MRS.REBECCA LORINNA WHITE,Jan.18,1916."Admrx.of-Carl H.White; bet d 63 F they P.P.DULIN,ie Is being held open.a few weeks longer for the benefit of iy task those who want to join,but who have neglected to do 80, If you are one of this number,then come in at once and Christmas shopping.~The Clubis Nearing the 1,000 \sol This was our goal when t _join,and be made happy when you receive your check “two weeks before next Christmas—just in time for your Mark.| ay but we think now that it will not stop at 1,000.°°- he club opened on December 27,| People are beginning,to learn that it pays to save the pens — nies,and nickels that usually slip through your fingers: and are wasted,and there is no better way to save the. Christmas Savings Club. CLASSES TO SUIT EVERY POCKET BOOK.NO RED amount that you have beén wasting than to join:the ; aLe wy TAPE.NO CHARGE TO JOIN. All that is necessary is to make the weekly payments, frorn December 27 up to.date,and you will have : start with the rest. if there is any thingthat you do not fully understand;we“ an even . will be glad to explain when you come jn,or write us and we will send y mail. ou literature,and answer any questions by Merchants and Farmers’Bank, Of Statesville, “The Bank For:Your Savings.” # ide of DLeel W ile, Hie thitchest—bidddesj4—--=—5 ee___SPECIAL. lipels with Staggard Spokes antl Channel Tires.Removable Dust Proof Wheel Bearings. o a a yo nn eeeh ne re, FEATURES One Lever to Control Whole Machine.. (9)Double Edged Knives (9). Automatic Stalk Hook.Few Castings.No Wood. NY;== IREDELL HARDWARE COMPA eee Gorham’s Sterling Silver Is all that could:be-desired._We-have “it in Knives,Forks and Spoons of all sizes and in sev-eral different designs,at the right prices.We have Catalogues and-price lists we will be glad to give you.R.H.RICKERT &S . ON,% \ JEWELERS.\_, 7susudlats x a WANTED!— SCRAP.BRASS—HeavyBrass 74c.per pourd,Light Brass 5c.perpoundneeaeFORSALE: New and second hand machineryfor-sale and all kinds of.boilerroomsupplies,} fek rege etdteatatkcos. C,H.TURNER:||; anaes~THANKFUL FOR TRADE!_ I want to thank for their trade all who traded with me this year.In the year which begins tomorrow when you need anything in the way of-jewelry,clock or watch repairing,examining of eyes and fitting ofglasses,I want you to.come to me.R.F.HENRY, B ‘READ WHat STATESVILLE BUSINESS < _Jeweler. ronaneshneSer uM ‘at y sitet ie |headache,~sick y 1 wb ar e e t he 'NextPlaners Wh.Statesville, ee = pe aI : > $ago a friend told meBaet,whi ae Piaaras it to be the rect tarytaifox‘bethebest family medi 1 keep Black-Draught on hand all thetimenow,and when my children feel.aeeoeaskmeforadose,and itdoesmoregoodthananymedicine bi a oer have a long spell of sith, on y,since we commence: Srtmiors'a,Elect.Denight ts pur"s ick-ft felvegetable,and hascon biasto reneteweakstomachs,aid digestion,relieveindigestion,colic,wind,nausea,stomach,similai ‘symptoms.gi Sate gS aptitmene at It has been in constant use for morethan70,and has benefited.morethanamillionpeople.Your t sells and re:k-Draught.Price only Occ.ny310-day.N.C,128 New Stock Moulding,Mat-board and Frames.Pictures framed prom-_ptly and delivered. R.P.ALLISON'S =~~*Boox:STORE. \CANNED GOODS. String Beans. -Corn. _Tomatoes. Peas. Pears. Apricots. .White Cherries.(Peaches.-Pineapples. Raspberries. \Miller-MeLain Supply Co. Fresh Goods. _.Dromedary.Dates, Dromedary ShreddedCoconut, _Apple Butter, Apple Sauce, Fresh Coconuts., Sherrill &Reece, Phone 123.108 West Broad St- DRAIN YOUR FARM. aa Al “parti E s e & SP P e y Pr ee f t e i e : ! SE R S U B E E itP INCREASE IN TAXABLES.| -|property Hsted by corporation and as- ’s Assessment Shows AnIncreaseofNearaMillionandaHalf-——Increase in Tax:os More Than’$17,000.=~Tredell’s listed -taxables_now.total$14,423.500.according to the tax ab-stract for the year 1915,recently com-viled and forwarded by RegisterBoyd-to the State Tax Commission atRaleigh.This is a gain of $1,483,- 608 over 1914 and a gain of $1,784,016 compared with the figures for 1913. The principal increase is,of course, in the value of real estate,the assess- ~-was-inereased-10-per} cent by the State commission,The total value of real estate,exclusive of i No.16 ),leaves 10.35 om‘TrainNo.24 ar.sel,Heaven tea D-™.l ment—of Train [oN =“oO OE leaves 10:40 &m. Weas iat41 bas1d Coatedto Sn Missouri Refuses Repudiated :Bonds. Gov.Graig has:been officially in-formed that the authorities of theStateofMissourihaverefusedtoac-cept the batch of old North CarolinarepudiatedReconstructionbonds:of-fered that State with.a view to hav- ing Missouri institute suit for recov-ery,since individual private holderscannotbringsuitagainstaState.The Governor issued a statement car- rvingthis -announcoement-—and-—addsthatformanyyears‘adventurers whoarehawkingthesebondsaroundthe ¢ountry have attempted to.~present.tham or some of them to variousStatesintheUnion,but that the States have «niformly declined tohaveanythingtodowiththebondsthataretaintedwithall/manner offraudandcorruption.” ‘Horse.meat has been..officially de-clared legitimate food in Durham andmeatdealerscansell.horse flesh iftheysowill.4 Another Wonderful Recov-ery From Kidney Trouble. For nearly nine years I was a great sufferer from what my doctor.said was Kidney trouble and my blood-wasoutoforder;enduring all that time excruciating pain in my back andacrossmybowels,I was drawn down so that _I-could only walk with myhandsonmy.knees..My doctor saidhecoulddonothingforme.I triedmanykindsof.medicine but all to.noavail..A friend told me about Dr.Kilmer’s Swamp-Root,and as I -had tried everything else that I heard of,l bought a bottle of Swamp-Root:and it did wonders for me.I prize it high-er than any other medicine and I shall recommend it to my friends,Iwish-to:add-right-here that--after-us-ing Swamp-Root for two months I be- van to straighten up and am now sound and well,and feel like I might live a long time yet to tell what yourmedicinehasdone.for me.:Yours very truly,«5T.C.CLAY, Marion,Ohio. 750 Sugar St.State of Ohio,Marion Co. Personally appeared before me this 19th day of December,A.D.,1914,T. C.Clay,who subscribed to the abovestatementandmadeoath.that the same_is ‘true in substance and in fact.CHARLES W.HABERMAN, Notary Public, .Marion county,Ohio. Letter toDr.Kilmer &Co.,Binghamton,N_Y. Prove what Swamp-root will do for you Send ten cents to.Dr.Kilmer &Co., Binghamton,_N.Y.,for a sample sizebottle.It will.convince anyone.Youwillalsorecéiyéabookletofvalua- ble information;telling about the kid- neys and bladder.When writing,be|sure and mention the Statesville Semi-Weekly Landmark.Regular fifty-centandone-dollar.sizé bottles for sale_at all drug stores.NOTICE! the county doing business un-der special license,and who have not paid -|same by January 31,1916,their names will behandedto.the solicitor as the law directs.Paypromptlyandsave“costs:J.M.DEATON, ei | C.WATKINS for “Everything to Build With.” FULLSTOCK:.LOWEST.PRICES Shingles,Doors,Windows,Ceiling, Flooring,Siding,Boxing,{Mould-ing,-Lime,Cement,etc.,4 / Statesville Brick Coite L.Sherrill,M.D., Will answer ’phone calls.leftatDr.Long’s Sanatorium orGeo,:M:Foard’s residence. Jan.21—3t.Sheriff.— -._|--Anyquantity 4-inch and ae DRAIN—TILE-on—AE eTERAN! ee .:cal.HO Common Bricks,Face BASEL Syr_||CVs ~Bricks,always ready for:*eandelivery.Oyaii,oe BASS.aye NIL IeTAL,PR)Ww?Ih Cogsihsiieseo™ Don’t overlook ‘the fact that a tin 1oof.is the best roof you can.useonanybuilding.We do all kindsofsheetmetalwork. Statesville Tin Co. *PHONE 55 jtal of $14,423.500. jjewelry.goods,wares. |White —Real_estate.$152,160,per- |$236,765,a gain of $27,886. WOOD'SProsperitySeeds. With bright prospects a-head for good popeos Veg- be r a t e ha e \ utter Wrappers! We have the very best «Parchment Butter Paper, <and-ean print:your name-y and brand on same.Let us‘(have your ‘order for any "quantity you want.See us.+>Prices ‘reasonable.Brady Printing Co. — 3 ', OLD NEWSPAPERS —Al)you want:atNae.84}with,Also good to put.under carpets and to THE LAierDARK-—tor~-them:: ,)RUIDRING?©.WATKINS: 2 himdred.,|Worth this to atart fires |, etable and all Farm peiceourfarmersshouldfeelen®couraged to plant improvedvarietiesofseeds,so as to in-crease their crops. WOOD'S VEGETABLE SEEDS,long known for their supe-rior quality and productive-ness,Lave greatly increaindemandandpopularity WOOD'S GRASS,CLOVER and '|$299,479,a goin of $64,670. sed by the State commission.is $6,467,952,compared with $5,263,395fortheyear1914,a:main of $1,204,-557.The 1915 value of personal prop- erty is $3,273,041,compercd with $3,-206.302 in 1914.an inerecse of only $66,789.The aggregate ~lue ofrealandpersonalpropertylistedis$9,-740,993.;; Real estate listed’by corporationsassessedbytheStateTaxCommis-sion.including.real property.of banks. totals in -valtie $841,480:personal property listedbycorporations $821,-746;property of public service cor- porations $2,558,533;bank stock $353,- 129:building and »loan -gssociation stock $78,640:corporation excess $34,- 029,a total of $4,682,507.which,when added to the value of real and person- al property listed by individuals,asmentionedabove.makes,the grand to- Of the total of $9,740,993 in ‘real and personal.property ‘listed by_indi- viduals,$9,426,164 was listed by white citizens and $314.829 by colored citizens.This is a gain of $1,285,-778 for the-whites and $35,518 for thecoloredcitizens,compared with 1914. The abstract shows 4,489:white polls and 1,072 colored nolls in the county.an increase of 262 in whites and 97incolored,“The number of acres of land listed,exclusi'-c of real estate of corpora- tions_assessed_by the State commis- sion,is 366,652,of which 235 is listedasmineral.quarry and water power. The.town-lots.listed number...3.391. The value of the land is $3,617,984 and the town lots are valued at $2,- 849,968.According to the abstract the coun- ty is losing in live stock.the total value of live stock listed’in 1915.he-ing $883:249,compared with $926,- 374 in 1914.The farming utensils, carriages,buggies.wagons,harness, etc.,listed total $215,355 in value.a loss of $37,034 compared with the fig- ures.of.the..yvear_previous.Automo- biles,bicycles and,-motoreycles —“in- creased in value from $74,080 to $93,- 404,a gain of $19.824,and this prob- ably.had something to do with the de- crease in live stock and farming uten- sils.The value of office furniture and warehouse fixtures listed is $12.069: tools of mechanics $11,470:household and kitchen furniture,musical instru- ments.provisions of all kinds,|fire- arms $381,533;libraries and scientif, ic instruments $11,930;‘money ‘of hand $24,800;solvent credits $1.003;- 634:shares of stock in corporations not incorporated in this State $800; oenqnnudiess cotton.tobacco:and.all other personal property not mentioned,$635.294.A chanre-in'the form of-the 1915.ab- «tract makes comparisons with 1914° figures on these items mncertain. Tredell’s taxes”for the”year,as shawn bv the abstract.aggregate €171-876.86,divided os follows:State 1€98.317.93;schools $50.676,16:sener- al and special county.$76,737.25;sperial school $7.248.96+special -rail- road bonds $8,798.36.The increase in taxes.compared with 1914 figures,is $17.3889.07. The taxables,as listed by the town- ship listtakers,exclusive of real and nersonal property of corporations,is divided between the townships and races.as follows:Barringer. White citizens —Real estate $181.- 978.personal.propertv $81,127.total real and personal $268,100.Colored —Real’estate $2,366,personal prop- ertv’$2,852,total.real-and versonal $5.218.Total for township $268.318, a gain of $43,408 compared with 1914. Bethany. sonal propertv $67,929,total $220,089. Colored-—Real $11,304,personal $5,- 372.total .$16,676.Total for township :_Chambersburg. White —Real estate $263,307,per- sonal property $138,758,total $397,- 060,~Colored—Real $14,433,personal. $9.422,total $23,855.Total for town- ship.$420,915.a gain of $114,721. Coddle Creek. White —Real estate —$986,848, nersonal property $575,715.total 51.- 562,568.Colored —Real |$19,113, personal $6,435,total $25,548.Town- chiv total $1,588,111,a gain-of-$80,-- 236.Cool Spring. White —.Real estate $182,554.ver- sonal nroperty $108.6387,total $291,- 191.Colored —Real $5,445,personal $2.849.total.$8,288.~Township total Concord. White —Real estate $212,141.per- sonal nroperty $134.392.total $346,- 533.Colored —Real $3,389,personal$5.294.total $8,683.ere total $355,216,a gain df $45,963..Davidson.'White —Real:estate $800,664,ner- sonal vroperty $182.648,total $438,- 312,Colored —Real $6,012.personal $4.960.total $10,972.Total for town-ship $444,284,a gain of $19,262.ee Eagle Mills. White —Real estate $150,096,ner-sonal vroperty $92,653,total $242,-749.Colored ---.Real $3,142,personal&1.924,total $5,066..Total for town-ship $247,815,a gain of $28,969.©Fallstown. FARM SEEDS are of tested ger-mination and superior quali-ties..Write for prices. WOOD'S DESCRIPTIVE CATALOGgivesvaluableinformationaboutallSeedsfortheFatmandGarden. ‘Mailed frée.on request. “PW:WOOD &SONS, White —Real ostate $244,778.per-sonal vroperty $174.646,total $419,-1424.Colored —.Real'$4,729.nersonal(84.967.total $8,996.Township total $428,420,again of $84,081. |New Hope.White —Real estate $92,017,per- ‘The Quinine ThatDoesWotAffect The Head|| sonal ‘property’$60,Colored —-Real $2,972, 228,total $4,195.Total$156,298;-a-gain AB gesoe sonal property $96,978,$40.Colored —~Real$665,total$269,271,a gain of $29,545. sonal property $119,614,total $320,-$25.Colored —Real $3,669,personal$2,377,total $6,046.Township total$326,871,a gain,a $50,282. sonal property947-"Colored —; $4,742,total $10,579,Township total|$ $539,526,a gain of $82,513.a personal property $712,504,total $2,- sonal $7,152,total $61,858,Total forcity$2,587,888,a gain of $385,629. -+Harmon,Oscar and.Romie Shaefer, MUSTANG ,total $162,103.|#pervoon!$1,-‘or township 4 White —»Real estate $170,862,per-|total $267,-|3$766,personal|$1,481.Township total Sharpesburg.‘4White—Real estate $200911,per-|8 iloh._White:.—Real estate.$307,817,per-re total $528,-Real $5,837,personal Statesville (Inside).White —Real estate $1,812,976, 525,480,Colored —Real $64,706,per- Statesville (outside). White —Real estate $637,429,per- sonal $216,159,total $853,588.Colored—Real ‘$75,745,’personal $23,042,to-tal $98,787.Total for township,out-side of city,$952,375,a gain of $79,- Total for entire township $3,539,713, a gain of $465,470.The total value of all property inStatesvilletownship,including corpor-ations;-etc.,"is $5,427,669,a gain of$556,762 over 1914.The total for Statesville township,including corpor- ations,was figured out to levy theStatesvilleAirLinetax.General township comparisons cannot be madeonthisbasisbyreasonofthefactthatcorporationsareassessedbytheStatecommission, Turnersburg. White —Real estate $201,486,per- sonal property $161,293,total $362,-779.Colored —Real $9,135,personal 4 to you $100,“You have paid in only $84.50.” ~HL-V.FURCHES,Secretary and Treasurer. 4 eae Let’s suppose that the young man js in doubt as whether he will want to own his own home some.day. But to be on the safe side he argues that it is best to.pre- pare for one.After he has been saving through this in- stitution for the full term he abandons the idea of a hom 2 He has no kick coming.»He has been systematically sav- ing through this institution and now has a neat sum to. his credit.He has been depositing with the association |. in small amounts for each week and this has been draw-s ing interest and earning something for him. Deposit 25 cents a week regularly for about 336 ie weeks and at the end of that time you will have coming «4 You do not have to pay taxes on building and’loan * shares,as you do in the regular savings vanks and the rate of interest is greater here,»Ae ie at First.Building and Loan ciation 4 OF STATESVILLE.is $8.M80,total $17,815.Total for town- ship 3380,094,a.gain of $62,986.Union Grove. White —Real estate $146,646,per- sonal property $92,435,total $239,081.Colored —Real $724,personal $592; total $1,316.“Township total $240;- 897,a gain of $53,898. Mental Anguish Case in United States Supreme Court. Attornevs for the Southern Express Company have filed a brief in the Su-preme Court of the United States,-ap-vealing from a judgment of theNorthCarolinaStatecourtinaward-ing John Byers of Hickory Grove $250 damages for mental anguish,arising over the failure of the compa- ny to deliver on time a coffin in whichto.bury_his.wife..The coffin was ship- ped inter-State by the company and the attorneys contend the inter-Statelawsdonotproviderecoveryformen-tal anguish not connected.with physi- cal injury.They also contend —that Congress has not’occupied the fieldofinter-State’commerce—legislation and the State law regarding recovery for mental anguish suffered is no long- er applicable to inter-State shipments.SENSED Child Seriously Burned—School -Honor Roll. Correspondence of The Landmark.F The following named students were||f on the honor roll at Eupeptic Springs school for the second month:Ina, Dewey and James Sharpe,Forrest,Ollie Mae and Ida‘Daniels,Lacy ‘Snead,Stella;Dana;Ina and Fay Rex and Raymond Weisner. e ad oy2Vf7 #7 SPECIAL LOW PRICES ON ibrary Tables This |resin Sacioe ST eas Me hig ny oUAAY All sizes and finishes in stock at $2.50,$8.75,“=$5.00,$7.50.$10.and$ll..0, We have the largest stock of Rugsever shown in —Statesville,AyCrawford-Bunch Furniture Compan _The Store That Always Wel comesYou.a Mr.Clvde Current,who visited his parents,Mr.and Mrs.W.E.Current, has returned to Atlanta to resume his A little girl_of Mr.and Mrs. and was seriously burned. EEL ARETE To Build a Store. Correspondence of The Landmark. Cool Spring township is to ‘have an-|2 other store.Mr.Herschell Swann is hauling lumber,to build a store on his father’s place,on the River Hill road. Has Faith in Quick ; _Remedy for Catarrh) antees That Hyomei Will Relieve}_the Worst Cases of Catarrh inStatesville.= When one of the most reputable concerns in Statesville-—guarantees that a medicine will produce benefit or they will refund the money,it speaks volumes for the merits of that |. remedy.It is in this way that the Statesville Drug Co.are selling Hy-|; omei,the treatment that has helped so many cases of both acute and chronic catarrh in Statesville and vi- cinity. Hyomei is not a pill nor is it @ spray or_a lotion that must he rub- bed in.It is an oil,the air of which you just breathe.in your nose,throat and lungs by the aid of an inhaler that comes with every outfit.Benefit will usually be seen from the very first treatment. This aid destroys all germ life in the air passages.and lungs and enrich- ag-and purifies the blood with the ad-|; ditional ozone it supplies.It ban- ishes catarrh of the head and throatandrespiratoryorgans.Wherever these mucous membranes contain ca- tarrhal germs,there Hyomei will doits.work of healing.The complete Hyomei outfit is in- studies in the Atlanta Dental School.)3Jo.)= Messick fell in the fire a'few days ago} The Statesville Drug |Company Guar-| |_____Wrailsofallkinds,—_ Lazenby-Montgomery Hardware( Look in upon us.seiAttendtoyourneeds.—Zeal pays.—S : _Kverything inour line.‘No better prices.Be wise. ‘Y ou are welcome. eee Maiestic Ranges.Oliver Chilled Plows. Truck delivery.Grates and Tiling.Qur best attention.=Much shelf hardware.F-verything to build with. 'Y ours for better service.zt Roofing,wood and metal, ss Heaters—oil,wood and coal.~J)avis 100 per cent pure paint.‘Woven wire fences. Care for your obligations.©ld accounts should be settled. expensive and includes an inhalet,dropper and sufficient Hyomei forseveralweeks®treatment.-Remember that if Hyomei does notrelieveyoutheStatesvilleDrugCo.will refund your money.f For Sprains,Lameness,Sores,Cuts,Rheumatis ‘Penetrates and _,Stops Pain At Once||For Man and BeastPi250250.$1.At All Dealers, Recatise of its tonic and laxative effect,LAXA*TIVE lead a patna ce iter than ve a{Qu j 8:a hervousa'nor(patie inked __SHEDSMEN,,+Richmond,Va.|-Remember the full name4)Lee eee diet oh We,GROVER Inte a” ib im: ne cot eeTRUTHTHECOLD x —IS \ QUINACETOL CURES A COLD. 25 CENTS A BOX icine A Mica HALL'S DRUG ST Ley i 4 tion naming Thursday,27th,as Jew-I tive people of tHe:country will hope| + it ah +helped,as the authorities of the coun-| j{ rt ““g pleasure Jews in that country. -fone hand the ultra-conservatives,rep- ably the greatest sufferers.In many cases the authorities are hostile to _them.and they do not saare_in relicf sent to the people generally.In Po-/ land at the present time there is great distress among the: Unless help is sent.to them direct they will not be try are hostile to Jews. Realizing this fact,American Jews| have been collecting funds for distri-| bution among their fellow-religion-| “$stS—in”this ‘war-“Stricken:Tand.Pres-| _ident Wilson has issued’a proclama-| ish Relief Day,;and Gov.‘Craig®has issued .a_similar proclamation.On this day our citizens generally’are asked to contribute to the millions of:Jews in Europe who-are suffering on account of the war. Statesville Jews are few in number but they have already seni $175 “to this relief fund and expect to~send more.It.is a well known fact that the Jews are the most generous of our citizens.Whenever there is a call for help they always respond liber-- ally...Remembering their generosity to others,it should be a privilege and y contribute to this relief fund for’their’people,and The Land- itizens will .-make The ancgmark “will be lad to ‘receive ary contribu- tions for this purpose “and forward it to the proper parties, —TS WAVE SOMETHING TO:SHOW FOR.IT. «The University News Letter,which is all the time presenting interesting and valuable facts about North Caro- ~something to show for it. “about the cost ‘Tina,{gives some interesting informa- tion about the cost of county govern: ment in the State.It will b a,sur- “prise to most folks probably to learn that the cost in Iredell is,much high- er than in any other countysin the State—is about two and a-half times more than the average in the State and a third more than the average in the United States. But before the alarm_is-raised: in Iredell,consider what the county has done and what it is getting for the money.Jt_is a fine showing the News Letter makes for Iredell.on this line.While we are spending a lot of money we have ty makes progress it must pay for it; and the-money~spent-for-things that cbenefit all the people—for things that are:worth while—is always well spent. ‘Our concern should be not the high "eost ‘but.whether we get full value for the money spent.Assured of the ‘latter;we need not worry about the cost so long-as-we can afford it.Cages aeeeenmetnaremcees The Landmark had expressed _the ~-eomplaints. opinion that.complaints,of the condi-| tions at the Soldiers’Home were doubtless due to chronic complainers <-among the inmates who could not be fieJscience inspector for the ~“boro:News a few # satisfied,no matter what was done for them.Candor compels us to say ‘that the report of Mrs.Price,domes- “State Board of Internal Improvements,who inspects all the State*institutions—the report being published in the Greens- days ago-—shows the sanitary condition of the Home %to be very bad.and-to fully warrant There is bad manage- ment ‘somewhere,and we say this without reflecting on any individual, for we don’t know at whose door the blame_lies.._The appropriation for the Home is about $240 per should be well kept and the inmates provided forin a way that would leave no:reasonable ground for complaint.ee President.Wilson is going to “take the stump,”as the saying goes,for _his..preparedness programme —and| towns all:over the country are invit- ine him to make a date.The.towns, ETTTEEgivingtheinvitationarenotsomuch}¢q and were executed by the Carranza |Bold Bandit Kills-and Robs in concerned about the preparedness pro- gramme,probably,as they are for the advertising it would give them for the President to,stop withinem.Ral- sigh,Charlotte and probably other | towns in this State have extended in vitations.Why not Statesville?:The} invitation to come to Statesville would; “probably not be accepted,but we'could’) et ins the papers by.making it and| that is about all many ofitheém-expact. A bold |bandit in ‘Chiéago,”in;open} ,rokbed a business office of $900, wounded the cashier,killed a polic “| f and eseaped temporarily.Why! e United States govern- send troops to Chicago?Bv-| tha city can’t protect its cit- many «million) BETWEEN TWO EXTREMES, In the matter of better prepara- tion for national defence,President Ww nis between two-fires.*“Onthe|:‘itor We \tL,M.Guttenberg,61-years old,fo raany years car inspector’re heCoastLineroadatWilmt“hdkilledbythetrainbeingmov:ayhilehewasunderacarinspecting). The heme of R.G.Vouahne ipresi- dent of the Exchange vais‘BankofGreensboro,was practically \de- stroyed-by fire on the 20th.Loss es-timated at $25,000,partially oO grod by—insurance:—.Ben- resented by,Mr.Bryan;-Mr.*--Oswald Garrison Villard,editor ef the New York Evening Post,and others,|op- pose any extra expenditure in this ‘|direction.In a’speech in Washing- ton lust week Mr.Villard —severely criticised the administration for its ux “+efforts to-increasethe national de-|Tho,C-year'-old aaitehene of fence and charged that the”purpose|nett,who lives near Ed wards.xX was to help re-elect:Mr.Wilson!On|Roads,Alleghany county,wasburned ithe other hand members of the Na-ite death a few days ago.Climbed up|o get something off the mantel‘and|tional Seeurity League,in session in he clothes caught from,the open fire. |Washington last week,sev erely,con-|Three race horses,three mules and demned ‘the administration for:doing!1.509 bushels of corn were ©burned so little;and Col.Roosevelt and his ‘Thursd:ay night,when fire destroyedithebarnofMr,Julius Johnson,near|type constantly denounce the Fresi-! AN ANCIENT ECLIPSE, he “Alexander,‘ThrewHis s:chadow.on dMogenes.sefA¥ec Talk About Eclipses,- Correspondence‘or “The Landmark,; to correctly report this morning'seclipseofthemoon. About,2,800 years ago there was aboybornatSinopeinPontus,who SYecame a_philosopher.He was for Thanks for ‘The Landmark's.aa >dence in my competence and veracity |} some‘time a pupilof ‘Hisalethingwasofthecoarsestandhisfoodtheplainest.His bed was thebareground,At length he found him-selfa-permanent-residence--in;a-tud, which belonged*to the temple of themotherofthegods.The Atheniansadmiredhiscontemptforcomfortandallowedhima.wide latitude of com-ment and rebuke.He was seized byyiratesandcarriedtoCrete,where he was sold as a slave.When askedwhatbusinessheunderstood,he an |Charlotte.The loss 18 estimated at dent onthe ground that nis*ptans for |ithe rise of $4000.No insurances.Ori-4 /national defence are so Tar stort of |i Pinehur st.| ‘In of fire unknown. *Leonard Tufts|what is needed that they will he of Mo hen donnty was clected ‘pedis ets |tittle benefit.Between the two e c-lthe State Aric sitoral Society,alias| teemes.there.is always-n-sate-grownd)theSitate Pair otamecting of the-di- Pe Prosident seems to b __rectors in.Re Jeich.Mr.Tufts wasidsCMTHOHEOCCU)reete pli e of John Sprunt Hill},The san€end conserva-lof Deu Caen.who declined to serve,—| Renregenjative Dougshton has!intro-}‘ Iveed a bill to provide for a Federal|i npuding at Lenoir,ta.cost $75,000. Tho government has already purchas- od a site at.Lenoir,Representative; iWobb has presented a measure pro- far a building at Morganton.to of ;pying that. that whatever preparation that wis- idom suggests will be made;that on [the one.we-may be saved from the) counsel that would leave us unpre-| pared to defend ourselves or-to assert |Vidingsurrights’arid:th he -ott gon GION DOO.inh ive ;nother wel :our rignts;anc ab on ta0 ovner we Dr.W.A.Murphy.who for some may be saved from(the wild-cyed fa-jvears has heen assistant vhvsi¢ian at) naties who would mor:gage the coun-|the State Hospital at Goldsboro,has/“osioned :ented a position with|try’s resources for renerations jresigned and accepted é;as ee :oe ug,to!ra New-York hospital.a Murphy:isturnAmericaintoanarmedmaesnesveasensresoemn4sonofthelateDr.:“the State :rate ears sunerintend :the State!WAS MISREPRESENTED.“for years sunerintendent o e State *Mr.David Clark Charlotte,|[Hos pital at Merganton.{Rey,Neilson Falls,an -E@scopal, whose testimony before the child la-|ministerr,aged 75 years.died of pneu- bor committee of Congress has been|monia er home in Wsaahiniieg watt}week g his remains were taken to}much criticised,writes the Seadae for interment.He‘was} that he ~has been—=aiaregheennted tac father of Mrs.Manley MeDowell| that he did not say the people of of Morganton.| western North Carolina were opposed mentee See has recor sided | to education,but did say that some of Wenn pela Tie tenth a e.'? the people in the isolated rural S2c-ling (represented in Congress by a Re-| tions were opposed .to compulsory ed-|»¥publi can.Senator Overman has charge| of he! swered:“How to command men,’’The |lave goon came to rule the master.|ncanired his freedom,was appointed,mtor to the children,and spent his old| ige as one of the household.Alexan-! jlex.theGroat visited himand opened | pane +conversation with:“Tam Alexan-! jer the Great.”to which.the.philos6- nner answered:“And J am Diogenes|) he Cynic _Alexander then asked him in what way he could serve him,—te,which Diogenes replied:,“You can} and out-of the sunshine.”Alexander! is-said to have been so struck with the Cynie’s self-nossession that.he!went away remarking:“If I’were not! Alexander I would be Diogenes.” Various heavonly bodies may be celirsed-but our almanac-makers usu-| ally montion only those of the sun a of the moon.When theshadow of! the earth is on the moon it is called|an eclipse of the moon.When the! shadow of the moon is on the earth it| is called an eclipse of the sun.pee ease of the shadow of Alexander 'Diogenes,just1 gohan.is one of | the ancient eclips Will the reader| decide what.was catnsed iin that case?| To the ancients eclipecs were outside| the order of nature.At Rome at one: [time it was blasphemy and ef ark ble by law to.talk publicly of tire being,due to natural causes.Thi nese imagineeclipses to..be ead"| creat dragons trying to devour the} cn anda Gat eecordingly ithey beat drums and brass kettles to: terrify the monsters into letting go! Lot of good values in evef'y department. Additional 7 lot white _goods..added for this Ifa coun-| capita:and |j with that amount of money the Home |Christy.tothe United States Supreme|jnder the constitution ucation,which he understands to true;that:superintendents and Saver seers of mills who come from the New England States,.where they have factory inspection,have told him that; in some cases the mills have the choic¢, verse reports and continual annoyance| or else to pay the inspector fora ciean| bill of health,and hence he suggested' that inspection,might mean~graft; that he did not say that petitions from| mill operatives in opposition to the bill were ene:in the presence.of the payroll man”;on the the operatives had the privilege of signing either for or against the bill. Mr.Clark says his testimony |has been_garbled and as The Landmark is one of the papers that criticised his testimony it is giving his statements| covering the points on which this pa-. per criticsed hm. ela aoe A report of Iredell taxables,com- piled.by The Landmark and printed today,is a little late but is of inter- est,nevertheless.The county authori- tise did not get from the corporation commission the final report as to cor-| porations-until about=the endof the year,hence the délay in printing"the;* complete returns. SOROACRATTe The Landmark is making its man- ners to the Concord Tribune and the, Hickory Record.| rrconrar Will Try to Save Mrs.“Warren. Powerful influences,the ..Journal! hears,have been set inmotion to save the life of Mrs.Ida Ball Warren,un-| der sentence of death for the murder| of her husband.It was mentioned re- centty~that—the—Anti=Capitalk -Punish=7 ment Society of America,with head- quarters in’Chicago,would try to gave Mrs.Warren and the Journal nears that Clarence Darrow,the noted lawyer who appeared-for-the-dynamit- ers at Los Angeles,has been retained| for that purpose and that appeals will be made to all the women’s clubs in!|, behalf of Mrs.Warren,whois now in jail at Winston-Saiem. Local counsel for Mrs.Warren and |, S.P.Christy,her partner in crime,are| not informed as to the purposes of; the Anti-Capital:Punishment Society| ‘hut it issaid they contemplate carry- ing both the cases of Mrs.Warren and ‘Court.In case the appeal is taken, |however,it can only result in delay, |The Supreme Court will do nothing. ae Mexicans Pay Penalty For Killing American. Bert Akers,an American,was shot | land killed at San Lorenzo,Mexico,Fri-|day,not.far from the boundary,line,| ‘by two Mexicans,Bernard and lreder- ico Duran.The Mexicans were captur- authorities at Juarez,Mexico,Sunday| morning. Akers and a companion were search: ing for stolen cattle when they.went \to the home of the Durans.The Du rans fired on them from the roof ami killed Akers. -|There was much indignation Americans whén Akérs was killed but ithe prompt capture and execution of {his murderers pacified them. |The coronation of Yuan Shi-Kai as ;emperor of China has been postponed |indefinitely.The -reason given:offi- cially is the uprising in southern |China.s Women of Sedentary Habits. Women who get but little exercise are likely;to be troubled swith constipation ahd indipes-ftion and will find Chamberlain's “Tablets high-jly henefteinl.”Not so good as a threé or four mile walk every day,but very much betterjthantoallowthebéwélstoreninin’a con-stipated condition,They are easy and pleasesanttotakeandmostyagreeablein’effect. Oh-tainable evexwwhere,..- dad ‘of a form of blackmail”through ad-"yy ‘hiredt ‘one negro to “for housebreakins ; ‘bery and another to ten years fer a ‘clothes theard to ‘he received the chad a gun-he would get ‘eourt,and the 'velt and Taft His companion escaped.| among | of the distribution of offices in that! territory.f Itheir prey. textile industries at Leaksville-|Miss Tarne began her beautiful per-| rare m:rking vast improvements.+acecrding to programme, M val]Field &Co,of Chicago,who ;ning near Caster and Pollux,ewn several of ingapis,it is report~ahout edule time,to-a—small’but Fed will spend a million dollars this appreciative,interested and’respecta-| i additions and new hic.numberof spectato only,a._lit-) at Teeiksville,Spray and Dyaper.'i}¢have interrupted the view:Secing’ Ten days before his wedding day (hat she necded no assistance,and, and without anv apparent reason.']>other important duties to per- Robert.Stanley Boykin disappeared your correspondent retired.| from Wilson.Cards had been:issued;leavine her to the .observation of fer Boykin’s mar ©toa young lady scientists more able to criticise and in Atlanta and his sister was in At-enlovize her ‘continued “performance| Janta helping to prepare for the wed-|than himself.Lak. ding.Statesville,N.C.,Jan.20,1916. W.FP. \ Livingstone,nrincipal of ‘the =: Gaddvsvilleschool in Robeson county.Business men of severalStates are) Ramsey-Bowles--Morri- 4 MOREBARGAINDAYS.son Co. fired on from ambush end 2 ball!petitioning members of Cong ress to! <effect in his leg»Troubles grow-j enact some legislation that w ill tax: 2 of -the netsieinn of pupils}haves order hou The plea is made; school are believed to be respons,that all local cnterprises are compell-/ ;_Mr.Civinestone thinks ‘a ne-jed to keep up _the institutions and, ‘o fired the shots but that he was |public improvements in the communi-| to do it.jetes they serve while the mail.order} New Hanover Superior Court!houses pay nothing,although benefit-| Peebles sentenced|ing very largely. in State prison |Edith Mills,2 ~reb—died ~of burns In last week Judge 25 years and highway haeeecaughtShewas ‘third little girl to die mi Durham with-. in two months from a similar cause. |GIRLS!HAVE A MASS_OF BEAUTIFUL BAIR, offence.The.first man,was, say by those near him,when sentence.that if he; busv on thei other used -bad an! as he was leaving the room| es Judge Peebles.added similar euage both ye year.- Between the Two Extremes. attacks upon the;:poljey single trace of dandruff or falling hair |f ‘and your scalp will not itch,but what; Lwill_please—yeu-most will be -after-a few weeks’use,when you see new} hair,fine and downy at fir Bt yes f 25-Cent Bottle Destroys Dandruff ne | Doubles Beauty of Your Hair.| Defonee.of and administration’s pr eparedness again marked sessions of the Nation- nl Security League in Washington Friday.George von L.Mever,Secre- ‘tary of the Navy during the Roose- administrations;Hen- rv_A.-Wise Wood,who recently re- signed from the naval advisory board, and Reyresentative J.Hampton |Moore.president of the Atlantic Deen-! er Waterways Association,led in the dav’s addresses.‘ Mr.Wood arraigned the administra- tion's conduct of affairs,asserting) that “we have no foreign policy at thebape”My:-Mever declared that}W@VY,and have’an _appearance of} the fundamental defect-of—the Navs abundance;an_incomparable lustre,| Devartment was that it had no brain,softness and nvakened f Knowl and Mr.Moore assailed the “repeated ee.oe ses arg nowiton’s| 2 ue the govern-}**z | oe a Sealed follutes af Heese toilet counter,and prove that your) the.sealp.A little _Dandcrine immediately}| doubles the beauty of your hair.No| |difference how dull,faded,brittle and/{ seraggy,just moisten a “cloth with| Danderine—.and_carefully draw.it strand at a time.The effect is amaz- |ing || Beal|hd the,i SOFT,GLOSSY,WAVY.|i Within ten-minutes-after-an appli-iffcationofDanderineyoucannotfinda} | through your hair,taking one smal —your hair will be light,fiuffy and}i DON’T FORGET Our Great Annual Hu Clearance Sale Now Going On—~ ‘This Week Only. m to heed lessons taught by other arsLae develon waterways near the hair is as pretty and roe asany coast adecuate for naval strategical that it has been neglectec or injured moves which might become necessary)PY careless treatment—that’s all—|“|you surely can have beautiful hair and|nm war-time."One inc ereeeation defender was lots of it if you will just try a ieele| Danderine. frie AESRearAdmiralColbyM.Chester,re- DURINGTHENEXT TWO.WEEKS |who reminded the league thati~ I shall unload several cars of Long-| 1tired, Chicago in Cpen Day. A bandit accompsnied by a woman, robbed the tourist agency of Thomas A.Gook .&Son of $900 in Chicago Friday,wounded the cashier,,killed a ‘policeman and escaped. According to the‘police the.decd was the most daring for years in Chicago.It was accomplished,on oneofthebusieststreetsof.the down- |town district at an hour when the |thoroughfare wes congested with au- tomobiles and workers on,their way home.The’woman did not »partici-pate in the actual robbery. |To Drive Out Malaria|And Build Up The System |Take the Old,Standard GROVE’S|TASTELESS chill TONIC.You know what you are taking,as the formula isprintedoneverylabel,showing it ispalaneandIronin-a tasteless form. the President | Leaf,Kiln-Dried Flooring,Ceiling,| jitary improvements.“HE you don’t game materials are today quoted $2) ,Fecourse of turning him out.of office: I shall offer these goods at very low| nation and should support him in|prices,and if “you are Planters’Warehouse,Statesville,N.C | thing for Sandwiches Potted.Meats, Olive Zest, —’PHONE 89~— slone was vésted with “authority\to! Siding,Boxing and Casing,that was| ‘like the way the <President handles to $4 per 1,000 higher than I bought! but so long as he is-in office we should; building and 12 recommendations he makes along;want to save mone rts i,e e eSandwichDainties ——WE HAVE—-— Date Nut Butter, Sandwich Olives, Eagle & Milholland:: ysis Queen Quality |||Rice,whole grain and uncoated,3 pound package 23c.,1 pound. package 8c. Florida Oranges 30c.per-Dozen. Grape Fruit 3 for 25c.Lemons DRIED BEANS AND PEAS.’ Lima Beans .....+.+++++++9¢e Ib, Yellow-Eyed Peas .5 Mixed Beans .... ink Beans Black-Eyed Peas ......7 1-2c.Ib. EVAPORATED FRUITS. Extra fancy Peaches,'15c. “value,for ae 12¢.lb. ey Evaporated ‘Peach 0c.Ib. Bvaporated Peaches .....5%"be:Ib. California Apricots ......12¢,Ib. MISCELLANEOUS, Whole~Grain Head Bice 10c.value,for ....1-2e.Ib.Mountain Buckwheat Flour Be.Ib. Hecker’s Prepared.Buck-wheat Flour ........10c.Pkg. Cabbage i loda elite emsCreamCheese.....+++,+280 Ib, Maccaroni_... California Prunes ....,..11¢.Ib. Seah clea een ReeSpaghetti.... Postum ...‘COFFEE.White House Coffee ..3 Ib.can 98c,‘White House Coffee .1 lb.can 33.¢Queen.Quality ‘Coffee,steel-“ cut,-put.up in 1 Ib.cans,Bbc.value for .....sseeee8 Gold.Ribbon.Coffee,1 Ib.can.i2de.Dandy Cup Goffee,1 lb.pkg....18¢.Ten Penny.Coffee,.1-2 Ib.can..9c.No..1 Bourbon Santos ‘Coffeeinbulk.We grind ‘this |fresh'as you need it and *guarantee every pound,36c,-vale for si.cess seeeeeees No.1 Blended Coffee,25c,value for cides ceseecusaeelNo.2 Blended Coffee,20c,value fOr ieee ieee eet ee L6GArbuckle’s Coffee,per pack-age Some eeeaerorersere eee Cuisine drives out malaria,the)bn nilds..up.the system,50,cents ecommend to Congress naval and mil- bought several months ago.The! this problem,”he said,“you have the them.As I am crowded for storage,| emember that he represents the ens| y.ithis line.”'C..WATKINS,next .to McElwee’s | When you want some- Deviled Ham. Peanut Butter, Pimentos,ete.The Robert Bunch Cash Grocery, “The House of Better veleeis i,PhoneNo.229,baigoet -PE oD, ead bite Sore i YENTLY PERSONAL, Hion of Folks Who Come and '° ‘erél weeks with relatives in Statesvillé-gnd ‘vicinity,left yesterday.for Wash-on,from whence he will return toston,where he is connected”withthequartermaster’s department of theUnitedStatesarmy,~Mr.Carl Lofland of Chicago is vis-iting his -brother-in-law and_sister,«Mr..and Mrs.0.W.Elam,at their honie on Water street.:Little.Miss Henrietta Mize,Spent a month with her grandmoth-or,’Mrs.Mary Mize,returned Satur--dav evening to her home in Taylors- who a Miss Daisy Hendley spent fromSaturdaytovesterdayatCornelius,~~the guest.of -Mrs.-F..C,,Stough,.Mrs.S.L.MecCanless of Salisbury et apent Friday in Statesville at the Ae _.home of her father):Mr.T.J.Conger.\Mr.and Mrs.R’C Bunch have re-turned from an extended visit to their, home people in Spring Hill,Tenn“Miss Julia Wren of ‘Wren’s,Ga.,will arrive tomorrow evening to be the guest of Mrs.R.B.Kestler.{Mrs.Lucia Parks Stephens of Con-rord is the ruest of her sister,Mrs,Ct.M.Crowell.>ae Miss Love Walker returned Sundaynizhtfromavisittofriendsandrel;atives.in Philadelphia and Swect Wa- i ter,Tenn.:; ::.Little Miss Sarah Sentman went to ele Charlotte yesterday to enter a sana- *torium for treatment.Sle was ac- ‘companied by her mother,Mrs.E.M. Sentman.:Mrs.B.F..Lone.Mrs.VeraB.:JonesandMr.E.S Millsaps went to Char-___lotte yesterday to attend the Social Service Conference.Mr.Millsaps will ,:go from Charlotte to Salisbury to at- ae ae tend the State Live Stock mecting. ce ;“Dairy -Agent John.Arey went.to Salisbury‘yesterday to attend the Statelivestockevent.Other local peovlewho.expect to attend the meetingareCountyDemonstrationAgentDull,Mr.H.H.Blaylock and Mr.W.-C:=Weaten.-“Mr E.K.Hines.went to Taylors-ville yesterday {o look after the bus-;iness affairs of his brother,Mr.R.L.Hines,who died recently..Attorney C..M,Adams is attending ¢|THE MARRIAGE IN 4 Pressly officiating.The couple spent “TEXAS. Miss Mallie Watts a Bride—Winston-Salem Young FolksMarriedinStatesv _Affairs.-potas Relativesin Statesville have been),notified of the marriage of Miss Mal-lie Watts of Grand View.Texas,andMr.B.H.Neely of “Holly Springs,Miss.,which took place some days agoatGrandView.Mr,and Mrs NeelywillmaketheirhomeatHollySprings.Miss.\Watts_spentthe past summerandfallinStatesvillewithherbroth-er,Mr,E.B.Watts,leaving for Tex-as about three wecks ago.She did not reveal her wedding plans whilehere.She is a daughter of the lateJ.A.F.Watts of this county.Forseveralyears.she has.lived in Texaswithhersister,Mrs.C.:I.Coffin.ShemetMr.Neely.while visiting in Mis-sissippi a few.years ago. Miss Lois Gonnelly and:Mr.An-drew D.Parks of Winston-Salem were married Saturday night abut8.30 o’clock at/:the home of Mr.and Mrs:Jas.W.Fowler,.on the north- eastern edge of itown,Rev.J.H. the night here-and ~teft-Sunday for Winsboro,8.C..where they will spend some ‘days with Mr.Parks’parents before taking up their residence in Winston-Salem.¢ Miss Connelly and Mr.Parks desir-ed ‘that their.wedding should be a surprise for their friends and for this reason Miss Connelly erranged with her friend,Miss.Bessie Fowler,to have the ceremony performed at the latter’s home here.The bride and groom-elect came to Statesville Sat- urday evening via Mooresville.where they were.joined by Miss Whitley Connelly,sister of the bride,arriving on the 8.15 train,The ceremony wasperformedimmediatelyaftertheirar- rival at.the Fowler home.The bride, who is an attractive young woman; formerly lived.in Statesville and has many friends e who wish her hap- niness.She is’a daughter of Mrs.’L. R.Connelly,who moved from States- ville to Winston-Salem —about—two years ago.Mr.Parks has a position in the shipping department of the Reynolds tobacco factory at Wins- ton-Salem. The members of the local lodge of Woodmen of the World enjoyed an oyster supper in their lodge roomThosaieenightesecteriee: The-ladies-of the -Elcricemoh—Glub- entertained in honor of their hus- bands Friday’evening at the home ofMr.and Mrs.Eugene Morrison on north Center street.The event was in celebration of the club’s tenth anni- He—Social|correspondence of The Landmark. thour,The first meeting there was;|, hand every one is : basket of dinner and enjoy'a good} “Wilkes “court “at Wilkesboro:~Versarv.An.excellent”course”dinner,Mr...and Mrs.Marshall Stone and including turkey,was served.Somechild.who visited Mr.and Mrs.T.J.of the guests.whose husbands could Reddick,,,returned yesterday to their |not attend the dinner had lady com-home in Thomasville.jpanions.Mrs.Lucia Parks Stephens‘Mr...and Mrs,John H.Gray spent |of Concord,who is:visiting her.sis-yesterday in Charlotte.iter,Mrs.T.M.Crowell,was an out- oa 3 Mrs.J.M.Downum of Lenoir ar-| :rived in Statesville yesterday to en-| ter the Sanatorium for treatment.| Mrs.M.FE.Pope is visiting her sis-| 3 ter;Mrs.Garrison,at Derita,Meck-'! semen vo EDP county.mrt .vesterday afternoon for a week’s out-|ing at.Connelly Springs.|Mr.and Mrs.Scott Fillman_of;Reidsville-spent from Friday to Sun-| day evening with Mr.and Mrs.Dor-'golo by Miss Mattie McKinney andjniccly grading our road from Bry-| man Thompson.at $${ Notice of New Advertisements.| iain a ce | t Dry pine wood."Phone J.H.Eee be tain.{ 5 White housekeeper wanted...Write| i L..care The Landmark. 5 ¢R.:B.McLaughlin has.qualified as t administrator of W.H.H.Summers.| :District manager ‘warited:—.Maéss-| 4 ‘achusetts Bonding and Insurance Co.| ?Stenographer wanted.Address H: M..care The Landmark. aes ‘Last call for sacrifice sale—J.M.McKee &Co.4 | “Between -season”bargains..— 2 -Johnston-Belk Co. }Tour more bargain days.—Ramsey- Bowles-Morrison—Co.eT Big comfortable Overland for $6965.| —Carolina Motor Co. “Rverything to build..-with.’—C. Watkins. Excellent photoplavs at Lyric to- dav.tomorrow and -Thursday,..‘"| New stock.—R.P.Allison. Mr.and Mrs.Vernon Castle, ———World’s greatest daricers,-at-the Cres- cent tomorrow. the} ¥Don’t forget great annual clearance |. ¢sale.of furniture.,—Statesville| %Housefurnishing Co. ee i :Hardman autotone.—Carlton.A Andrews;manufacturer’s—agent.-+}BIN {future for each one written on them. ‘|gold,which are of-town guest.After the dinner Mr. Morrison entertained the husbands at! a smoker.:ooMr.and Mrs.J.E.Heinzerling en-| tertained the..deacons,and officers of the First Bantist church,their wives Rev.and Mrs.John~F.Kirk left)andthe members of the churchchoir,|working in the Bloomfield cottonmmill.| Thursday evening,at their home on| Tradd street.During the evening; there were readings by Mrs,L.K.La- zenby and Miss Annie Terry,a piano} the Baraca quartette.|Punch,sandwiches and coffee were} served.en | The Eclectic Book--club,-whieh--had, net mot.for about six weeks,.held a)pleasant meeting *with’Mrs;-H.-0.' Stecle Thursday afternoon.The study} of South America was resumed with! a paper on Columbia by Mrs.Dor-man,Thompson and a_paner ‘on old Cartegena by Mrs.R.B.McLaughlin. Mrs.A.L.Coble led the discussion of current events,Mrs.-Thompson sang two.numbers ‘and Mrs.McLaughlin played a piano:solo.Following _the programme the guests were invited into the dihing room,where elaborate refreshments were served.Special guests were Mrs.Fred.A.Thomas and selections by Mrs.Watkins,new-comers toStatesville. "Reported for The Landmark. The Junior class of Statesville High School.wag?entertained most pleasantly Thursday ‘afternoon ~by Miss Kate Finley.After a half hourtofjokesandmerry-making.an_origi-|_tnal..contest afforded much fun.Fol-lowing this came a “fortune telling”in the form of cards,with a possible iThe cards were tied with purple andtheclass.colors. {x e ‘ot much bette...movei.tom|Lhe Lyric Theatre COOKING CLUB AT VANCE,|A snowstorm ushered in the cold toh oricihetieie Amy oa ain Watauga county The Debating Society “and thejand a week.ago the thermomettr\i ;dropped to zero at Blowing Rock and~Flagand.BiblePresentation.(75 "very near that at Boone. :ek 7 9 The Gist of It.Statesville,R-4,Jan.24°—;Av cook-|‘Last December*I-had «very severe cold azal ing club has been organizedat Vance,was_nearly down sick in hed.“1 bought twoH,|bottles of Chamberlain's”Cough Remedy ©anditwasonly’avery few -days until.I.wascompletelyrestoredtohealth,”writes 0.J. under the supervisionof Mrs.I. Whiting,assisted by.Miss Beulah‘Wetmore.‘The’first lesson.was giv-|Metcalf,Weatherby,Mo,If you would knowthevalueofthisremedy,ask iiny one who hagusedit,Obtainable everywhere,i MARKET REPORTS. pie ee BER see |Statesville Produce Market.much interest and we hope to see the|-—‘the-following prices.were paid yesterday good work continued;and we feel sure |fof produce on.the local market. it will prosper with Mrs.Whitingin |bd dl oy 12¢.per Ib.Rd per Ib,charge...ee es ‘Hens,10¢.per tb.An unusually good debate was held Exes,20c.per slozen. at Vance school house Thursday eve-|Roosters,Se,per Ib. ning,20th.eit | { at:the home of Mrs,Whiting,and the second lesson will be given next Fri-at.the usual| en.Thursday afternoon,20th,at ne {| day afternoon,28th, aeees 15c.per Be .z wax,25¢c,per Ib,At the last meeting of the V.P.|Green Hides,llc.per Ib. club the club discussed meee sub-|Green Hams,18¢,to 1be.per Ib, jects and then the .president of the)giges 126.per Ib., debating society took charge.The |Shoulders,2c.per Ib. solved,that.the character:of man|Poetweed-mteney Comh.ie te 1c.ner Tbs stands higher in Old Hams 18 to 20¢.-per Ib. question for the evening was,“Re-/Red Honey,Se.per pound., the estimation of! mankind than riches.”Every speaker|’The following prices were paid yesterday did his best but we must-say.that two|Or krain ~the Jonakpearkohi of the speakers did unusually well—|aren ye agoO Mr.Grier Sherrill and Mr.-Frank|~oats,65e.per bushel,~~ Proffitt,When Mr.Sherrill spoke he}Rican ores brought out good points and stated)4.4,Ptolenrilte Cotton Market." them clearly and forcefully.Mr.'Prof-|pound was paid for best grade Fags fitt also brought out good points and].Seed cotton,6.25. it was very hard indecd to make the|Cotton seed 57¢.per bushel. decision,but finally it was given to Mr.Sherrill’s side—the negative. We want to call attention to the good work which is being done.at Vance.and.we hope to see not only the old members cling to theixwork, but new ones added.Next meeting per (ADVERTISEMENTS in this column 10 centsperline.cents.Cash must accompany order.) FOR SALE—Dry Pine Wood.J.H.BOSTAIN. WANTED—While ‘Phone 347 Red.Jan,25—-1t*. Woman,middle-aged,as 7 sy >housekeeper for family of two.Write L.,to me asia Peiday evening,28th,at|core THE LANDMARK.Jan,25—-1t*, ne usu .:!Please remember the presentation LOST nts BlowmBeld,Tbeketheok Containing;|$26.Name W.A.Kilpatrick in pocketbook.of the Bible and flag at Vance:school Reward for return to THE LANDMARK orW.A.KILPATRICK. STENOGRAPHER WANTED Must be speedy, accurate and capable of handling office work in general,.Apply in-own handwriting.Ad- day.|dress H.M.,care THE LANDMARK. Mr.and-Mrs.A.J.'Beaverand fam-|+38,25. ily of Vance community have:just re-sR A.L.LOWRANCE for the best InsuranceturnedfromDavidson.where they}..that you can buy.PHILADELPHIA—IN- havé been visiting their mother,Mrs,|_SURANCE Co.qe Frank Carter. Land Deal—Boy..Imprevine- Cther News. Correspondence of The Landmark.| Statesville,R-5,Jan.21 —-We have _— hadalittle taste of Wititersferssome! davs~but-spring-like--weather.provails.j.2s todav.Farm work is progressing|—— slowly,with some building and some |HON! house will be Friday,28th.The girls SNe Rani, of the cooking club,will serve coffee asked to”bring a —District Manager for Statesville Aity ;good proposition for the right jous experience unnecessary.Freefinstruction.Address MASSACHU-8 BONDING AND INSURANCE CO., Accident and Health Department,Saginaw, Michigan.Capital $2,000,000, Jan,252t, —We have {ARES AND MULES improvements to farm buildings.Pott Reais d by ©pee en of 28 Mares.We :S i |now have ever 225 head of Horses,Mares Mr.Howard Woodward has bought|ana y PAA pea tadlteinGet cae rant Catt Le CRAIGeoAN2hicdhefromMr.J,J.Jobnson~.of Stony}and see them. Point G5 acres of tand tyingin}STOCK.CO... Sharpesburs;townshipand_is build-WANTEL ing a house on it for a-tenant.The|lieht housekceping. consideration was $15 per acre.Adiress ROOMS,care THE LANDMARK. The little son of J.D.:Hartness,|Jan.21,;: HENKEL - who was shot by his little brother,is FOR RENT—The Nicholson house on Bell | :_DORMAN THOMPSON,executor. »7.home from the Sanatorium and is get:| ting along nicely.:eames See Mr.R.J.Sloan.who has been in| feeble health all fall and winter,is} this community to Statesville and”is|Calls your attention tothreeexcellentphoto-plays.We feel sure that ~you will becharmed with them..’Try to see themall.“We offer Miss Bell Barkley.is living at the old Barkley home alone and is getting| jalong finé.: The road force is getting along. antsville to:the county line.Alexander| should be up and doing to meet us.| It will be too bad for our good Toad| io fall over—the-line-inte_a_mudhole |} and a gulley.Come right on,good|__Today people of little Alex.,and meet us and!A notable all-star cast in be as happy as you are when travel-|Tredell’s good roads.:“THE CHORUS LADY” Spelling Match at Kerr’s Branch|The most.human play of ~Personals.stage lifé ever written. Correspondence of The Landmark.his hoto la’h Troutman,R-1,Jan.22 —Miss |.Ti P Pek abeen Mattie Wagoner returned’home_this pronounce nas n smeri- week from Concord,where she-—has'|—-can-Classic”by the critics.Weurge you to see it, ing on been visiting her sister,Mrs.Denny.| Miss Mamie Mills of Salisbury is vis-4 iting relatives here.|. There was-a-very-interesting-spell-; ing race at Kerr’s Branch school |‘Tomorrow housé last Friday ~afternoon...The)The dainty,fascinatingspellers.were.the Bellville school |:‘r aoainae the Kerr’s Branch _school.|favoriteof the films.;MARGUERITE CLARK.in her best photoplay.}—“THE-CRUCIBLE? There.was some splendid spelling on| both sides,but Kerr’s Branch was | successful.:Jonor_roll_Kerr’s branch school forsecondmonth:Nannie.Dee”Smith,? Luner Overcash,Sarah Johnson;-Viv-; ian Johnson,Clara Compton,Tiny| Compton,Turner Overeash,Spencer} Johnson,Lathan Smith,Daniel Comp-| ton,Fred.Compton.: adorable in this produc-tion.This is ‘a special. Shoes repaired while you wait at) Sa M.&Hi Shoe Co.’s. sale.—Mills &Poston. ->Christmas Savings Club nearing 1,-| 000 mark.—Merchants &Farmers ‘Bank.;Snvecial price this week+ables.—Crawford-Bunch Co. ow library Furniture Home ‘or investment.—First Build-| ing &Loan Association. —$$ The Arthurs Schook: Correspondence,of The Landmark. “Honor roll Arthvrs’school:Tirst month —Georgie Ballard.Vance and Geneva Dearman,Marvin |:Myres. Edith Myres,Neva Myres;|second month—Nettic Bass,Georgie Ballard, _.°.Maggie Bass,Marvin Myres,Bertha r ~~Ballard.Dewitt Smith,Nettie Hoov-er,Edith Myres.The enrollment is 59;the averagelastweekwas47.Some more will beenrolledthisweek.J.Knox Patter-“4 gon:is the teacher andis teaching .asplendidschool.at this place,one’of the best,considering the many schoi-ats he has.He is liked by all'the pa-trons of the district and no complaints-have been made,so far:as is}known. It is gratifying to the people of ourdistricttoseetheirschool-moving on their neighbor schools.Mr.Mack Bass.moved ‘back toStatesvillethepastweek.AnelinateemnelnnaneRinsestpptainenechue ~~~SMITHEY &FRALEY have a fewmorecasesoftheCaliforniaPeaches.to elose out at only 5c.Come and:getyoursbeforeitistoolate.—ad. ji,SMITHEY@ FRALEY have.just +‘Country Hams to close 2tuneengergh aking preparation for big winter| so.nicely and progressing as well as| received another-~big®“shi.tdietef These colors were Véry attractively carried out—in the block cream,cake| and-mints.Miss Finley proved a ;most gracious hostess. Honor Roll Wayside School... |Correspondence of ‘The Landmark. 'Honor roll for Wayside school,for- merly Lingle school,for second |month:|#red.Allison,Curtis Allison,Wil- iliam Cloyd.Wade Cloyd,Pressly 'Deal,Odell Dellinger;-Alice Dellinger, ‘Oscar Dellinger,Lester Ellis,Lula|lis.Paul Ellis,James Ellis,Vance jfreeland,Allen Freeland,©Emory |Freeland,Irma Furches,Edgbert Fur- \ches,Clayton Furches,Steven Fur- iches,Lula Furches,Cloninger Kyles, |Vanee Kyles,George Kyles,Mary |Lineberger,,A.V.Lowery,Lee May Lowery,Phoebe Lowery;Cortex Low+ ery,Mamie Reavis,Ralph |Reavis, Grady Reavis,Eugene Reavis,VanderShoemaker.: The Wayside school is making good progress,With Miss Janie Gray as teacher.\*“One-Day Club’’’was _re-cently observed and.while ‘the men jand boys of the district planted shade\trees and otherwise beautified.the ‘school grounds,Miss Gray and_the older girls,of the school gave.the building a thorough cleaning and made it_as attractive as possible. SMITHEY &FRALEY will sell$1.50 Table Damask,pure Linen,for $1 yd.today and tomorrow;50c.Nap-kins for 25c.each;$1.ladies’SilkHoseforonly50c..pair and othergoodsjustascheap,—-ad.i I astaceste soutien 10-quart Buckets at SMITHEY &FRALEY’S for.only 10c.;10¢.Dip- y.5e,;Other g pers’at SMITHEY&FRALEY’s for Cc.C.Broom,a Union county farm- er,45 years old,mentally unbalanced,| committed-suicide by hanging. '10 CENT “CASCARETS”BEST LAXATIVE FORLIVERANDBOWELS. Don’t Stay Constipated,Headachy,|Bilious,With Breath Bad or | |Stomach Sour.| |No odds how bad your liver,stom-| |ach or bowels;how much your head | ‘aches,how miserable and uncomforta-| 00}‘Sursuvsjo a[jyues | poou sapisut ef9qy t1oy3—uoIp[Ly>ayy|qoSLOJ UOT ‘spolBosyA [19s s}sisaSNap|IL “syguoOUL Joy peay“veap>v pu’ssou|-iddey ‘yy[voy guBaut xoq 4uU20-0T V *Kaasiur ay}Suronpoad st yor 10998Ur|F.poyedyjsuos pus sesed ‘ajiq oy}[[e jo[suesio apiIsut ano asuvBalo :ssd.1}SIpIo9yjO[[@ pues YIwerq osaisuayo,‘pjoo peq ‘youuojs Asses ‘anos ‘yoIs ‘ssou “SNOAI@U ‘SSaUIzzIp ‘ssousnorliq ‘ayou pay ay}07 pus ue ynd ‘4y4d1u0}Syo1B9 -SUQ eXVY,‘a[qusostu nod ayewW STemog pue ral ‘yowutoys ano Yof,3,UOd*sROIBOSBD Y}IM jJorjet jos sAvmye noA+—sjomog ysIs8njs pue ssousnoriq ‘uolysedtput ‘uoIyedtysuod ‘pod B WOAy a1 NOx .9{q cured at the request of some of our patrons whohaveheardofit.Don’t miss it.Thursday The eminent dramaticstar,JULIUS STEGERInhisrecentstagesuc-cess, “THE MASTER OF THE HOUSE”- A film drama that goesstraighttotheheart.The admission for any:of the above will be 5.and 10 cents.These areextraordinaryattrac- tions..Try to see all three of them. ‘Lyric Theatre, “Nothing but the best all the time” TO CREDITORS. Having qualified as administrator ‘of the es- tate of W.H.H.Summers,deceased,I herebynotifyallpersonshavingclaimsagainsthis@s- tate to present same to me on or before.the26thdayofJanuary,1917.Those indebted’totheestate-—especially those owing store ac- last week | Grain.| No ad.taken for less than 25) THE FIRST ALL.LOANS MADE 4 AT THE LEGAL | RATE OF INTEREST -ONLY, NATIONAL BA ‘Statesville,N.C.or Capital $100,000.Four Per Cent Paid on Time Deposits.— LIVE asOne or two furnished roonis for |@ New Goods,2 I-2c.:¥ Apply quick with price.|@ ee -~attraetion—and —was—se-—4- counts—are requested to make early settlement.R.B,McLAUGHLIN, Jan,25,1916,Administrator,JUST RECEIVED ‘™ One car Lime,* One.car Cement, Liegritg tee cell Next to Meclilweots ‘ IF SHINGLES COST HALF ALEY’S for 50c.;‘PCT i Ra RAR ood.Axes at er phate ith Planters’.Warehouse,Statesville,Ni G, a Miss Clark.is positively =} | | | ||| \ As much as galvanized Roofing,-don’t| you think my Pine,Cedar and,Cypress |Shingles are worthy of consideration?'|KINS about “EverythinC.WATKINS,*Next/to”McElwee’s|With;”‘phone No.43 andPlanters’:Warehouse,Statesville,N.C.'ly Ford out for you, 5,000 Yards Val and New Hamburg Edgit Round.Thread Lace,and Insertions,Cc. gating.=S :- ~Buy now!-Prices-will be-higher-later,.———ed “U.S.Depository.* ~~15C. \ Johnston-Belk Co :The Store That SellsFor Less.. ains Offering Many “Between Season”Barg ::{foot 12 1-2¢.Toile De Nord”Gingham ......+%;ie 10c.light ‘and dark Outing ..........hee ve 10c:Standard Bleached Domestic 2...20.045 pe BIG LOT OF SHEETS—29e.to 98¢.,full size. PILLOW CASES—10c.,12 1-2c.,18¢.and 28¢.pair.” READY-TO-WEAR DEPARTMENT FULE-OF ~BAR.“GAINS2 oe Coat Suits,Long Coats,Sport Coats,Street Dresses at House Dresses.If interested,this line is worth investi. FIVE-CENT COUNTER FULL OF BARGAINS. Dress Ginghams,Apron-Checks,Prints,“Cannon Clott (short lengths)Cotton Suiting,Quilt Lining,ete. Your opportunity now for White Goods,= One of 12 Big Stores That Sell for Tes °PHONE 212. LAST CAL | J.M.McKee &Compéz If you dantt-ford in to:GO.WAT:| TODAY WINDS UP THE GREAT SACRIFICE SALE OF THE od M.McKee &Co’.s Stock q For today only we have made-further cuts in all depar ments.‘Bargains will be here a-plenty..Ladies’Coa Suits,Coats,Skirts,ete.,going for almost nothing.Don’ fail to:come early..An opportunity like this comies only. once in a lifetime.Yas STATESVILLE,N.C.sg HORSES,MARES|my stables.with|Mares and Mule:Horses’to feto...Build:.Cash ortime...G;fre willglad-|For SALE—Two:}TOMLIN,pi: pias“BOUGHT A FORD! ‘You Can Now Get the Big Comfortable:35.Horsepower Overland for$695 Roadster $675 f.0.be Toledo Demountable rims;with one extra’106-inch wheelbase mi Deep divan upholstery /¢ One-man top;top cover | En bloc 35 horsepower motor Electric starting and lighting system Electric control buttons on steering column Four inch tires :aa FO EN : CE N Ee ee e . se mE A eo Me e e — er ae ee a Ho So e i ss s : ~ — —- * > } - aT 4 iri 7 é42a| £ i f we¥ ay JL: #Model 86,Six-Cylinder Seven- With unerring judgment of value With a rush that swallowed up a record production in jig time— The public took more than 50,000 of the $7506 Overlands in six months. In six monthswe’ve absorbed all the ‘overhead;absorbed all the develop- ment expense;realized on all the ex- perimental cost that is usually spread . over a year. We covered our material require- ments at before-the-war prices—saved three and a half million dollars on aluminum and another million on steel. We have increased our production capacity of 300 cars per day last June|tol 000 cars per day. ‘Model“8hB,Willys-Knight TouringCar,40 H.PSmaB,Willys Knight Roadster,40 H.P., ALL THESE CARS NOW ON EXHIBITION AT THE~™a CAROLINAMOTOR COMPANY,4MOORESVILLE~ Passenger Touring Car,50 H.P., “Model'83.Bo teen So again we have broken aii records. Again we have planned and bought material —-for—a~—bigger--productionprogram.‘pai And again we are setting a new and supreme ounce of value— You can now bud the big,roomy,comfortable,thirty-five horsepowerOverlandfor$698: Hereis the value which has clearly dominated the automobile market for the last six months—now made even more clearly dominant.| Here is the car with a performance record never even approached by any carof its size ever built—fifty thousand in every day service.> And though the price is reduced the car is improved. It-has-an -up-to-the-minute-power |plant,en bloc type,developing fullthirty-five horsepower.It has abun- dant power and speed and an exception- ally quick get-away. The value is pre-eminent—un-approached. We guarantee that the price for this | imodel will never be lower. But this price reductionis made in the face of a rising material market—we cannot guarantee that it will not behigher. See’the Overland dealer”:now—an-) ticipate your requirement if need be‘but amake'sure of your delivery.now. ‘OTR ER MODELS $1,150|Model 75,Touring Car,25 H.P,,1,135|Model 75,Roadster,25.P.1,100 STATESVILLE “Madein U.S.A”, OMT (F.0.B.DETROIT.)© he Willys-Overland peneToledo,Chio a vay iFN Baier een iL pk begetl 1 -*BBLACK-WHITE-TANAG | *Contain no acid and thus keep the leather soft,protecting it against ‘‘eracking.They combine liquid and paste in a paste formand requiro only half the effort for a brilliant lasting shine.Easy to use for all the family—children and adults.Shine your shoes at home and keep them neat.F.F.DALLEY¢:Buffalo,N.¥.CeLed, KEEPYOUR SHO aNEAT 4 “Special Sale N |Meeting at Cool Spring T “The Cooking Class —Spring News. Correspondenceof ‘The Landmark, Cool Spring,Jan,24—-A numberoftheladiesofthecommunitymetat|the school Thursday afternoon and dis-|cussed the organization of a Commv-|dnity Service club.Theydecided that|it would be _beneficial,to.the’.com-'munity and school and they:ask all)the ladies to-meet with-them-Tues-day,January 25th,at:2.30.o’clock,| for the purpose of organizing.the:slub.The cooking class served:the: ‘adios with hot chocolate and ¢ake.| Every one.thoroughly’enjoyed the) occasion and all wished very.muchthattheymightbeinvitedtovisitthe ceoking class kitchenette again. The cooking class has fixed up one of the rooms not in use into a little kitchen,and they-all enjoy their les-sons very much,Miss Adsh Canter ~is; teacher at Olin,She spent the weék-Aiend at home.Mrs.Webber of Scott's lis visiting her ‘daughter,Mrs.Goode. 8 Miss Annie Lazenby,who has¢been teaching at Linville Falls,has..com-BE ploted her work and is at home again, 'She expects to visit in Statesville’ aoH lest debate on international questionslsinceCongress.convened..-Great.Brit- liberation to await justice from cool-| assistant, lreople without.food:from the United sostareanastuvasepyosvatia.tava tally {x SENATORS ON WAR ISSUES.|-——=|Sinith Would Punish Great Brit.ain For Interference With).Commerce*-—Williams:Makes} .Answer.1 ‘Issues “arising from the EuropeanWarworediscussed‘without restraintintheS€hate Thursday in the warm- ain’s interference with Americantradewascharacterizedas.“perpet-val robbery;”Germany was brandedas“guilty of murder,”plans madefor_an_embargo on munitions and’foodstuffs.to-Engleand-and--chargesweremadeanddeniedthatBritish|‘ors intercepted American mail to) censorstake-advantage-of-trade ‘secrets.|Possibility of war to enforce Amer-|THE GOWAN MEDICAL COMPANY, Gowaas Penet Don't take chances with coughs,colds,croup—thedevelopsedisea:andMm»penetrate,‘There's one treatmentthat is more powerfulolvatesquicker0LececactanehenanywieThat's why thousaads whohaveence used itaxepo.praise 6 :GOWApease .&Thave been inthe retail drug business for tw__which time Thave sold,as well as used,itiewey Toe cines.{must say,however,that Gowans Preparation is the best1haveeveruzedotsoldforthe’yseforwhichitis recommended.I I it my duty as well as meee ro recom ‘ oe Lg ican rights did not vscape attention.| But the suggestion oY war was coun-| Steers terbalanced with appeal for caim de-| ‘er heads after the belligerents had ye-| ‘covered from war madness. Dehato was precipitated by Sena-| itor Hoke Smith of Georgia,who deliv- ered a long prepared speech denoune«|ing Great Britain’s course in holding inp neutral commerce and particularly iher interference with cotton shipments to Germany.He proposed an embar- vo against England,who he said could‘not continue the war without muni- "tions from this country,nor feed her ;q.7 :: |sari Ries a ill..States and other neutrals.His vigor- eee iy Mee See A jous assault upon England’s-attitude I |Lazenbv’s.‘He expects to fe.Was endorsed by Senator Borah of Ida- aE:peat 7 .ho,who said he was willing to take re-| turn to Linville Falls in a few days-|vbnsibility for.“action,not speech,” |{a;Mr Suddert just ::|Mr.R.H.Sudderth,who has just “9 protect American rights.but fear- | {| B recontly «moved ‘into.ov muntunity,|:2Birecontly‘moved ‘int aT ee nity,od embargo legislation could!not:be| ipassed by Congress.| |From Senator John Sharp Williams| ithe Georgia Senator’s utterances drew %A ‘a stirting reply,with:a declaration Settee a that he was not willing to-go to war : for mere dollars nor to have the “peo- iple of Dixie”placed in an.attitude of jholdine property on a plane with.hu- man life.Senator Williams said until ithe issue of murdered Amerigan wo- |S os Ean ‘men and children on the high seasf_Sdtial Service Conference.was settléd.“he would not nag_the The Social Service Conference For |President of the United States about B |wvas called to the bedside of his moth- |Many of the friends of Miss Ger- Ri trude Edwards will be glad.to know that,she.is better than.she was.at |Christmas.Miss Ella Moore has been i |sick for several days,but we are glad || Few of these Cabinets left,at a real Bargain.°. Good many other articles at,closc-| out prices.ie Bishe is well again, :;Miss Roberta Moore spent the week- ;.ree et none.Miss Moore likes her ..ee 3 work at Vance very much.:$1.50 Eclipse Shirts,Special Sale Price--$1.00 Eelipse Shirts,Specia!Sale Price Neerentretrarery attem ree settle- SPECIAL PRICES ARE CAS f ‘crest Nomerous able speakers,wil 77)appeal to their calmer Jouemen’|“TE he Williams Furniture House. ;#fare of mankind and tne general uplift when war had ceased,:pra eS ee :3 ie ——’PHONE NO.&88.———;jof humanity.— oe 5|Among ms speakers who will be,“Consuls Released.: ‘A wresent or who have already spoken at’SREEeTtgtestEtetteseTeaeTeeaeeTee teeee SHERRILL-WHITE SHOE CO y Through the good offices --of the!CommercialNational Bal . a1 he-conference,which_began Sunday,|1nited-States.the-German,Austrian, |a William L.Poteat,president |Turkish and Bulgarian consuls at Sa- lof Wake Forest Coliege;Dr.Walter |joniki,who have been held under ar- |--PHONE 23.— ys1 =|FOR SALE![=]_ 300-acte Alexander County’Farm,near school and churches,near- est:railroad station six miles,fronting on both sides of public road,soil and location well adapted for fruit,grain and stock farming.Over two hundred fruit’trees.|Two-story,6ix-room dwelling,two tenant houses,barn and out-buildings.Well .water- ed by branches and springs.150 acres in cultivation, level and productive,balance in woodland which will cut over one hundred thousand feet ‘of timber,Bargain at $17,00 per acre.” miles from Statesville,ad-Seventy-eight acres one and one-half Forty—acres-in-cultivation,joining the State Experiment Farm, level.and “productive,five of which is branch bottom, ‘woodland.Three-room cottage,small barn,two branches. located for dairy and truck farming.; For further.information call on or write,ERNEST G.GANTHER,6°25 SEQRAN___OFFICE NO._1, Well eS The Statesville Realty &faveuinent Co." INSURANCE!=——= As-a great many policyholders do-not—seem—to—know_that their insurance will be void under certain conditions named in the contract.of the policy which they buy.We decm it advisable to mention some of the causes under which the same will be rendered valueless,viz:1—Vacant or idle property for longer than.30 days—apply to your agent fer permit.eee :2 Aechinics Making additions to,or extraordinary altera- tions.in or on proferty—always get permits from agents. 8—Property upon which there is a mortgage unless notice of same is given—apply to your agent.:; 4—Any change in the title or ownership, ty insured other than by death.a 5—Assignment or transfer of property to another. 6—By any increase i hazard,notice must be given. q—The taking of0 ‘urance withoutnotice. 8—Keeping-explosives-on_the premises_without permit other than kerosene oil..~La 7 9—Property encumbered by chattle mortgage. Policyholders should read lines 7 to 30 of the printed contract of their policies.It is impossible for agents to know of these de- jencies_unless_notified.—Call-on us for any INSURANCE infor- or interest in proper- mation.eee i “WE INSURE ANYTHING INSURABLE.” J.F.CARLTON,Manager, ‘PHONE 54.STATESVILLE,_N._C. generally © GENERAL INSURANCE,RENT- MILLSBUILDING._ HONRAATRTAST ;Seal i $:; ia Se Lingle,of thy Union Theological rest by the allies on board a French ace Es ;,|warship in the harbor,are to be re-rainary;Dr.J.Y.voyner,superin-endent_of public instruction;Dr.Clar-nee Poe,-Dr.E.K.Graham;president of the University of*|Gov.LoéKe Craig,Bishop Thomas:C. A,Darst,Mr.W.H.Swift of Greensboro; RiMiss Julia Lathrop,director of Chil-|fidren’s Bureau of the Department of 8}Labor of the United States,Washing- ton,D..C.;Mrs.Thomas W..Lingle, ;president of the North Carolina’Feder-A ation of Woman’s Clubs;Miss.Ella.P.H\GCrandall,executive secretary of ‘the |What's Heap of Happiness it Would : 8'National Oragnization for Pablie |Health Nursing,New York;Dr.W.S. balance in:# | fe| m |Greensboro; @ |Charlctte;4 president of the Conference;Dr. /People’s ad Issued by this bank bear interest from _date at the rate of 4 per cent per an- num.Savings Deposits 4 per cent, credited quarterly. Checking Accounts — either large or small cordially invited. We want your business.~ FICELoanand Savings Bank. x De e ee e e s e s e e s s e e s e s e e e s e e s e s s e s e r s o o r e g p o a e 29 9 9 0 0 9 0 09 0 0 0 0 0 00 0 0 S CS T e et e e ee s ee s es t e s sling. H |WheneverYou Need aGeneral Tonic $F tg © i chill Tonic is equally valuable as a H |well known tonic Rankin,seeretary of the State Board iof Health;Dr,J.I.Foust,president of ithe State Normal and Industrial Col- ‘lege,Greensboro;Dr.L.B.McBray- ier,superintendent of.the State Sana- torium;«Dr-»Charles W..Byrd, Mr.Heriot Clarkson,Mr.A.W.McAllister,Mel-‘ton Clark of Greensboro and a number tof ‘other speakers of ability and repu- |tation. »Last Letter:Front Dead Son. The Monroe Journal says that Mrs.McNeely of Union county,the mother ,of Mr.Robert Ney McNeely,the |United.States consul who lost his life told:of her son’s death.A few days !before news of the wreck of the Per- lsia was received,Mrs.McNeély suf- she_has since.improved and it was de-cided to tell her of her son’s death.~ Three days’ago,says the ‘Journal, Mis.MeNeely received the last letter {from her son:It was dated at Malta, \December 27th,three days before.the sinking of the Persia. as the others had done,assured her ofhissafety,._It_said.that he -had_beeenassignedtostateroomNo.2 and life-boat.No.4,in case of accident.TheStateDepartment.at.Washington con- itinues to seek news regarding the lossofthePersia,but nothing has been jlearned.It is not even known the na-tionality-of-the-submarine-which-sunk North Carolina;| in-the-wreck -of—the-Persia,_has_been. ifered a~streké of paraylsis—a .sec jond stroke.Contrary to expectation,| This letters} I Doan’s Kidney Pitts=the~-same~that+ ‘leased...The...consuls,were arrested.‘soon after the military occupation of 'Saloniki on the charge that they were communicating military infor- ‘mation to the Bulgarians.The condi- tion of ‘release will be that the con- pale must return to their home coun- _tries. |IF WOMEN ONLY KNEW. |Bring to Statesville Homes. |Hard to do housework with an ach- ling back.: Brings your hours of misery at lei- (sure.or at work- If women only knew the cause— that Backache pains often come from weak kidneys,> ’Twould save much needless woe. kidneys. says: Bell St.,Statesville,says:sharp-pains—across—my—kidneys—and rheumatic twinges in my limbs and me to try Doan’s Kidney Pills and I} got a supply from the Statesville| i Drug Co.After taking a few doses,| |}was-relieved-of the pain in-my back and the rheumatic twinges disappear- ed.Whenever I have any sign of! kidney trouble now,I use Doan’s Kid-! ney Pills and they do me good.” Price 50c,—at all_-dealers...Don’t simply ask for a,kidney remedy—get} Mrs.Fespermanhad.Foster-Milburn Doan’s Kidney Pills are,for weak fi Read what a Statesville citizen Mrs.Eugene Fesperman,328.W./§“T had'§ shoulders.One of the family advised| OF STATESVILLE,N.0. Capital Stock Paid in -$100,000.00 Surplas and Profits—31,500.00 Members of Federal Reserve System.a t : Your Banking business solicited and every accommodation extended to de- positors consistent with prudent bank- ing methods.cag Four per cent.paidon timeandSavings._ Deposits remaining on deposit'three — months or longer. ‘OFFICERS: W.D.TURNER,E,MORRISON,—=D..M.AUSLEY,-—@.BE.HUGHEY,-Assistant Cashier. rePPPPELTLLIFTTIL LILITITIots eeeLIEhsheseeAasened Co.,Props.,Buffalo,N.Y: the ship,or indeed wh@ther or not it'|was a submarine.~-| Wilson Urged to Appoint Negro.| President Wilson has received an! open letter from Bishop -Alexander| Walters of the®-African Methodist| Episcopal Church,president of the negro Democratic League,requesting; him to appoint a negro toa prominent, position in the Federal service to test the attitude of the Senate towards naming them officeholders.The Pres#ident has been urged to.appoint a’ne-gro register--of-deeds of the District:of Columbia but is reluctant to do so because it will stir racial feeling.intheSenate.Senator Vardaman of Mis~ Senate.Senator Vardaman of Mis- sissippi has notified the President that he will fight the confirmation of any. negro appointed to office.« RO HTSTRETTONIEOTT The Sane and Safe Place. Salisbury Post.;ai Senator Cummins of Iowa wants a “zone of sanity”.preparedness some- where “between William*of Prussia and-William.of Nebraska.”This_is about where the average man stands. He wants his country prepared and ready for whatever ib likely to hap- pen,but he does not’want-the milita- rists and extremists:to do the.driv- taal ‘ake Grove’s ‘The Old Standard Grove’s Tasteless General ‘Tonic because it contains the il We have choice Flowers Roses,Narcissus,| Hyacinths Three lovely Flowers in beautiful Bloom,ready to be sent out the moment your order reachesus.Our Greenhouse andstore have the apetrane of summer, and when you enter.these places you forget that the weather very often is play-ing around the zero mars. throughout the cold weath- erin as beautiful variety as summer.\Ours:is\a Flower Plant-prepared to serve you:the year roundLwiththeutmostsatis-faction.- Van Lindley Co., GEEENSBORO,a.6. propertiesofndIRON.nePeete tee,Driria,Enriches’the Blood.the Whole System:50car‘amaae i wateBuliastp é BUILDING?C.WATKINS.| “YOU SHOULD SEE OUR ~ ISPLAY-OF-QUALITY STATIOR By the Pound,the Box and ia Correspondence Cards. All the newest designs and colors.|Sees |Statesville Drug Comp’y, Quality Prescriptionists.| PooL0S0S00S eee Te ere titesees 8 7%aie 8 *asTimberBoundaries!- Weare in the market for STANDING TIMBER: «s \\Writeor’phone’us..|6 a BOYCE LUMBER CO.Geo.H.Myers, PHONES:;RESIDENCE i Vice Pres.and Manager That’s what I always try to give.Alt “notsatisfied’ again.Timeis money.Why not buy yourself ‘some. for 1916.Ihave time,from $1 00 up. *-Parts of the Country. +Furman D.Updike,the Chicago millionaire,whose two sons confessed ;slotting to murder him,their moth- pe 9 oa sister,has forgiven the boys and will employa lawyer.to defend them,«The boys are in jail. By a vote of 61 to 51 the lower house of the South Carolina ‘General Agsembly-defeated-a-resolution calling for,the submission of a woman ‘suf- fvage constitutional amendment at the next general election. ..Recommendations for the dismissal of Thomas N.Davis of South Carolina, F,J.Kelley,Jr.,of Brooklyn, fe the Naval Academy,have been placed before the President.A court martial.found them guilty of infrac- tions of the rules.‘ Will J.Hughes,wanted in Spartan- burg county,S.C.,for the murder of Robert.Stephens,a chain gang guard, whom he killed with a shovel,rob- ~hed him of his gun and money and es- eaped,in the fall of 1914,was arrest- ed-in New Orleans a few days ago. ‘fhe President and Mrs,Wilson spent Saturday and Sunday cruising on the Potomac river in the presiden- tial yacht,the Mayflower.The Pres- ;ident sought the seclusion to prepare the address he.will deliver on his coming tour..The only stop made was at Yorktown,Va. Owing to uncertainty regarding the movement of slides in Galliard Cut,the Panama canal is not ready to be re-opened,nor can a prediction as.to its prospective re-opening be made,according to a statement.is- sued by Governor Goethals of the -Canal zone./ Mrs.Edwin Payne,36 years old, hanged her 4-year-old daughter,her 2-year-old son and herself with three separate pieces of clothes line attach- ed to a hook in the ceiling of the fam- ~jly home in Alloway,three miles from Lyon,N.Y.The-husband found the dead bodies when he returned home from work. ;Gold medals for meritorious service to humanity during the past year were awarded at the annual mecting ine New York of the National Insti- tute of Social Sciences to Mrs.Helen Hartley.Jenkins,who built the Ser- bian-home .of’refuge,and to Robert 3acon,former ambassador to Trance, for his efforts to better humanity. ,Bronze medals were awarded a num- ber of other persons for meritorious My é BEPVICES enn eee Edward ‘Higgins,United States con- sul at Stuttgart,Germany,will be re- -ealled on.leave of absence because of the fact that he has rendered himself (objectionable to the German authori- ties.Consul Higgins,the Siate De- partment has been informed,has been outspoken in favor of the allies and ,has embarrassed members of the ‘American colony in Stuttgart by his alleged indiscreet criticism of the Germans.: ‘Five negroes held in connection with the recent killing ot Sheriff More- land.of Lee county,Ga.,were taken »»from the Worth county jail at Sylves- ter,Ga.,by a mob of some 50 men and carried away‘in automobiles.The ne- groes had.been brought to Sylvester from Doles,Ga:,for-safe-keeping.A sixth negro sought by the mob, _said to be the guiltiest of the lot,had been taken to Moultrie,Ga.,and es- caped the fate of the others.The five were hung from the same tree. ‘Twenty-three persons were —killed “near Puebla,Mexico,recently,when a passenger train was blown up,sup- edly by Zapata adherents,accord- ing to A.J.Trumbo,wealthy mine ownet of the State of Oaxaca,Mex., “who has arrived at El “Paso,Texas. Trumbo says several volleys were fired:into the train and_that only one passenger survived,He also says -that anarchy exists in Oaxaca and that “Americans are frequently killed and their -property—destroyed. “Miss Elizabeth C.Biggs,national field secretary of the Florefice Crit~ ‘tendon Home,has filed suit in New ork city for $10,000 damages from Marie B.Clapsattle,of Lockport,N. -¥j for injuries~suffered at Asheville, aN.G.,on February 20 last.Miss Biggs says that while she was_rid-ing on a street car in Asheville the defendant carelessly fell—over her; her _knee-cap_was injured and that she spent $2,000 in medical treatment and lest her salary of $25 a week for six _months._i i Snow—Six Lives Lost. jured early Saturday when the west-“bound Great Northern Cascade Lim- riear Corea station,Wnsh.,on the persons are still missing who are be-*eTO?.AMERY lieved to be dead.The Great North-Se eee i ~~3 ern has 200 men at Corea digging in|Sufferers Find Swift Relief by Use x.3 the snow for pai ge an of Remarkable Treatment.H 1%“a *° flecks the Oe eraccntnenal ne Stomach sufferers in ws MA ¥i Railroad officials said the road would,pa "ke soe ee ee oa:. not be open until today.A pasenger|N&VE Poune SO ae and efficient oo = Who was on the train says the snow|Lesults from the use of Mayr’s,Won-1 3 =-(aoe os y :ios Wee eea eel ern GET ULRCMeUys ufos Te iS ::4 _Mgored inthrough windowslikeator-|“Many have taken this remedy and #4.All the Auto-ones are manufactured in iH Mt ine stint caninlate.(tell today of the benefits they recciv-#AIL ake eee —o /Seen See eee eetene rey |68.Its effects come quickly—the first ¥thei entirety —=DaSIC plano ‘and play eY “necessarily slow and some of the |ose convince.Ifere is what two.gt mechanism—under one management and 4 neers were ulmost froze hen |Carolina.folks have.written:4 _.::+ ere were almost frozen wien)W.R.DAVENPORT;Parker,N.C..8 yractically in-the same plant-therefore be- oo “Poy [1 fered f #‘-“Foy yearsf have suffere om a}Bess ::m :Wipe rab,REWARD.$100.Viccdce Hin powdled doetors 1 ing complete in themselvés.There is no : :aders of this or will bed}eng of wour remedy 1 /7 of.fe .AZ f wa to learn that thereis at leam {heard of your remedy and one bottle §COMBINATION of a piano-of ONE MAKIs : dreaded disedfise that science has |vave me_relief.Your full treatment ;‘1K)’~5 bo.abletocureiffall Its stegos.and that has about gamed mc.”;with a player action of ANOTHER,but j i wn ti .J.T.,Wins Salem,N.!:°Hh :q .ly positive cure now known to the|J.T.AQWIN,Winston Salem,N EVERY Autotone is the result of unity of ical fraternity.Catarrh being a conutionaldisease,requires a consti-nal treatment,Acts and muccus surfaces cf ‘the disease,and giving the pa-rength by building up the con-ion and assisting nature inork.The proprietors have so mucthey on. Send list 4 CHENEY &CO.,Tole- Prugetste.Tc.‘Pils forgeviyMtBases fails to cure.for KX (MOORESVILLE CREAMERY, yy ting—A-Thriving --Town,- ants Gathered From <All) Buried in Avalanche of Six persons were killed and five in- ited train was struck by an avalanche ‘west slope of the Cascade mountains,gqnd two cars—thé diner and a‘daycoach—were swept down the moun- tain side and a sleeper topvled over. Four bodies were recovered and two Hall's Catarrh Cure | nternally,acting directly pop } the } m,thereby destroying the founda-| doting <in tts curative mowers that t i Rubarés Dollars fOr “any case’the stomach and around constipation. An Enterprise That,is Succeed- A.r CGline-in Winston-Salem Senti-nel.:The Mooresville co-operative’cream-ery began operation in January;-1915; and has grown steadily ever since.At present they are manufacturing 15,000 pounds of butter monthly.Last sum- mer for a few months the output amounted to 35,000,pounds a months The creamery is pow paying 29 and 30 cents per pound for butter fat and selling at 31 and 32 cents.‘Phe cost, of delivering the cream to the ¢ream-ery is about 2 1-2 cents per pound. The présént’output—is—all being sold as rapidly as manufactured and or- ders-are—being turned down.All the ||| exception of about 1,000 pounds,is hauled in from the surrounding coun- try.Buttermilk is sold for home use at 5 cents per gallon and the refuse} at 2 cents per gallon for hog.and} chicken feed.The creamery is locat-; ed in a splendid new brick building huilt especially for the creamery.Mr. L .R.Coombs of Illinois is the butter- maker.Mr.Coombs is a graduate in butt@r ‘making and thoroughly under-| stands the business. Wherever introduced Mooresville; “Autumn...Leaf”butter has made per- manent customers.The output is marketed fresh and the consumer,is always sure that no stale butter ~is being put off on him.The greatest care is exercised to make the butter absolutely pure.The interior of the creamery is as neat and clean as it-is possible to make it.\ The origin of the Mooresville co-| operative creamery is quite an inter-| esting story.About five years ago a co-onerative creamery was established at Hickory and representatives tour- ed Iredell county urging the farmers to hbuv cows and ship the butter fat to Hickory.A great many farmers were induced to take up this method of disposing of their butter fat.After! 18 months of furnishing cream to the creamery at Hickory,the farmers of the Mooresville section decided to tinnd themselves-together-and—manu- facture their own butter and as a re- sult of their determination the Mooresville co-onerative creamery was.organized.Within ten days af- ter a eall for stock was made $6.000 had been subseribed at $25 per share, only four shares beingrallowed to any one stockholder,making the plant purely co-operative. Mooresville is one of the most vro- gressive towns in North Carolina, having a population of nearly 5,000. Recently 2 new water and sewer sys- tem was installed,handsome_streets Jwere..builtall_over.the town.and..a) “Great White Way”installed.These| improvements —cost approximately | about $65,000.All wooden poles have| heen removed from the business sec-| tion of the town and wires have heen| placed underground.The “White!Way”is one of the prettiest in the) State.Handsome globes are surmount-| ed on tall iron posts along the main! street,creating a beautiful effect) when the lights are turned:on.\ -A numbr of important.industries+ are located in Mooresville,including four cotton mills,two flour mills,two cotton seed oil mills,furniture facto- ries,lumber plant,mattress factory and other smaHer industries.Business| is good in Mooresville.Al!factories hre running on full time,paying pood wages and finding ready markets for. their products.Mooresville is not talking hard times.———————— The latest report«from Villa,the Mexican bandit,is that he denies re-| sponsibility for the recent massacre| »f Americans in Mexico and that hehas:taken another wife.He has aj wife in Cuba and probably several others at different points. There were 22,549 atcidents in thecityofNewYork-during 1945,in which 659 persons were killed ,and 23,821 injured.Forty-four per cent. of those killed were children. nobile accidents drawn vehicles.100. ~Constipation and Indigestion. .“TE have used Chamberlain's Tablets must say they are the best I have ever used ‘for and | Trrrsrtiiitestes cream used at this creamery,with the}fas XD1MR.A 4 4rescent Tomorrow :AND MRS.VERNON CASTLE, America’s Most Famous Couple--The;World’s Greatest Dancers,HIRL OF LIFE”In Six PartsCe The Castles in their favorite Dance, rom “The Whirl of Life.” The “Pull of Pep Girls”of the Cafe De Paris,scene from “The Whirl of Life,”starring Mr.and Mrs.Vernon Castle at Crescent Theatre,Wednesday,Jfanuary 26th. A thrilling melodramatic story based on the actual, though almost unbelievable,experience —of the “CASTLES.” You will see Mrs.CASTLE in-all of her latest gowns, creations of “LUCILLE’—LADY DUFEF GORDON.She is known as “America’s Fashion Leader,”spending over SCANCCITyeeMeth i Twelve fishermen,all said ty be! before the present-war,-and for the Victrola people. comedy. 20e, ported by_a very capable cast, and KATHRYN BROWNE It’s useless for us to try would be impossible. made by the famousi he has attempted some great is his first one in six parts, 96,000 separate pictures that You can imagine the cost. ural colors. In this picture you will above and will pronounce it “ —The Picture De Luxe.” 20e. _$50,000 a yearon her gowns alone.: Tn this-pieture-you_willseea real novelty and get a “Peep in”at.the gay night life in the “CAFE-DePARIS”— came famous there in a single night. You will see “THE PEOPLE,WITH THE MILLIO DOLLAR FEET,”who make all of the dancing records.. _This picture opened at the Globe-Theatre,New York city,and played to tremendous business scored the:biggest kind of a triumph, The New York Sun says—‘'The picture was a greatsueeess,.Qut.thrilled the biggest thrill in-the movies,”“VARIETY”says-—“The Whirl of Life’is’a whoop-ing big Film success—of the scarcest sort—high-grade This picture will be shown one day only at 10e¢.and eOnFriday,January 28,_WE WILL PRESENT A PATHE GOLD ROOSTER HAND-COLORED PICTURE, ‘6°had .‘The Beloved Vagabond”:IN SIX PARTS. This picture features EDWIN ARDEN,who is sup- -DECKER. :It is’enough to say.that it ‘was ‘rench producer,PATHE,and,while Every tint of the flowers,ev-ery color of the costumes,is shown in actual colors.if you don’t care for moving pictures,splendid actingandan,ideal story,you do care for beautiful scenery,~-beautifulflowers-andbeattifed ecostumes;-altin-their nat= see perfection in all of the This Picture will be shown for one day at10e.and see how the C ASTLES he- a at 25¢..to $1 and ineluding-BLISS‘MILFORD to describe this picture.It hand-colored pittures,this In this picture there are had to be painted by hand. The last word in Pictures,’”” LS A | r;negroes,who left Mount Pleasant,S. \C.,Friday morning in a power-boat and have not since been heard from, aIre 7 GR TURTON OTE An TOaNTRRTE BUG are believed to have been drowned. Invigora Malaria,enrithes theAtrueTonic. ting to the Pale and Sickly da t ent in For adul gov &czema Saxo Salve Auto-'to stop the itching and begin healinkilled.178,‘horse-|with the first application or return Vout'money.There are lots of skin remeé|dies but Saxo is the only one they guar-||antee like this,Why don’t you try it? ST O T T FO OI T A UT E T and other Skin Troubles —We Guarantee CU D UR U I R U N U R O T O T OM T *W.F.HALL,DRUGGIST,> Jim McCall,a negro youth and an| lex-convict,arrested in Harnett coun- ty for criminally assaulting a 7-year- old white-girl,was hurriedly taken-to the State prison to.avoid possibility of lynching. Cures Old Sores,Other Remedies Won't Core The worst cases,no matter of how long standing,7 are cured by the wonderful,“ott reliable”Dr? Porter’s Antiseptic Healing Oil.It relieves Paice co?Ueale rt the sacie tine.eo.Re,$1,007aR ir“~|In Winston -Salem Sunday after- noon Policeman Whiteheart was shot and dangerously wounded by an un- known negro,who made his escape.| The officer thought he recognized the negro-as oné?wanted for crime and caught him by the arm.Instantly the negro shot the officer and fled. CAROLINA PEOPLE TELU | iC.—AT amsatiéfied through personal use of the powers ‘of your .remedy. You have saved my life.” Mayr’s Wonderful Remedy—gives pérmanent results for stomach,liver |and intestinal ailments.Hat as much-'and whatever you like.No-more dis- |tress after eating,pressure of gas in the heart. |Get one bottle of your druggist now |and try -it.on an absolute guaranteeffnotsatisfactorymoneywillbe, |returned,j SPSLA TAR AAR ETAL TSS,AAO LY 2 dl DEES Tv | posesgacpesesencsaeeetereed St t s o e s e s MAKING PREPARA We are receiving daily and making preparation for our ~ Amuual Big Winter Sale,which will consistof the FAMOUS ROYAL MUSLIN UNDERWEAR,and all kinds of White and Colored Wash Fabrics for early spring sewing. in the meantime don’t forget the Bargains we are offer- ing on our Remnant Counter.| Yours truly, TION!| Ni v e ON T FP S Ta x i r RY A N T@ X Ra OX V O N R IS “T e constipation~and indigestion.My wife also Statcexitie.————::” used them for indigestion and they did her}E asa emerge : edod,”"writes.Eugene S.Knight,Wilming-|EA ——L = ‘am N.C.Obtainable everywhere.i oS ='*e :c Ee Is SSTSTS a|Spraor SSIS IG STRESS TO,Take off your flat ti'The {Ee SERA SSAC HANMpa Ml MESSNSMS MANNE EST.PUMP_ON EARTH — Ayers!” “s - Don’gc through 1916 without pultirg ina Myers Pump.Com- plete stock on hand of pumps and repairs for all make pumps. Headquarters for plumbing and wator supplies.W.BE.MUNDAY. FOR SALE BY,~ Lazenby-Montgomery Hardware Co., Statesvilic,N.C.Phone 59.munemeenenens — Subseribe for Thit LANDMARK. ” SEITELLISTEA TILT ETT TTBSTTIIIITIIIAIIE Lo e s e e s e . workmanship and warranty,which.places it beyond competition. FOR SALE—CASH OR EASY TERMS Carlton A.Andrews, 547 South Center St._.Manufacturer’s Agent. russazsaussssedsauuagestcnensesansagneconaseaneseatennsyagtaseszieiteseet203t L'% st 33 Cr t si r HW Interior and Exterior! FOALS wis PY TA ge“for and BD S.,M.&H.ShoeCo.| Shoe Repairing. work done by our expert 4 shoe repairer.It only & takes him 15 to 20 min-& utes to tack or sew on a pair of half soles.Plen- ‘ty of comfortable seats you can have work done while-you wait.. in-town shoes called delivered. Remember-we shine -shoes free. FIRE-PROOF PAINTS! ¢Tf you don’t ‘believe they are fire-proof;-will cover more space per gallon and last long- fer than any other paint,C.WAT- KINS can prove,it ‘at Watkins’Lium- jber Yard.Next to McElwee’s:Plant ers’Warehouse,Statesville,N.C. “|DOORS;WINDOWS,BLINDS. Stairways,Mouldings and aeboughtfromanyof.the WATKINS.-Lumber Yards are.good and —stay good, the same manufacturer for 34 years.©.WATKINS,Next to McElwee's:‘Planters’Warehouse,Statesville,N.C, Have your shoe repair § We-have been buying from_ ei oe ae4 vf}% pe +; ey 3 3 :maeecls none)*aos mete a ‘‘ . *|j \ ies a 4 :i ‘ STATESVILLE,N.C.,FRIDAY,JANUARY 28,1916, IGURES WERE WRONG 1915,Not $6.91. not unmixed with indignation, cal advantage,when they ~read $6.91,may calm themselves. $2.19.-Inl915 it was $2.49; tess than $6.91. figures at the court house,or from the tate—fax Commission report,take -the-population -of -the county by the last census—34,315—and figure forhimself. The total taxes.levied in Iredell in1915:-for all.purposes——State,schools and_county,which ineludes special dis- trict school taxes,township bond rail- road taxes,etc.—amount to $171,876.- 66,Divided by the population of the county this gives &per capita of $5.- 01 for all purposes.The State tax for the county amounts-to 83 cents Some county dnd township taxes.to $2.49.The taxes paid in the county by rail- “roads and other public service corpor-|ations amount to about —$1per, ta;:so that the-actualamount:p:the people is $1.49 instead of $2.49. The University News Letter~-is ed- *ited ‘by a member of the faculty of) *the State University and the editor, information The digs up much _valuable.about the State,some:of which Landmark has-been glad to Coming from that question.When the table giving the in the State appeared in the.NewsLetter,while the cost for Iredell seem- ed a trifle high.the News Letter gave ».?The Landmark passed it on without |...the figures.But it is never safe to ac- of the readers recovered from “off;A little reflection would haveshownthat,but The Landmark, stated,didn’t stop to give the figures ah thought. 'A Statesville man who is strong on +figures has made outa table showing: that in only 29 counties in the State, $2. $2.19¢ 41,Forsyth is.second with $3.68, Mecklenburg.third with $3.44,the lit- tle county of Cherokee.in the extreme western part of the State,is fourth with $3.39,and New Hanover is fifth The remaining 24 coun-with$3.30. ties are under sees from §$2.- oe -98-in Henderson to$2.03 in Wilson. ital out of the News ities in that connection, has been mentioned it may he/ —Cherokee,Henderson. Dowell and Cabarrus. Fe s |.ments Iredell has .The average _per ~ ties of the State thez 88°1-2—one cent “higher>=a tion,school supervisor,health work, worth the money they cost. —are higher.not _progressive—whether or Democratic—the taxes axg lower. County progress should not be a mat-| ter of politics but of good citizenship; nty Tax Per€Capita in Ire- Hell $2.19 in 1914 and $2.49.in Those who raised a shout of alarm, and those who gleefully anticipated politi- the University News Letter story in the last issue of The Landmark,in which it was stated that the:per capita cost of county government ‘in Iredell was >The figures were wrong!All taxes ’collected in Iredell in 1914 for county purposes~show-a--per—capita-cost of Anybody can get the per) capita,the school tax to $1.69 and the; ee with the assistance of the students,|; print “yer capitaeost of county government’ this county such asplendid:boost that giving a thought to the correctness of *cept the other man’s figures,As.soon“as The Landmark appeared and pepethe “shock:the $6.91 gave them,they be- gan to figure,and to demonstrate that the News Letter figures were badly “as based on 1914 taxes,does the per cap- ita—taxfor—ecounty—purposes—-exceed- Iredell is 23d in this list—the fig- ures for this county that year being The highest is Durham—#3.- Some of the Tredell Republicans,it is said,got busy trying to make cap-Letter’s error. —The-Landmark had no thought of pol-|.but since it said that in the list of 29 counties mention- ed there are five Republican countiesSwain,Mce- The per capita county tax:in Cherokee is $3.an Hen- neither county has the public improve- capita county tax in the State is $1.- 87 1-2 and in the 23 Republican coun- iverage is $t.= Iredell has put on a lot of mod- ern improvements—new county build- ings,improved roads,farm demonstra- ete.,etc.—all_of which cost money and The tax- es in counties that are doing things|Mr. «whether Republican or Democratic)funeral service will be conducted at tri the counties that are |the Foard residence on north Center Republican}street this morning.Interment will be MR.‘THOS.B.ELE Y DEAD.isinaadtioishiinrpup.sMocksvilleLawyer“Victim “OF Pneumonia -—Mrs.Reavis Died of Burns—Other Deaths. Mn Thomas B.Bailey,of Mocks- ville,whose.illness.was-briefly.men- tioned in the dast issue of The Land- mark.died Tuesday morning about 9 o’clock.Mr.Bailey was a victim of pneumonia.Last weé¢k he suffered an attack of grippe but his condition was not serious until Sunday morn- ing,when prieumonia developed,Dr. M.R.Adams_of Statesville,a relative of ‘Mr.Bailey,was.summoned to ‘Mocksville Monday and was with his kinsman when he died. “Mr>Bailey~-was--2~-ruling:elder.-of the Presbyterian church of Mocksville and his funeral was held.in ,that church at 11 o’clock~-yesterdayr Dr:ang,Mrs.Adams and Mr.B.H.Ad- ams of Statesville attended the serv- ice. Thomas Braxton Bailey-was a na-tive of Davie county;where his.fath- er‘and grandfatherhad lived,and was 66 years-old.Fora generation he had-been a.leading lawyer and citi- zen of his county and was held in the highest esteem.He was a tower of strength in educational and religious eireles and probably no citizen of the ;county who has died in this generation willbe-so much missed or so sincere- ‘ly mourned, Mr.Bailey was a graduate of Da- vidson Collere and had practiced law at--Mocksville for probably 40 years, ae.‘one time represented Davie andRowan:in.the:State-Senatesand abovt 20 vears ago was one of the Demo- ‘eratic nominees for the Senate in the then hopelessly Republican district of Yadkin,Davié and Iredell.A little ater he had strong:support for Supe- rior Court.judge in this district and the convention at Salisbury was dead- locked for a time,Judge B.F.Long I. ae from oe y oe hcneiee been of Statesville being nominated. mented HY The IT ahd Mark with ne Mr.Bailey was a successful busi-cepted DY Steet MWnout ness mah ‘as well-as_a successful at-torney.He was president.of the Bank of Davie,a director of the Wa-|) chovia Bank and Trust Co.of Wins- ton-Salem and was interested in oth- er enterprises.Hle was for years chairman of the board of directors of the Siate Normal College at Greens- boro,was a-prominent Mason and one of the promoters and sustainers of the annual Masoni¢picnie at Mocksville for the benefitof the Oxford orphan- age. Mr.Bailey is-survived by:his--wife, who-was Miss Jessie Hall,a daugh- ter of Capt.James Iredell Hall of Covington,Tenn.A brother and sisteralsosurvive.The latter,Mrs.Lee, lives at Mocksville.Two daughters of Mr.and Mrs Bailey,who “were in school at the State Normal when an epidemic of typhoid-fever broke out there years ago,were victims of that plague.Mr.Bailey maintained his in- terest in the collere,founded a schot- arship there as a memorial to his daughters and ever since their death he had paid the tuition of some girlinthat’institution,..As,a-cresult a number of young”wometi have been educated at the Normal through Mr. Bailey’s generosity. Mr.Bailey was well known to many Fredell people.He-and—Mrs,—-Bailey. are ‘each related to the Adams family of this county and Mr.Bailey had many friends in the county who held him in hi¢h esteem and who sincerelydeplorehisdeath. Karel -Henty ~Bondam,aged Ht vears,died yesterday morning at the Sanaterium,death resulting from pe- ritonitis,following appendicitis.The lad became ill at his home in-Wilkes county more than a month ago and when he was brought to the Sanato- derson is $2.98,Swain iseke ’a rium it was found that he was suffer- --Doewell-$2.36,-Cabarrus._4.Liing-from—appendicitis._An_operation pay-a greater tax than Iredell “and revealed that the appendix,had been ruptured,making—his chances.for re- covery very slight.He lingered.for wecks,however,before death came. The boy was a son of Mr.and Mrs. Karel Christian—_Bondam,—who moved from lWoland ~to America several months ago ‘and located on a farm near Poor’s Knob,Wilkes -county, which they purchased.-The Hague, Holland,is given as the birthplace of pie hoy.His parents,who were here with him.have been boarding with and~Mrs.Geo.M.Foard and the 'in Oakwood cemetery. Mrs.Wm.Kyles died yesterday at yy o’eclock at her home in Fallstown and economic expendituresshould be a,township,death being due to pneumo- “matter of good citizenship. . ive that a want to live in it. worth while—for good—and every dollar is honestly anc economically expended. Meeting Civic League. The Civic League,in session at the It-is not!nia creditable to a county to have a low/service and burial will take place to-tax rate if thereby it is so unprogress- progressive man doesn’t High taxes can be! defended if they are spent for things| the general public and complications.The funeral day noon at Bethel Baptist church. Mrs.Kyles was abont 60 years and is survived by her three children. hushand and Mrs.Jo.Reavis,who was seriously’ burned recently at her home in Con- cord township,died yesterday morning at 6 o’clock from the effects burns.-It was thought for a few daysaftérherhorribleexperiencethatshe |! Commercial’Club Tuesaday afteraaa would recover,but a change for theelectedofficersfortheyearas”fol-|\orso became apparent early’thislows:Mrs.T.Anderson president,|ock and it was realized that sheMra.R.E.Nooe vice president,Mrs.J.C.Fowler recording Mrs.J.L.Culley financial secretary Mrs.W.Orr corresponding secretary,“Miss Mabel Poston,Mrs.Orr,the ‘retiring president,~tendéred:a rising vote of thanks“her faithful and.efficient ‘services.The services of Mrs.Vera B.Jones,oes ‘visiting nurse.were turned.ove .secretary, treasurer was for could not live.Death was hastened by the feebleness of age.Mrs.Reav- ‘lis was 69 years old and is survived by her husband and one.brother,Mr.Amos Jenkifs,of Conéord township. 'The funeral and burial will take place today at South River church,conduct- ed by the pastor,Rev,C.S.Cashwell. It will be’recalled that Mrs.Reaviswassweepingaroundanopenfire-r old! of the! 'Wanted.to Testify inthe Over- cash Murder Case—For Steal- ing a Dog—Other Court Cases Cyrus Plummer,a young white man who is to be used as a witness for the State in the case against Houston.Overcash,charged with wifemurder,was arrested at Barber Junc-tion Wednesday by Deputy Sheriff John Gaither of Rowan county,andindefaultof$50 bond was’broughttoStatesvilleandplacedinjail»to await court next week.,The.arrest was made in accordance with instruc- tions from Solicitor Clement,who feared that Plummer would not at- tend court.~~Bob Bensons-colored;was arrested|Wednesday afternoon on a warrantcharginghimwiththelarcenyofadogbelongingtoMr.J..C.Henley.He]: was taken before Justice Lazenby, alg continued the case until Februa- ry 15th.An interesting point of law}™ is expected to figure in the casé-when it comes to trial.The law says “if any person.shall feloniously _take, steal or carry aWay any dog listed,for taxation on which thereis paid an an- nual tax of $1.he shall be guilty of| larceny.”’.Mr.Henley listed five dogs* for taxation at,$25 for the five.The dog found in Benson’s possession was one of.the five.2oseo Revels:colored.is .in.jail avain oiCharges similar to thosewhichhavenlacedbim.there..on_pre- vious occasions.This time he~~is* charred with-stealing two pistols from \Mr.aa Habbard-He “was.given_a hoards ete,Sr-CaldigH swho! m-to jaik-in def:ault of One of the weapons was committed ‘hit $100 bond. recovered. Will Drum and R.LL.Dagen,a couple of white men who were arrest- ed at the railway,station Wednesday night for beating a ride on a train, were released by Mayor Caldwell yes- terday on the payment of the costs. THEY WILL NOT SELL OUT. Iredell Telephone_Stockholders Decline to Consider.Offer. The annual meeting of the stock- holders of the Iredell Telephone Com- pany was held in the company’s build- ing Tuesday evening.Mr.R.L.Pos- ton was chairman of:the meeting and Mr.W.-M.Barrifiger:secretary.The report.‘of -Mn..Barringer,the retiring|r secretary ard treasurer and general }, manager.Showed the company’s busi- ness to be im good condition."The earnings the past year were very gratifying.’The stockholders —unani- mously rejected a proposition to con- sider the sale of the stock of the cor- poration. Nine members of the present board of oe were re-elected as_fol- lows:H:.P.Grier,F.Morrison,Wm. Wallace.J.G.Sheiton,Dr.P.F.Laugenour,R.V.Brawley,Dr. King,R.J.Bryant,R.R.Clark.Two new directors are R.L.Poston and FE. G.Gaither,who succeed S.B.Miller and H.A.Yount,Mr.Miller had sold his stock in-the—company—and_.Mr. fYount asked to be relieved as direc- tor beeause-his time is fully taken up. Mr.H:P.Grier was re-elected presi- dent.of the company. At the meeting of the directors, held after the stockholders’meeting adjourned,E.Morrison was-re-elect- ed vice president and Directors Grier, Morrison and Wallace executive com- mittee of the board.E.O.Heritage was elected secretary —and-—-general manager and H.P.Grier treasurer. The directors some time ago decided to separate the office of treasurer from the secretary and general man- ager.The salary to be.paidwthe sec- retary and manager and the treasur- cr is the same as was paid Mr.Bar- ringerWhenhe fitted the combined; positions,so.there is no increase in, the expenses of operation,the change}heing madé to facilitate business. Better Place For a Bridge.| “Arent thebridge-over-the -Catrwhr; river at or near Lookout,a gentle-|2 man familiar with the location says) further down the ‘'river—about half! way between the Little and Lewis fer- ries—at a third less cost.An:engin- tioned,thinks «bridge at that would not cost over $10,000 and the building of the approaches to the! bridge on cither.side would cost.little.| In addition to the lower cost,he says) a bridge at.this point.would accom-| modate a greater number of people |more} would | Hickory! than at Lookout;it would be a direct route to Newton and be little if any further to than via Lookout., GoldenWedding. Mr.and-Mrs.A. ren Plains,.Warren county,parents| of Mre-W.sEe-«Webb of Statesville.| versary Wednesday.Mr.Webb of Statesville,who spent the first two days of the week in,Raleigh,went from there to Warren Plains to at- tend the celebration,which was more or less of a family reunion,a num- ber of the children of the aged couple being present.Mr..Webb was ex-pected home last night. Military Training|at University. Plans for the establishment of a North Carolina will be discussed at the Jane meeting of the board of trus- A WITNESS SENT TO JAIL. J.El the Landmark S.Webb of War-only.four contributions from outside local Jews,who had already con- thiscelebratedtheirfiftiethweddinganni-|<hould be many more and it,is not yet tere feature at the University of| man presented to versy. In addition Great Britain has swered tentatively the American pro- test.against the holding up of mails,buf will reply more fully wheh France approval of Great attitude. comes the announcem warships are to aid the British navy hag signified her Britain’s in blockading the and the North Sea and take part in the exumination—of mails—as—well_ascargoes. Hand-to-hand fighting between the French-and Germans neartookplacewhenthe.French==tr:re-take trenches captured by the|mans. tacks were are everywherearms. If reports from Turkish headquar- ters are exact,the British forces in Mesopotamia sufferedsevere reach the reverse foiles |cast of might be buried. tefik,on the Turkish losses in Russians in the neighborhood of Eze-rum,Allied made byTrkson the British ©forces’in “according to advices sources, have-been driven from alt the territo-ry they held in that section_of coun- suffered heavy losses in the fighting,-the re- ports-declare;-the figures being-given it 15,000 killed and 20,000 wounded. western Arabia, from German try and have that—a bridge'ean be built two miles €ontributions For Jewi sh Relief |, Fund. The Landmark has_the eer who looked at the"location men-|contr ibutions for.the point|fund,explained in the last issue of The Landmark: G.FE.French Z.V.Long A Friend Walter Culbreth Wallace Bros.Co. LITTL E FIGHTING NOW, Report That Montenegro “Has Finally’Quit—British Losses With Turks. Hostilities on all fronts having for the moment dwindled to rather unim- portant proportions,the political’side of the war has again‘ chief role of interest ‘The British Parliament is discussing with much animation what steps shall be taken to make more rigid the fov- ernment’s plan of keeping goods of all kinds from being imported or export-ed by Germany;.-British labor has de- cided by an1 overWhelnting majority to support the government to the-full.intheprosecutionofthewar;the .Ger- ambassador at Washitigton hastheAmerican mént a draft note concerning the sink- ing of the steamer Lusitania which isbelievedtomeetalltheAmericande-mands on this’troublous which,if accepted by the German gov-ernment,will finally end the contro- Berlin reports’that-all the at- repulsed,however;have taken—-from.the -Ger-mans mine craters they had occupied several days ago and in mining opera-tions in the Argonne forest have de- stroyed German trenches. The representatives of the Montene- grin government,according to a Vi-cnua dispatch coming by way of Ber- lin,at last have signed garding.the disarmament.of the Mon- tencegrin army and the Montenegrins laying down their in their endeavor tobesiegedtownofKut-el-|that the house was“tented mara,on the Tigris river.Some Kut-el-Amara; Turks in counter-attacks British back several miles,the latter leaving on the field about 3,000 dead. The Turkish losses are have been comparatively slight.It was after this fight,which lasted six hours. that General Aylmer is have requested:and obtained a truce of one day in order The British advancing from.Mun- Shatt-el-Hai south of Kut-el-Amara,toward Kor- na,also were compelled to retreat be- fore a Turkish attack, port,leaving 100 men dead.-The Brit- ish reverse is somewhat offset by the airmen have:again dropped bombs on Monastir and Gievgeli,and a-hundred -_persons.are--estimated have been killed or latter town.The Germans have drop- ped explosives form sircraft on Dun- ‘kivk,where five persons—were killed, and on the aerodrome at Nancy and /factories in Baccarat. British possession of territory pro- tecting the Suez canalsouthern.end is imperiled by attacks large ‘bodies of Arabs NEWS IN CONDENSED FORM <-.A SELON 3 voters eae oerItemsofInterestGatheredFrom Over the State. Dr.J.H.Mock,a physician of Thomasville,died this week,aged 41, Wife and daughte#survive. Dr.John G.Ector,a retired physi- cian of Guilford county.88 years old,was found dead in bed Tuesday morn-ing. Emmet Boone of Castalia,Nash county,14 years old,-was shot when a pistol in the hands of another was accidentally discharged.The wound was fatal. While’in Charlotte’this week ex-Gov.Blease told the Observer that.iftheprimarieswereheldnowhewould be.chosen.Governor of South Carolinabyamajorityof25.000 to 50,000 votes, Geo.Patterson of Gastonia attend- ed a party,was drinking and fired his pistol into a crowd.Russell Harvell, 22 years old,caught the ball and ‘is inahospitalat:the point of death.Pat- terson is in jail, At the meeting of the Mecklenburg county Republican convention Wied- nesday Hbn.John M.:Morehead op- 4posed a resolution denouncing Presi- dent Wilson’s foreign policy and the resolution was stricken out. Miss-Clara.Mae Wishart of Char- lotte was.struck by.an automobile in a suburb of Raleigh Wednesdayafternoonandkilled,The machinewas-driven-by—Jo-Upehureh-and-it-is said He.accident was unavoidable. ,the young.Wilson_jusly..disappearedannTaloeeeeTerhismatriagetoayoungwomaninAtlan-ta,has returned home.‘As the ‘wed-ding invitations had been recalled itisnotknownwhetherthemarriage will take place.‘ A police justice,a jury,several po- licemen,three lawyers,two witnesses, two slot machines,a quantity of gum, several nickels,numerous law books and-an entire forenoon were .employ-ed-in the Concord”police court to de=cide whether a nickel-in-the-slot ma- chine was a gambling machine,Thejurydéciedthatitwasnot. Mrs,Méry H.Howland has broughtsuitagainstthecityofAshevillefor Suffer assumed _the govern- andissue, an- Simultaneously ent ‘that French English Channel! Neuville er" The.French, articles re- house owned by Mrs.peer whichwasburnedin1914,is allegedecause the.city,had.failed to provide ade-‘quaté “water pressure. Garland Hoover of Caldwell coun-ty won the scholarship offered by Congressman Doughton to the corn club boy.making the best record inthedistrict.The scholarship is totheA.and M.College.Young Hoover made 125.8 bushels of corn on an acre at a cost of 22.6 cents.per:bushel. A news item sent.out from Mt.Ol- ive,Wayne county,says the_indica- tions are that the Irish potato crop, heretofore one of the most important truck crons in the eastern part of the a somewhat | the drove the| declared to -declared -to that the dead railway, says the re-small consequence,due to two reas- ons principally—the high price of seed potatoes and the impossibility of se-curing potash;-a very-necessary-ingre- dient in potato fertilizers. CHIEF JUSTICE _ANSWERS.|; Judge.Clark Makes Reply to Gov.Craig. On another page of The LandmarkisacriticismofChiefJusticeClark! by Gov.Craig and the statement of| the Chief Justice that provoked the criticism. Yesterday’s papers carried a long answer from Judge Clark.The battles with the towoundedinthe route:at.its Chief Justice says he is “astounded”and that the Governor should intimatesouth-|that his Langston letter in any «wayexcusedthemobthathangedthene- groRichards.He reminds-the-Govern-or that hg began his Yetter with a de- nunciation—of_lynching,—declaring it WS’anarchy.He challenges the Gov- ernor_to find any line of apology.inhisietter—for—thosewho—committed the offense.The Chief Justice insists that the cause of these lynchings must be re- moved by an efficient administration ofara giving good men reasonable ssurance of protection for their lives as well ad for their property.He de- clares his position to be that the chief fault is in the system by which ju- rors’are drawn,excessive number of challenges being allowed defendants. He wants it understood that he_be- lieves these lynchings are not the fault of the peonle who,he says,are as a mass law abiding. The Chief Justice explains that he The British extremely} following}, Jewish Relief| 5.005.00!2.0025.00 oe Ladies’Aid Society.08 believes that no one acquittal of the RUTIBC eee .“|guilty offender nor,indeed,any vane a Kn offenders,has brought about these test bia!aca “theat .aes conditions.Furthermore,that no lack|, of \tributed $175 to too late. Praise For Collector Watts’Ap- pointees. Mr.D.J.Gantt,revenue agent who has been’stationed in Atlanta and : was recently transferred to Cinein=|~—The fourth number of the —Wivter nati;writes Collector Watts highly Chantauqua extension,“The* complimenting the services of Depu+jof Nature,”by Mr.R,B.Mc h ies @.C.Hamrick and R.E.Tuttle,|lin.in ‘Shearer Hall this ev 8 who were commissioned by.Collector|ofclock..Tie két holders will have re- Watts and have Agent Gantt. been serving under Mr.Cleveland county and of confidence caused by any one judge nor the excessive use of the pardoningpowerbyanysingleGovernorisre- sponsibla for conditions as to lynching in this State.\He insists that the trouble is long standing.and that it isforthisjreasonthattheteashavebeengoadedtotakingthelawinto their-own-hands..~ Mr.McLaughlin at Shearer Hall fund.There Hamrick is from|is free.Remember the hourMr.Tuttle is o'clock.At the last $47,000,alleged tobe the value of a}, State,will this year be a matter —of| ~|names,asking that such.an Pacis). str ved seats but the general admissionis‘8 entertainment BRIEF ITEMS ILOCAL NEWS. —-Superior.‘Court next week,Judged Ferguson presiding. —February 21-26 will be Pay-Up,Week in Statesville.Get ready for it, ——Box supper at Kerr’s BranchschoolhouseSaturdaynight,30th,forthebenefitoftheschool, —License has been issued for thdmarriageofMissLillianAnnie’StineandMr.Lester Lewis Current. -~The open season for.bird huntsinginthiscountyendswiththemonth.anext Monday being the |last day. -~~-The cotidition of Rev.vals AsSmith.continues.to -show-«.some:Smeeprovement.‘He is,however,still confinedtohis.bed.; —Mr.-J,Hs MecLelland of Mockent:ville wants it understood that he is intheraceforregsterofdeeds.Hehearsitisreportedthatheisnot:a candidate. —A _car-load of Percheron horsesfrom.the Iredell Test Farm weretaken.to--Salisbury Wednesday “by”Supt.Meacham for exhibition at ~theState,Live Stock Meeting. —In the page advertisement of théCarolinaMotorCo.,'in Tuesday’sLandmark,the price of the Overland» ue was given as f,0.b.Detroit.It should haye been f.o.b.factory. —Mr.Robert Udell Harris .and Miss Rosa Summers of Bethany town-”ship were married yesterday evening_at-6-o’clock-at-the-home-of:the-offiei=-——ating minister,Rev.J.H.Pressly. sar-Mr,Alfred Armfield,who ©haabeenwiththeGoldenBeltCotton:Mill at.Durham,is now at his home’here and ‘will take a position as night.foreman at the Paola Cotton MillFebruary1.seen —iThe State Board of Edjicationhasapportioned$75,000 to the publichighschoolsoftheState.The.three”schools in Iredell get the followingamounts:,Harmony —$350,Scott's $260,Troutman $300.; _——Ai subscriber asks thtonameéthenextyear ‘when’themonthofFebruary’will have ‘five ‘.-Sundays.The date is 1920 —fouryearshence.In 1852 and in 1880'-there were five Sundays in February. —Greensboro-and Statesville willcontest-on the local basketball floor.tomorrow night,and the Maryville_College team of Maryville,Tenn.,is—scheduled to be here Monday for9gamewiththelocalsMondaynight. —Mr.R.L.Cowan,who has beenmakinghishomeintheWestforthepasttwelveyears,has returned toIredell,his native home,to live.Mr,Cowan is a son of the late.W.H.Cowan of Olin township and is wit:eyhismotherin-Olin. —Rev,Dr.C.E.Raynal of StatessvillewasoneofthespeakersatWed-nesday’s session of the Social ServiceCénferenceinCharlotte.-His-subject————was “The.Woman’s Club and Commu-nity Upbuilding”and the Observer —refers to it as “a delightful address.” —The new heating plant which hasbeen.installed at the Barium Orsphans’Home was accepted from thecontractorsthisweek.Supt.Walkersaystheplantisapparentlydoingfine,and is,of course,adding .com=fort to-the entire population”of theHome. —Mrs.~Burt.Knox:has:moved...toStatesvillefromCoolSpringstown<~ship.and is occupying one of.me rEliasonhouses,on radd_eaebe- |street.\.‘Miss.Jessie Knox and.Mr,Sam.Knox,who have been in States<"ville:for-some_time,will live with.”their mother. —Mr.J.A.Houpe,an Iredell manwhoislocated.in.Oklahoma,’netsMangum,in a business letter.to OeLandmark’mentions _thewea‘er_had_been very severe but at.thetimehewroteitwaswarmandspring-like.Stock of all-kinds hadstoodtheweather-well,said Mr,Houpe,“as we shave an abundance offfeedthisyear.” WOULD SEND ’EM TO JAIL,ho John Skelton Williams;Comptrol<«_ ler of “the Currency,told the House - committee_on_rules—that Congreue Soe should pass a law providing for pris. on sentences for officials of national banks who might be found guilty of —, violating the usury laws... Such drastic ptinishment,he added, would deter bankers from chargingusuriousratesof{)terest on loans toborrowers’who can .t protect:theme. selves.The comptroller,who has been consductingacrusadeagainstusuryfor. six months,declared that he had un-— der consideration ,plans to institutesuitsforthecancellationoftheonaes .ters of the worst offenders.; EMBARGO ‘ON “MUNITIONS. For more than an hour yesterday the Senate debated.indirectly,the proposal to put an embargo on ship- ments of munitions and then without a vote referred to the foreign rela- tions committee,as the administras tion leaders wished,a thosuand bun--dles of petitions bearing a million 4 be established. President Opposes Federal SuffrageAmendment, To 200 members of the congres from-Caldwell.Mr.Tuttle the past;the patrons voted to change the hour year made a record of more seizures}from 8,30 to8 and the audience is than any other Officer in the service.|expected to be prompt. Collector Watts is naturally pleas-|.The Landmark repeats the assur- ed that.two of his appointees havelance that what Mr.McLaughlin will given such good account of them-|have.to say about nature will be selves,worth while. to the Associated Charities,her term of,service under the new arrangementto.date from January‘Ist. nlace when the broom caught fire agd|tees,according to:the,decision of the her dress was ignited from the brodfn.|executive committee of the board at aa}:}mecting in Raleigh yesterday. ie question\of continuing the|“The Landmark is advised of the Leagrae tea’room.was.discussed,and death of Mrs.Myrtle Greenwood Pace,finally referred’to the executive ‘com-lat Elwood,Ind,-on.thé:16th.Mrs. mittee.;Pace was 26 years old and the daugh- al tinion for woman suffrage, President,in New.York yesterdstatedthatheopposedawom frage amendment to the Fstitution.Suffrage,he said,wasquestion.for individual States.ote ‘ter of Mr.J.W.Greenwood of _this county.Husband and two children, father and four brothers survive, o———writers-have pre woanmearormnerstraesFORTARIFF COMMISSION: The President Favors It?Estab- lishment—The Object. It is announced that President Wil- son favors the creation of an indepen-' dent,non-partisan tariff hission, with.broad.powerstariffduties,the relations between in-| dustries .at home ant abroad and the| entire tariff and commercial |machin-| ery of the world.f I Although the ~President ©.previ-|ously has taken the position that the} powers of a tariff commission already!° are held by existing governmentbureau,he told Mr;Kitchin,”chair-| man of the ways and means commit- tee,he felt justified in pressing for the creation of a separate ¢ommis-sion at this time because of unusual international GOV Gov.Craig Goes Squarely AfterChief‘Justice Clark For aStatementAnenttheWayne County Lynching.~ The Landmark has had something to say about the letter of Col.John D.Langston of Goldsboro,touching the recent lynching in Wayne county, Col.Langston taking the ground that the:lynching—was-the—result_of-—the failure of the courts to punish crime. Writing to Col.Langston,Chief Jus- tice Walter Clark says: “I have read your letter in the News and Observer with great inter- est.I am sure you have stated —the real.cause of the.trouble.Lynching isto be condemned and it is anarchis- tic.But the remedy is not scolding in the newspapers nor.the usual farce of investigation which leads to noth- ing.The real remedy for lynching, and the.only one,is to remove the cause,That cause is the protest of the people against the inefficiency of the courts in failing to protect human “ON V RIOUS TOPICS. The members of the senior class of the A.and M;College have decided to set #precedent for that institution by ting themselves for graduation ‘at commencement “‘in the convention- al cap-and gown.”The cap-and gown has been affected by the graduates of a’number of male colleges in the State and the A.and M.men want to be in style.That is’their business,but.it strikes The ‘Landmark that the cap and gown,which smack of the clois- ter and might be all right for a theo- logical seminary,is hardly an-appro- priate garb for young men who are going into the industrial world,-The A.and M.graduates are engineers, machinists,farmers,ete.and if} clothes appropriate for their work were to be selected for their gradua- tion they.would don ‘overalls.The overalls would be a badge of ‘honor after the present,upheaval, Representative |Kitchin thoughsionshould.be clothed with what- Said he} Editor Brings Suit Againstainst Ed-itor—Case Comes Up at Newton|as lander —now the Aurora -Her—published at Bhelby who was a monthby-Rdivae wy nant ot the a Ks ne and who at the:time sa ie wou! 4 investigate)ing suit against Editor Withers for criminal libel and also a suit against Mr.Withers‘and_his x lages,this week started t ‘criminal libel in Catawba county court at Newton and the case is to be heard today.jcounsel for Mr,DePriest. tion in Catawba county rather than in|eas Cleveland,the home county of both)== ithe parties to the action,is not,fully|explained.)One reason that has been|Se Ee AAvae *jassigned by some of the papers is po- tof the 5 sendin Ae tea |litical prejudice —Cleveland being a|& couny OF ie he tates|pomocratic county and Catawba for|5 will have in commercial adjustments the time being in the hands of the Re- publicans,and DePriest is a Republi- Sore ae ican. the Federal ‘Trade Commis-|the case will not be determined |politics. Editor B.H.DePriest of The High-ighland- written uporsoagoliberalShelbyStar, er for dam-e action for Mr.W.A.Self of Hickory is|(@ The reason for instituting the ac-: However,it is to be hoped thatby every additional powers might be under the circumstances;the cap and gown will signify nothing as to the work they are to do. life by-the certainty of ‘punishment, Nothing else will stop lynching.” |Quoting from statistics to show the lalarming number of homicides in this Mr.Bryan says he has no purpose |State,and in this country as compar- :to trail.the <President~and maketcq with other Countries;the Chief speeches against preparedness ;that|Justice continues:ee aoe whatever speech-making he is to-do]«phe fact-is thatthe number of ae oe beat agers See ene een temciscs in the United States in pro- e President’s'purpose was :- ed.The newspaper writers who first ‘guessed that Mr.Bryan would follow! the President to reply tothe Presi-|than in any other part of the Union,|g dent’s arguments,and Ne On end it is larger in North—Garolina Se dawnsT Fey ould at|tean in any Statein the South.The!Investigate the ndministhative and! Tabet Bive the ex-Secretary credit for |Pron io -ea ‘ra eee than |fiseal efféets of customs laws now in, his.statement.bit they .won’t.Whateli)any otk setts it wre li er than /foree or which may be passedin the|| ever speeches Mr.Bryan makes in the|n at ine ea thar Se Sicily,ig }future;determine the relations .bey? next six months will be accounted-a a reenii :Oona.In sicv'y,nol |tween rates of duties on raw mater- 6 Ty to the President.Mr sean ie nstanc ing its Ma ue Youwill see jiais and those on finished or partially hes his faults and The Landmark has eae ue discussed by me in 166 N,|finished ™products;investigate the “never been one of his followers,but it|“it Tessa pani th nie thal ever _leffeets of ad valorem and specific:du-| is a notorious fact t-at many of the |jawyer aril Geeue citizen ie ld aN ities and of those which area com-| %newspapers constantly misrepresent|foy ‘th;Pa ae facts me ld he Bs 1,[Pound of ad valorem and specific;exe| him:and itis a further fact that |i own a i ne =separa NE a fig jamine the arrangements of schedules {many newspapers and newspaper ue e .hte Ca |*St he.gf duties wamt=thee-elassification :Sree tHale ron ere eens the State of the “articles .on the several little—conception.o ishall,_throughthe—Legislature-and—in|.chedules-—investi »—the oe %meaning of fair treatment when pass-the administration of the courts,en-peared mrvestipate ae rene S ing on things they oppose.aeee a ont baa pes ee jof law relating to the-tariff,and=..the-+ i a aus anc ’¥Strat Sige POO)02)“os eye a btu)ate git ‘ee ition of the criminal.Jaw.that.will re-|eeeiyenaieic ene cE tg eect a The attitude "of tHe hewapaperseeTht,evil.The people a rime nt~applyine to"invoices and other) and the public generally toward the'ne (reated aoe ST EMRE ee aE application,to the col-| §Goldsboro lynching should encotite lerese the Fat a ue Suuee and aro-Ay)he working o theriventhefallest[ight upon all sub-ijjye ocatrally iends w and order.Never!soots :Re eayenees ina Utah vemnas asqpjmine geyeraiy u ,:the friends of la jects and their sound judgment will!eystoms ‘and tariff Jaws in.their effect and administrative necessary,but that he believed a) majority of the ways and means com- mittee favored a new independentbody.The President.made it.plain, ke did not think the proposed ¢ommis-|sion.should.be...established—-with-thetviewofupholdingorcriticisingany particular tariff-pelicy but should be: J fc entirely non-pertisan,and é¢apable of! portion to population is greater than |oatherine facts without any political| in any.country in Europe;that the |pias,:\ proportion in the South is greater f td As proposed by the President such}commission would have “speeifle} powers to: _&before was there such general con-!|cuye the evils of the body politic.snomic Sdemnation of a lynching in this State.'”«|pelieve in the fullest publicity in|ye o = ““and-the evidence-that-the-trendof ayine—before the —public’verything peered public opinion against this form Of itHat touches their government.for I)aq). Jawlessness has become _very much |helieve they are competent to eel ee “36 stronger in récent.years is as UNMIS2-eovernment and that when they know Tax. “takable as it is gratifying.It has |the |facts they will remove the evils)In a leiter @ Chairman Kitehin of) 4 not..beenmanyyears since lynchings|whatever they are,and wherever they |the ways and means committee,Con- cree oe A Doughteon Opposes Stamp *in North Carolina were either passed’oist.”;5 Nonehton of this district| over in silence,half-heartedly con-|Governor Answers Judge.iV is apposition to the stamp «;demned or openly excused and de-|[In an address before the Socia!)t savs: ite :llItisn’t so now.Outside the,of a vevenue bill is ;‘Service Conference in Charlotte,Gov.|“The cue «Wayne county papers,which ee Craig took the ground—and correctly |now under consideration by your com- ly offered some excuse for i if out-|—that public opinion’is the supreme mittee.”I trust vou will not consider‘break in their;-home oa 2 ne ower in this and Mm all lands and that it presu ous o2 my part.to offer, *paper has excused the Go ds a it On|natever conditions exist are by the 9 few sugrestions.”: &fair The Landmark pat t reac :rs ."eonsent or sufferance of the people.+“In the last Congress,owing to the :this same line t a 1s ee a reas-|He said:;_great falling off in customs,caused on to believe,et ath a th eeThe “The moral staminaofthe State is hy the European.war,the ways.‘and| Eos less een ar in .“Courl “een clear of responsibility for the means committee brotght in a bill a arleston News and Cou aMietiss oe commission of crimes in de-Icvying an excise or special stamp”tax, i that Georgia,ee:fers MUSSIS~|fiance of law.We are to some extent,or certain articles,such as deeds, y sippi_are the arch offenc thi ae respcnsible for the lynching in Wayne ‘notes,telegraph and telephone mes- :the States of the South in t .ma org (county,for heretofore we have not sages,medicines,ete.This bill was &:though Georgia 1s a much ee made sufficiently clear our conviction »passed,as an emergency measure and _than any other State t at a an he (one have not determined against the with tke anderstanding that it was +fense to the others to ean er in ss ‘erimes of the mob.If the criminals,not to continue.‘ *same-.breath.”The en iy 4.who lynched that negro,who violated “When present Congress met it was y show that almost a third o th yne rang tramped down in the -darkness;found necessary ta continue the same 4-ings in’the United -States a jthe sanctity of law,who outraged the measure temporarily;but now,in year occurred indont an a many |State,had known that a people shock-}finding «general revenue measure,I .this year-six or eight NE 1 ee ed at this night orgy of death,this'trust your committee will sce both been lynched m ih ee e latest |uncalled-for,unnecessary,wanton and Ithe .wisdom and the justice of pro- "seas the 1 lief.that Fiera Geen n and spoken against them niof the present law levying these spe= a couragéement in the nay ee :itighteous indignation to their expos-cial stamp taxes._This law is odious,|° iy Southern States are showing Improve-|yre and condemnation,the “soil”of ;yexatious and burdensome and the orment in this.direction.|Wayne eounty would not have been|people whom IT represent are weary th i ——ee oad he me by the blood of another mur-junder it and want it repealed. :“iQ PHBE:in B ke|OF s :=|“While Tam anxious:at all times __,Southern Power Company in toy |But we can hope that this is the to be found in line with our party,I ‘and contemplated ee ee of stch crimes in this State.The must say that I will not again undér -s-the Catawba Spas ao oe He butaries (press and the pulpit and patriotic cit-|any circumstances support a measure (pan Caldwell and_probably other ae have.spoken with emphasis,and ‘carrying the stamp provision’of the ,ties,18 explained by the company anc isounded a clear note that public sen-|present,Inw,believing as Ido,with ,the explanation is printed today.No timént in North Carolina is against!my whole heart,that it is wrong.|If :“doubt the purpose is as_stated,for such deeds,and will no longer toler-additional taxes must be levied it can : there-is_good-reason_for the_compa-ate them.—Outside of Wayne countyibe done,in my judgment,in some pny’s.desire to conserve and regulate there is the one discordinthis noteofmanner tess burdensome and objee=7 the flow of the water in he ae endaaiie!condemnation and that -is|tionable than by continuing the pres- ip But that,probably,eee oe sole from the Chief Justice of this State./ent sysicm of starap taxes and T trust reason.The Southern ower ompa-Jt is astounding that:he should hold |your committee will take this view of ,ny doesn’t want any other power com-'the courts responsible for the mobs.|the matter.”- \many locating plants in this vicinity-|This serious charge is made in general) “Sit naturally-wants~-the-whole field.-A+against~our-courts:It~should-—have+‘Morganton man who is promoting aihcen made _special._The recreant| -fended.tien Badin (alias the Whitney develop- Since_business has been _resumed_atu. Three car loads of All Heart Cypress Shingles!These are the best wood shin-_ gles that money and man can make. Compare this shingle with any other and note the difference. We sell also the cheaper grades _of shin-xles,A and B or Star Brand.These younow,are second and third quality’butmakeagoodroofforinexpensive_build-_-ine,Galvanized Metal “Roofing,Cort-~'yvight Shingles,Regal Brand of Composi-tion Roof.Talk to us about your rooftroubles. €.1 Another big car of Doors and Sash justunloaded. ntLHeeeeee Albeit UAHA ie Wakes sen The RAYO LAMP SAVES TROUBLE OU don’t have to ‘}spend the greaterpartofyourtimecleaningit—and won- dering why it won'tburn.The Rayo is simple in construction-and-in design.It lightswithoutremovingthe |shade and gives thebestsortof-light—the_kind that won’t hurtyoureyes.2 Lamps Rayo lamps are an ornament *to any home..They require Sale Continued Another Week) Sale prices to continue on all Winter lines.--We=have thrown together lots of short lengths in Dress Goods, Ginghams,ete.,to clean up at half price and less. 98c.SHOE TABLE. We find many odd pairs.in Shoes—some $2 to $3.50 values—to close out,choice for 98c.pair. All Winter Underwear—19c.for 25c.kind;39c..for .50c. kind;79c,for $1.00 kind.One lot Ladies’Suits—$10 up to $25 ones—to close TOY «occ ccc ccccccnevdewvee ety eee pare tO Ghigo: 8 Ladies’Long Black Coats—in $5 to $6 vaiues,sale price,3.48 Few Men’s and Boys’Rain Coats,for....$1.48 to $3.98 Great.values in lots of things to clean up on.Don’t'miss the opportunity. J.M.McKee &Company, eee ewe m ewe ere ences eevee seeevre reece oe STATESVILLE,N.C. very little attention—yet always add to the,attractive- ness of the room. The Rayo is the symbol | of efficiency —economy— convenience.; Use Aladdin Security Oil or Diamond White Oil to obtain best resultsinOilStoves,Lamps and Heaters. The Rayo is only one of our many products that bring com- fort and economy to the farm. Ask for them by name. Matchless Liquid Gloss Standare Hand Separator Oil —Standard Household- Lubricant Parowax Eureka Harness Oil If your dealer does not carry these,write to our nearest — station.Zz STANDARD_OIL_COMPANY ||| x |~---Mica-Axle-Grease-—-~---——|-- | THE Christmas |@ Is being heid open a few weeks longer for the benefit of those who want to join,but who have neglected to do so. \ v If you aré one of this number,thea come in at once and join,and be made happy when you receive-your-check - two weeks before next Christmas—just in time for your Christmas shopping.ms j (New Jersey)| BALTIMORE | ‘Washington,D.C.Charlotte,N.C.Norfolk,Va.Charleston,W.Va.Richmond,Va.Charleston,S.C. The Club-is Nearingthe1,000-Mark.—-— This was our goal when the club opened on December 27, ‘ +Southern company’s purchases”im to administer the Taw.Crime does |morning Henry—billy,—a—negte;—-was«Burke.The Southern’s répresenta-not go unpunished No reasonable|Shot and killed by another negro,who _utt¢ves-had_endeavored to_buy him out.)man conclides:that this negro who.escaped. ‘started he will.probably find some hands of judge and jury.To—hold_up|_Jively competition.It"is argued—‘our State as worse and more lawless| just as the Bell Telephone Company |than Sicily with its Mafia.is,an un-; “perior to that given by a number of matter in State vs.Cameron.From|_Severe cases of croup have been ‘smaller companies—which is true;'the opinion of Justice Allen,replying|known to.yield to an external treat- and that the people who buy power|to the opinion of the-Chief Justice in|Ment known as Gowans,in 15 minutes, course but,they have some concernof murder in the first degree,and sen-|80ing to bed rarely fails to break up about the price.If they can be as-'tenced to death,and judgment has!the worse attack.It seems unfair to *+gured that the price will always stay been affirmed.This would seem to|the little ones to let them suffer when company furnishing the power has the cause,and which are often mis-|colds are neglected,serious resultsithefieldorhascompetition.But ex-leading,have any place in a judicial!follow.Gowans is absolutely safe to perience has shown that big corpora-|opinion,nor do I concur in the indict-|use,even on the most delicate chil- er Company will do when it gets well!am well assured that facts and condi-|when covered over with an;i t 2H a MT ass at facts ¢=-®warm flan- established,with no possible rival in tions existent do not justify it.’|nel cloth,it goes straight to the spotthefield-and_electric_power in -such;—“This-statement “made by”Justice]and breaks up the inflamation and Lea .ijecture.It can put up a pretty stiff;“The men who are apologizing for!A.Peters,Atchi ie.|r !g ;.,Atchison,Kans.,,writes:‘“ ‘rice if it oe and the folks will land attempting to:palliate this kynch-|cannot endorse Gowans ideas have to stand for it.ing,are not,accessorics after the fact,|too highly.Have used it for croup on tate of Mrs.S.notify all persons having claims against said } estate to present same to me on or before the| 4th day of January,1917: CROUP and PNEUMONIA ‘company and has a power site in.judges should have been named.There |Ment),in Stanly county,the killings “Burke county,probably-hastened ‘the|is no disposition in North Carolina not |N@ve also been resumed.—Sunday “Failing in that they have bought land|murdered a farmer in Wayne county -,all about him and if he gets his plant would have escaped —_justice at the!CROLP AND COLDS es ov sargues—that one big companywith justifiable accusation.The Chief,TREATED :BY COWANSHargeresourcescangiveaservicesu-Justice says that he discusses this |——— care mostly concerned about good serv-ithis ease,I read as follows:and it is said that one application on ice.The people want good service of|“‘The prisoner has been convicted;the chest and throat at night before within reasonable and proper bounds |be enough.I do not think that sta-|such easy,quick relief is within reach they are not concerned whether thejtistics not revelant to the decision of Of all.Then again,when croup and rtions sometimes take advantage of a)ment against the te_of ereealf|ains 2 people of the State dren,as it is applied externally to the‘monopoly.What the Southern Pow-or the administration of her laws.I|chest-and other affected pane and common use that the people are ob-|Allen was concurred in b Van :5 ce hat ,as (y Justices}congestion.Here is one of ma liged to have it,is a matter of con-|Walker,Hoke and Brown.|thousands of testimonials:Prof.R. for they have committed no.overt act {to protect or conceal the criminals, aNATTEE $100 REWAR®,$100. The readers of this paper will.bepleasedtolearnthatthereisatleasta:ed disease that science haspeanletocureinallitssteges,and that ‘$%s Catarrh.Hall’s Catarrh Cure is}the| only,positive cure now known to the,i ical fraternity.Catarrh being a con- ‘respect for courts.and the adminis- tration of justice,and they weakentherestraintoflaw,on occasions-when ‘communities are enraged by deeds of tutional disease,requires a consti-|horror j ‘:jonal treatment.”Hall's atari Cure |horror in their midst.The lawlesskensuchutterances. en internally.acting directly spon eens welcomes :6 and mucous surfaces.c e|The organization of future mobs ©isseeonBALthe’pac |made easier,sBut-it is unmistakable tent strength by butlding uD ithe con {that the conscience of North Carolina :and assisting nature in doing jis set against.such things,and..theonoeeenatmuch|people have spoken the deep convic- @ Hundred Dollars for..any case ttions of the State and of the age.”it fail to cure.Send for list of|<=eee i adi F:J,CHENEY &CO.,Tolo-BUILDING?>~6WATKINS.‘ I Druegiate,Te.;aMalt Raa Bin:eoittaten.|BUILDING?_C..WATKINS. but such utterances tend to lessen the| my little boy and have always found it effective and immediately so.”.Ask your druggist for a bottle.“Demand Gowans,because Gowans is more pene- trating.”25c,50c and $1.00 botties. Sample and testimonials.on request oftheGowanMedicalCo.,Concord,N.C. EXECUTOR’S NOTICE. Having qualified as executor ef Miss SaraSmith,déceased,this is to notify all personswhohaveclaimsagainstsaid-estate to pre-sent them to the undersigned on or beforeJanuary4,1917,or this notice will be’pleadinkaroftheirrecovery.All persons indebtedtosaidestatewillplease“make immediatesettlement, J.B.PARKS,Statesville Ruf): Jan,4,1916--*Executor.of Sarah Smith, rai .| ||NOTICE TQ CREDITORS. Having qualified as administrator of the es-| S.E.Moore,deceased,I herebyj W.S.REID,| R.B.MeLauehlin,Att'y.Administrator.| 1916./| |“DANGER”| Jan.4, Come like a thief in the night and seize upon the infant child.Be prepared to save the life of your little ofe by having a bot- tle ofBrame’s Vapo-Mentha Salve4-———-FOR——-Croup and Pneumonia. Price 25¢,60c.and $1.00.: For sale by all dealers or sent post-paid on receipt of price.BRAME MEDICINE CO.,N.Wilkesboro,N.C. WANTED! SCRAP BRASS—HeavyBrass 7c. per pound,Light Brass 5c.per pound ane i i"~FOR SALE:| New.and second’hand machineryforsaleandallkindsofboiler ropm supplies.: C.‘H.TURNER. Iredell ’Phone No,74,.Bell No,7. but we think now that it will not stop at 1,000. People are beginning to learn that it pays to save the pen- nies,and nickels that usually.slip through your fingers f and are wasted,and there is no better way to save the amount that you have been wasting than to join the ~ Christmas Savings Club. 5 CLASSES TO SUIT EVERY POCKET BOOK.NO RED TAPE.*NO CHARGE TO JOIN. \ All that is necessary is:to make the ‘weekly Haynients from December 27 up-to date,and you will have an even start with the rest.ao _ If there is anything that you do not fully understand,we will be glad to explain when you come in,or write us and. we will send you-literature,and answer ang questions by |, mail.‘ Merchants and Farmeys’Bank, :_Of,Statesville,-soso ea “The Bank For Your Savings.”co Gthe didnot help me.last,ui, :I'took washi ig. saa d the past 50 years. ~~~At all druggists. resedanothe: ai help Sod,for it has he-many thousands of other weak women i ~~Write to:Chattanooga Medicine Go.,8,Tenn,.Advisory Dept.,Ch(eatracions on jour caneant44-pagebook,ome r doctor, my mother advised me to takethewoman’s tonic.eeemediodonc aypodOomeanieclevenbottles,and naw I am abletoooosofmyworkandmyown 1 thou;deadightBut Ithink Cardul is.the best.medicine in»the world..My weight has increased,‘and Took the pictureot health. Ifyou _suffer-from.any-of the:ailments’money get a bottle of CarduiWe-knowIped80 LadiforSpeciale¢|playing order and the SE B B E E B S B BB leaves 7:06 p.m,Nos.23 and 24 are not operated on Sunday. Service League’at Scott’s—Per- sonal Mention. Yorrespondence of The Uandmark. Scott’s,Jan.24 —-Community Ser-vice League met at Scott’s Friday af-ternoon.A short programme con-sisting of a reading by Miss AnnaSherrill,“How We Can Improve Our Community Service League;”recita- tion.by.Miss Mildred.Hedrick,“A-Du-el;”a trio by Misses Carrie and Del-la Wagner and Clyde Gibson, Plans were-made for having an en-tertainment to gét funds for the im-provement of the school..Quite afewofthemotherswerepresent.We now have our basketball-inHighSchool boys are much interested.Mrs.Moore has-returned to her and Frames. a oa New Stock Moulding,Mat-board Pictures framed prom-ptly and delivered. _R.P.ALLISON'S ~Book STORE. piTe, home at.Wilmington after spendingtwoweekswithherdaughter,Mrs.W.G.Reynolds.Mrs.Mary Smith spent Wednesday in Charlotte. .Master Gilmore Morrison has beenrealillwithspasmodiccroup. Zeb.Hunnicut,a young man em-ployed in a cotton mill in Concord, shot himself twice with suicidal ins tent.Domestic trouble is assigned asthecause.: Another Wonderful Recov-ery From Kidney Trouble. For nearly nine years I was a great CANNED _GOODS. String Beans. Corn. Tomatoes. —Peas. Pears. Apricots. Peaches. 'Pineapples,_ Raspberries. White Cherries. Miller-McLain Supply Co. sufferer from what my doctor said was Kidney trouble and my blood was out of order;enduring all that timeexcruciatingpain.in my back andacrossmybowels.I was-drawn-downsothat—I-—could-only_walk-with-my.hands on my knees.My doctor saidhecoulddonothingforme.I triedmanykindsofmedicinebutalltono avail.A friend’told me about Dr. Kilmer’s Swamp-Root,and as 1 hadtriedeverythingelsethatTheardof, l bought.a bottle of Swamp-Root and it did wonders for me.I prize it high- er than any other medicine and IJ shall recommend it to my friends.I }|wish to add right here that after us- ing Swamp-Root for two months I be- gan to straighten up and am now sound and well,and feel like I might live a long time yet to tell what your medicine has done for me. Yours very truly,T.C.CLAY, 750 Sugar St. Sandwich Dainties Olive Zest, When you want some-thing for Sandwiches—WE HAVE—-—— Deviled Ham.Potted Meats, Date Nut Butter,Peanut Butter, Sandwich Olives, Pimentos,etc. —’PHONE 89— ¥ |Bagle & Milholland. “|DRAIN YOUR hand. _Any quantity 4-inch and6-inch DRAIN TILE Common Bricks,Face FARM. on Marion,Ohio.State of Ohio,; Marion Co.¢ Personally appeared before me this 19th day of December,A.D.,1914,T.C.Clay,who subscribed to the abovestatementandmadeoath~that the same is true in substance and in fact.CHARLES W.HABERMAN, Notary Public,* Marion county,Ohio. Letter toDr.Kilmer &Co.,Binghamton,N Y.© Prove what Swamp-root will do for you Send ten cents to Dr.Kilmer :&Co., Binghamton,N.Y.,for a sample sizebottle.It will-convince anyone.You will also receive a booklet of valua- ble information,telling about the kid-neys and bladder.When writing,besureandmentiontheStatesvilleSemi- Weekly Landmark.Regular fifty-cent and one-dollar size bottles for sale at al drug stores."NOTICE! All parties in the county doing business un- der special license,and who have not paid same by January 31,1916,their names will be handed to the solicitor as the law directs.Paypromptlyand_save—costs. J.M.DEATON,.Jan,21---3t.Sheriff. GENUINEin Tess delivery.~Bricks;-always ready for Brick Co, Statesville. :ing,Laths, Next Planters’Wh. CG.WATKINS for © “Everything to Build With.” FULLSTOCK--LOWEST,PRICES Shingles,Doors,Windows,Ceiling,Flooring,Siding,Boxing,‘Mould-Lime,Cement,etc., Statesville. eet Se SS|SpeatMORE) “AKI PPE.gyeaaETALERS6»COPIUTIIEL?- Don’t overlook the fact that a tin 100f is the best roof you caa useonanybuilding.We do all kindsofsheetmetalwork. Statesville Tin Co. *PHONE 55 Von AN faraAOL Coite L.Sherrill,M.D., Will answer ’phone calls left~at-Dr.Long’s~Sanatorium orGeo.M.Foard’s residence. SACRO ERE‘Dan Valley | Parchment *Butter and brand on same. Butter Wrappers! We have the very best and can print your name have your order for anyquantityyouwant.See us.Prices reasonable. ‘Brady Printing Co. Paper,x Let us |OLD NEWSPAPERS —,All with,--Also good to putwalle.1 papée the alle.Cotes BUILDING?€. you want at10¢.a hundred.Worth this to atatt fires |%under carpets and |BtoTHELAND- WATKINS. ¢The Flour of Quality.§ &DAN VALLEY is milled from § #the celebrated wheat grown in & the Shenandoah Valley of Vir-§ %ginia.IT HAS NO EQUAL. %,Makes better bread and more ¢ %ofitto the pound than other 3 %flour.-It is economy to buy 3 DAN VALLEY.TRY.IT. 8 Cary C.Boshamer, #Local Representative,§'’Phone 125 Black.Itaw.§,“a BUILDING?“C..WATKINS,' Mifriends of Mr.Cullen.Ostwalt 8 |apnendicitis. sling fair. them?We can reprimand the ice-man or buy from the other one;/we can re- vort the delivery boys to their man-agers with dire threats of _movingourtradeifthatdelivery.boy will not keep off the grass;we can threaten our children with the whipping.we never intend to give;we can frightentheneighbors’children.off;we can re-port’to The Landmark that we willstopthepaperif*the“editor does*not keep his newsboys from jumping overourlittle“hedges;but’with ~themailmanwehave,no redress.Hewalkswherehepleasesandpleasestowalkjustwhereyoudonotwanthim to walk,and we can’t say anythingbecausewecan’t get our mail from another’.man.Just now constantwalking‘in the wrong place will soon tread a path that will be all too no- ticeable when spring opens.And now while on the mail man,is it a postoffice regulation for him toringthedoorbelleverytimeheleavesanordinaryletter?With the chil- dren all in school,and the housewife with her hands.maybe,in the biscuit dough,ting-a-ling goes the door bell,out come her hands.snatch a dish towel,rub some dough off on_that, then grab a hand towel,get off a lit- tie-more-dough—on-it,—start-to—the: door rubbing off a little more dough on her apron,throw the apron out of sight,get_on her smile to greet her caller,open the door—and there’liés a one-cent letter.If the department.requires the mail carrier to ring and to walk through yards-on-flowery-—beds,—I-haven’t_an-other word to say.Let him do-it._S ee A READER.(The Landmark has had_in mind. and some experience with,some.of the troubles mentioned;and if our correspondent can manage all the oth- ers;~-especially.the--nesghbors’...chil- dren,surely there is a way to reach the minions of Uncle Sam.The de- partment may require the mail car- rier to ring the door bell,and as there are all sorts of folks in the world some may complain if he doesn’t ringthebellandletthem’know when he comes.But it is The Landmark’s oninion that Uncle Sam doesn’t.give him authority to trespass becauseUncleSamhasn’t that authority to give;and if the mail man refuses to walk in the straight and narrow,af- ter being warned,a note to the de- partment at Washington might bringhimupstanding,9r sit him down. _RECA NE A AI AES OSTWALT BETTERMENT. The Betterment Society,Ost- -walt School and Neighborhood News. “orrernondence of The Landmark. ~Statesville,R-3,Jan.22 —The La- dies’Betterment Association held their last meeting with Mrs.U.A.j Ostwalt and were nleased to haveher|daughters (Mrs.Murdock and Mrs.Johnston)present.Mrs.Flake Mur- dock was our first.secretary,whenMr.L.O.White organized our asso-; ciation,about seven |years ago,and while we are not so strong in num- bers,losing by death,marriage and moving away,vet all this seems to bind us closer to each other;and we do.enjoy the getting together snirit,| and:hearty co-operatién of our little|band:And,too,we can see good re- sults;'especially in cultivating.the ce e bw he l e w e be © ee e @ © 0 ¢ 0. 8 6- 8 00 : 0 Ot o Oe Se Se e ee e ee fo e 8 ee we >+ ..“*ITRAMPLING THE LAWNS.|**ay “8 * rarer Haat Ee DON’T ASK FOR ONE.* Little Chance to Keep Pretty|+One particular nuisance The *Lawns and Grow ror .Landmark endures|could ibe ; ;Trespasser.8 abated with great benefit e We ee .Mail ‘Carriers *people who have business with * bes scab *the office as well as the people *Conspicuous Sinners. |*in the office,and we make bold * Correspondence of The Landmark.r ie sal for a aheeinatin:ie . The ladies always expect The Land-you ‘have business w mark to chalanina their cause.be 2 The Landmark,please state it . their side right or wrong.The issue},when you ’phone or’call at the . of The Landmark of January 21 had},—,to whoever responds.* a foot note to a piece copied from an-|,Three people make headquar-*). other paper,advocating the care of],os in the front office of The : yards _and__surroundings.very|,vandmark and any.one_of them . nice,but Mr.Landmark man,have|,4”transact any ordinary busi-. you ever thought how discouraging it|*"ess coming to hand.If he * is to spend time and money on your].can’t he will say so promptly * yard,then have others walk ‘over|*#"d make note for it to be at-° your flowers or grass plots rather|.tended to by the proper party.*° than walk in the neat little paths you|*,But day after day people svent so much time in digcing out for Phone the office and ask for * some one person.Often,twoorthreecallsaremade.tak-ing time at both ends of theline,when-if'the caller had stat-ed what was wanted it wouldhavebeenattendedtoprompt-ly.Sometimes.people who _want to insert a 3-line ad...togiveapersonalorothernews-item,or ask that some an-nouncement be made,‘will*phane..two.or:three times andaskforsome.one individual.consuming -a~lot of —time andmakingmuch...-unnecessary trouble. ‘The people-in the office givespecialattentiontodifferent lines,but that.does not meanthat.each of them can’t or won't do,anything else.Each one takes whatever comes to hand.Often onlv one personisintheofficeandthedemand for another,when the businessiswiththeoffice,is unnecessa- e and causes trouble and de- ay.: If the business is private and personal,that is another mat-ter:If it is with the office, nlease state it and it will be at- tended to at once or a_note made-so-that-it-will-be-given-at-tention.Sometimes people who want things in the paperunnecessarilydelaybecause they can’t communicate withsomeoneindividualandmiss what they want to do.or cause extra trouble.Work in a news- paper ‘office must be done to- day.not tomorrow.“The papermustcome“out.though the~ heavens fall.Save yourself trouble by stating promptly what is wanted.: -oe *ce e d de s e en e na ca n e ee e ee e ne ee ee e oe ee ee e wi n e te ee fF ***** Will Be Cut—Other News. “orrespondence of The Lanamark. do the winter nlowing which essential. done in this section. aati Houstonville,Jan.24 —The weath-|@ er is very unfavorable for farmers to]¥is so|@Butlittleplowinghasbeen|% The small grain’)§ /THE UNIVERSAL CAR ‘ Wiih fifty branches—twenty-five assem- bling plants and nearly 8,000 agencies in all parts of the United States,Fordownersreapthebenefitsoftheservicerenderedbythiswonderfulorganiza-tion.Average cost for operation andmaintenanceistwocentsamilewithrealservicewheneverneeded.~—Touring Car $440;Runabout $390;Coupelet$590;Town Car $640;Sedan.$740,f.-0.-:b..Detroit..--On sale at Carolina MotorCo.,Statesville,Mooresville and Newton ° pepoocssosesesesseesssitritt) In our last talk to you we explained that by deposit- ing 25 cents a week with us for 336 weeks you would te= P posit a total of $84.00.and we would be due you,at the end of the 336 weeks,$100.seaseekf ~The-most-important-part-of this.transaction.isnot that you have earned $16.00 by.depositing $84.00,but that your have learned the lesson of systematic saving. You have acquired the SavingHabit and there is no better habit.5 :es : ‘ crov is not making much show as yet. .meve to a farm on the Big Yadkin river,in or near Shallow Ford. pairing buildings. Mr.J.N.Holmes has been sick of.pneumonia. reported better at-last account. furniture company. year.Owing to ”the unsatisfactory prices the past season,’there will be a considerable reduction in the acre- age.this year.There will be an in- crease in the acreage planted to cot-ton. Stony Point News —Hope For Favorable Decision-in.Bonds. Correspondence of The Landmark. Stony Point,Jan.24 —Presiding Elder Ware preached in,the Metho-dist church here Sunday night and held quarterly conference Monday. We are glad to see Mr.T.A.Miller putting up a stock of goods here inhis—store_building.__Mr-P._E.-BarnesleayesMr.R.L.~Fincannon to take a reading of good books and magazines; and we pass mothers’magazinesaroundsoeachonchasthebenefitof| all the good readingmatter of the vi-}“Tcinity.Then at each -meetingwe-have+ good papers read,which are beneficial|to:all.Our sqciety gave a box sup-|ner_a short time hefore Christmas.re-| alizing the neat little sum of $17.50,| which we spend for necessary articles| for.our.school——such.as-chairs.ete... Mrs.Perce Suther’s-little girl,about two-vears-old,-has—been—seriously-ill} Mr.J.M.Ostwalt.while trving to, break a piece of timber in the dark,| stamped on a 10-penny_nail which, punctured the bottom of -his foot,|from which he suffered much,but a;rhysician gave him’relief and inject-|ed serum as a precaution against} blood poison.| ‘The Ostwalt school,taught bv Mr. Edgar Wagner and Miss Sherrill.has; organized a literary society.They) will have a programme for each Fri-} day afternoon and later will entertainthepatronswithadebateonsome: interesting subject.Our teachers are doing good work and we appreciate it.|We were sorrv to give up Miss Austinbutherhealthdidnotpermitherto: continue.| _Mr.Rufus Litten_is having a well| bored.Mr.Leroy Cavin has movedtohisfarm.near Ostwalt’s mill.We} i hope his wife will like the country and | we are proud to have new neighbors.| Mrs.Perce Brown .enjoyed her visit)to Kannapolis the other week.iheand | Flake.Clodfelter are glad to see them|out again after their operation for| Mrs.J.M.Ostwalt has a little |Mivang of Partridge Wyandotte chick-| eng just hatched for early market.| She aims to have some for the com-! Wo trust the fair will be a gure thing this time. H.T.Ham,65 years old,a retired¥imerchant of Greensboro,committedsuicide”Monday night by shootinghimself,.Was in ill health and de-|snondent.Wife and five children sur- vive,:|a Five himdred students have regis-'tered at Wake Forest College,making}the largest enrollment.in the history|of:the institution,at position with Mr.Miller.Mr.James Bailey takes Mr.Barnes’place with Mr.Fincannon.:;:We hear that Mr.J.M.Miller_con-templates pytting a stock of goods in-| to his new building,which is now be- ing completed opposite his hardware, store,| The people on_the sale of our.road bonds and are confidently expecting the ‘confirmation of Judge Cline’s ruling.We hope this ||F matter can be readily adjusted,so that we can begin building roads as! soon as the spring opens. Mr.Goodin Hurt—Sick ‘People. Correspondence of The Landmark. Stony Point,&-1,Jan:25—Mr.Bart Goodin was seriously hurt while help- ing Mr.W.E.Morrison pull stumps Monday afternoon.Drs.Little and Grouch were immediately summoned and dressed the wounds.He was later removed to the Sanatorium in States- ville.A gash was cut behind his right temple,with a crowbar,rerder- ing him unconscious for a time. Mrs.Caroline McCoy,who has beenconfinedtoherroomforsometime, doésn’t seem to improve very much. Mrs.A.W.Stevenson has--been-con-fined.to her room,with grippe. Mr.J.F.Murdock and granddaugh-ter;Miss Grace Murdock,went to Charlotte today'to visit relatives.The friends of Mr.H.L.Gilbert ofShilohtownshiparegladtoknowhehascomeoutforsheriff.He will,ifheiselected,fill the piace well. AGED TAX COLLECTOR -Restored To Health By Vinol Corinth,Miss.—‘‘I‘am a city tax col- lec and seventy-four years of age. ]-was in a weak,run-down condition. My druggist told me about Vinol.I tried {t and in a week noticed consider- le improvement;L continued its use and T have gained twenty pounds in wel and feel much stronger.I con- sider’Vinol afine tonic to create strength for.old people.”’—J,A.PRICE. We guarantee.Vinol,our delicious cod iron tonic,for all run-down, weak and debilitated conditions. J._R.-Cash.will-in the.near—future| Mr.|& Cash has been there building and re-|& right|% His condition was; J.I.Keller has returned to High|% Point,where he has:a position with a|% We don’t hear much said’among/%\the farmers about a tobacco crop this|% of Stony Point.are,EA awaiting the Supreme Court decision|| Under our method of doing business payments must be regular and orderly.and this lesson is one that,will stand you in good-for all times.te '4 Remember that it is only another week until the opening of our-59th series.and.we want you to join.SAT- URDAY,FEBRUARY5,is the day.' ig i :a First.Building and Loan Association —.OF STATESVILLE.a rer. 0000090080909000SSSTOTT31115155205250002 nm (CRORE JI Rn Le HEN)NO 1\@/007,OTORIR TE TEN eee basalts as scemememamnahe Gondola-Bassinet |BABY CARRIAGE. Bassinet a Stand mm rySomething— SRE cy "Different + 4)CarriageqAt -And—ay Pr)7 fe(Sees aaah >)AS |Same Sy “aA Cy <=: Price.LY mxZ\S setter. Two-in-One Baby Carriage.The body is detachable and can be placed on the Bassinet stand that comes with the Carriage.This Carriage is beautifully fin- ished in white enamel and lined with Baby Blue Cor- duroy..Top is adjustable,can be placed in any posi- tion.You will appreciate this carriage more when § you sceit.*dl Crawford-Bunch Furniture Company. 3,The Store That Always Welcomes You... FA PRTPNOTCMUDC MC MMLC NENT NTTLC ATTLC MILT NOIRE NBDUC SOLE NEC NU NUTR SEC WCODE NACOCN NLO NOSDIE LEASULA,NU Or a s Ep i s ? So m e s We a k ee e AO S ? NT O , SR R OO S ? NS 2 5ee e pe aah i f cm CR U RO S I U R I O R R O Ea senna“THE COLD TRUTH | ,‘IS x QUINACETOL CURES A COLD.— 25 CENTS A BOX ———AT 'W.F,Hall,Druggist,Statesville,N.C, HAULS DRUG STORE _.Charity and Childrenis advisedthat {remedy is to remove the cause,The Ford as-one who lived softly and eani- :ati «»at .*t t ::i..business"before.thenational_conven-|.onedy-evils,-or-at-deast-it-too often;snvbody—ontside of -his~domestic es] .be .+z |=fF .«Congress holdingonuntil next”fall!phe.Gavernon...says no.reasonable __..with theories of policy but would be -par-capita-cost.of..county government.;escaped that this clemeney-of the divided_his_profits with his working- _due to increased assessment—instead :__ity—clearly.and.distinctly for the jos he declares his spposition to stamp ___.direct.The people would then knowjing fired on and wounded a Mexican-emergency matter,entirely apart .~Some of the articles on which stamp}made that American cattle thieves| itor of:The Landmark doesn’t know|Carranza soldier water some horses|persons are treated annually nt the eommenenemreetyonaeagee se eRe ANP ae ea 2 JUDGE AND GOVERNOR.|ROQSEVELT ©AND FORD. Far be it from The Landmark to arya yet at butt into any controversy between [the Contrast is Not toth Colo- two such able debaters a8 Chief Jus-|~ tice Clark and Goy.Cratg,but really it seems to The Landmark that they Roosevelt o the cc we ul were not so far apart in theli original Peat goad int,the ‘an-American statements.The Chief Justice ©de-Scientific Congress,:were aimed at De 1016,jhounces lynching but says there is aoe vo thePoaepiaweccs: -g FRIDAY,--~\January 28,1916.cause,the people know it and the”eee oe erred ‘e Mes.‘former President BROAD STREET. the error in The Landmark to which |Chief Justice’s reference to “scolding ly,was”timid and-lazy,absorbed ©in .;stats:+lin th spapers”?th been luxury,slothful and unwilling te-run it calls attention is the editor’s-own;in,the newspapers”must Aave "Tiska or to toil and endure.” and its attention is further ealled to;considered a personal thrust.by the}Toking these remarks force Pex the fact that in mentioning popular Governor.hos New oe Pty <ee the é ;rk is ress leadi iB 4c land Mr.Ford in the following: errors occasionally The Landmark:In -his-address leading—up--to—his a nd.‘»fol g ;sig fo Lcntplath ‘hie ‘bien tha Coy.|{Examining the biographies of these has confessed its own sin’and dis.{criticism of the Chief Justice the Gov-|-cotlemen,ara fina that Mr..Roose- tinctly disclaimed any pretension to crnor had contended.that the will of yelt,born in 1858,with wealth,never freedom from error.|the people is supreme and that they ,conducted a successful business enter- ‘are responsible.for-the-sort of —gov-|PTiSe of any kind;that his principal ident Wilson is urging.Con-|core or _|nctivity has been’office-holding —orPresid£jernment they fave.All true,but the ls ce-secking.and that exeent in:that gress to ‘speed up and get through|mass does not realize its power tojennacity he gives no employment.to _tion meets.The advice is good but it feels helpless to exercise that power,taptennent the other h } is doubtful if it-will be.taken.Legis~!3q somet’mes,angered beyotd en-|jn ati =oe one eee Bp EG ge os pik at :a :.pa Ral }OD,mM Ee }20 lative’bodies in this country are USU-/durance,it strikes out blindly as athe greatest industry in his line tw the ally unreasonably slow.A session of|:{world,in the conduet of which many|protest.|os 'inf hig associates have become mil-_ne tionaires-end--ters--ofthousands “of won’t help.the country and will Reb man would conclude that the Wayne/workingmen have found oceupation be an advantage to the party in ae eet would escape.That is true and |at the highest-wages -ever~paid-to| rats .ae z .tmee ies similarly”eng . oe aste pane thee it is the strongest condemnation of Hea aad gia Pairs oacen s they ought to be able to specd j,,ne Dee ier ete erent as ¢ar nis wonde suecess houses they oug 2 )Spec’the mob,which nearly always visits|heey due to political or legislative up but it is doubtful if they will, eer pac \its/punishments on those who arein|triekerv.| no danger of escaping the law.“Crime|“Just w at does our most leisurely | .et 7 tatesm:or,lrapper,rr PdoesnotgounpunishedinNorthCar-statesman,hunter,trapper,rancher.|aa :ate traveler and explores mean when he;olina,”says the Governor,That state-|syenks of such a man;as soft,lazy,| to a tariff commission,which he now ment will be disputed.Homicides are /slothful and unwillin.to run risks or ssion,:::::ito toil g “ec?«=©Does he have!E ie Sxanm.inereasing in North Carolina all.the|‘®toil and.endure?oe ays favors,because “all the circum time:the Phe iotae ieti ;Sf iany eoncepticn of the risks,the.toil stances of the world have changed.””?e number of convictions Tor'.ng the endurance that appear in the 4 hatay.frst degree murder are very few and makine of Henry Ford or a thousandHesayshehas“no.thought whatev-;|3 and! lthe number of excct-zions are fewer.|Cn Ina letter to Congressman Claude| Kitchin,President Wilson says he | has changed his mind with reference| ;;.him?.| er of,a change ay attitude toward ee r no one crime in the State ia (ero!That is what Major Jack Hall of| so-called protection question,”as the)”~he crime In tne otace is CIeTS |Pawan would have called’a “surbind:| commission “will have nothing to do less certainty of adequate punishment jer.”Mr.Ford’s peace idéas,or rather| ‘than that of.homicide.In fact so his plans for promoting peace,seem| Nightly is this crime regarded that the S°Utterly impractical and_his_peace ‘murderousty -inel:ned slay .wi roietcnnoncion was so poor)’‘aandledeeeyatnonnenateddenRinROUT.WAS A laughing ifear.They do not fear ine exireme stock.But as a man of business,asa ee ipenalty.They expect to get off light ce Ee -is weedof ;:*:mt :any whit,tle reat successes 0 e country.| The Landmark’is directing atten land usually they do.So many white Not only has he made a pile of money| tion to the corrected figures of the|men who can command influence have jn »legitimate business.but he has charged only with the duty of seek- ing facts to guide Congress in legis- “lation.”aLSND in Iredell,printed on another page.It|courts is naturally extending to the ™"-The idea that a man like Roose-lvelt,who never knew what it was to will be seen that.the cost in Iredell in |negroes in some cases.The work of 'strugele for a start in life and whose 1914 was $2.19 and $2.49 in.1915—|the mob can neither ve excused nornrincival business,as the World-says. the increased figures last year pele (ceteden:but the people realize that ;)as ta to hold ns ce office,say- ..jing that a successiul business man SABE dl Cee eae eee Abeta baw hes become too lenient in €ap-1tire Ford is slothful,unwilling’to of $6,91—the figures copied from the ital cases..:a ' University News Letter in the last is-|. irun risks or toil and endure,is timid) oo jand lazy and absorhed in luxury—) ‘sue of this paper.The entire per cap-|The Landmark is advised that a/well.that sort of talk is so utteriy| ita cost for all State,woauey and /#00d many people in,the county don’t ore ne es Se eciiy one a a ‘cage a |on ve .if the colonel is really mentally hal- school taxes in Iredeii last year wag]Understand the 10 per cent.increase|sneod at times... only $5.01—$2.90 less than the News |Made by the corporatyon commission.|: Letter figured for the county aione in|The Landmark went into the matter|/MANN FOR PREPARATION. ‘;ape an Jaci fully at the time the assessment.was |:TF Papny |1912,when:the cost was less than last =ae eee ISSe le Ma ‘S|Republican Leader in Congress’ year.Papers copying the News Let-,"ade.e corporation commission Would Be Ready For Possi | };Sf ete eee ee ey a ady 0 3i- ter story should give heed to this cor.*imply increased the assessment of piitiag rection.all real estate in Iredell 10 per cent.,1 -;' :aa ‘over the’figures named by the local ee a aos of ee ee The Landmark is hoping that when |,.onceope any tes .ae Mr.Mann.the Republican leader, the.President a out to talk about assessors.That is to say,if the local’made a vigorous plea for.prepared- e.President goes ou LD ee he |assessors valued your real estate at,9¢8S and his remarks were liberally preparedness that he will giye,his $1,000 the increase.makes‘it $1,109,2Priauded on,both sides of the House. reasons—in so far as regard for in-|,.:“It seems the part of wisdom forar<ge ‘and you will have to pay taxes on $1,-/:5 to prepare ourselves for any pos- ternational affairs will permit public-|-a eeebIy100.That means $1.05 more taxes un-!|sibility of trouble that may .come,’ ,:38 you live in.Statesville towaship,|W725 the keynote of Mr.Mann’s_re-| necessity for the increase of the na-|y yore thelcnte:Gees imarks.He declared that the world i So f |where the rate ‘is $1.11.The totalii.in the worst condition that any liv-tional defence.So far the reasons as-|ainte ;o 3 :is ;St co 2 SAL any UV: cienaa have been Gil i ‘I |"tate and county tax in Iredell is $1.-|ing person has ever seen it,and pre- &:cen many and-general.'n5 on the $100 ‘but in some townships |dicted that it might be many years The President can state them clear-l“hefore it is definitely determined ly-and-concisely and if he will,or can,whether one or the other.oF neither do that the people will be better sat-|side,can become master.”He also :‘couted the permanency of ‘a “paner «isfied—both those who oppose further —mes |peace.” increase and those who favorit.Many!The Supreme Court decision that+—No one knows,”he continued; é fe i t Lb aay “9 ratey .ye cidepeopleareatseaforlackofinforriia-;the income tax law is valid it is said |wire oe eee ee ae i j .7 Sater :¢.may leac s,perhaps t »this tion.They neither doubt the honesty j covers about all the disputed points-of}struggle,but’into one which is the nor the sincerity of the President,but |the law and‘places the income tax as;outcome of this.IT do not intend to they want to be shown—and he is the}/a revenue measure outside the shad-pense oe ele 7 pas cence m s 7 .nn the conclusion myse vat uf it were be te show Shem,=ow of a doubt as to legality.As al well as an emergency measure to in- result Congress is expected to amend jcrease our regular army to 250,000 or eee where there.are special taxes for some purpose,as.in Statesville town- ship,the rate is higher. Congressman Doughton voices’the will be largely increased.Mr,Hall of ‘ROWE,IneTeaRE OF onTennesseethinkstheamountofrev-!fairly Lee t Q3.speaki ce ee s -ifairly.amply protected,and that we taxes,speaking generally.They arelenue can be increased from $85.000,-|Should provide-a navy which would be necessary,.at times,as _emergency|699 ¢9 $90,000,000~—as—it—is—now:—to able to defend us on the sea.I have taxes,but for permanent revenue!¢‘much more fear in the end of war,AUC |$185,000,000 or more.oe a ne oe taxes should be arranged to give the )or more jwith England than I have of war with Yoast trouble and &aad se}ra ;)Germany -_least trouble and annoyancepossible.’Suegest That Some Punishment,“Events are comirg ranidly in the People-pay-taxes more cheerfully —;aKy jworld.We may sit by in~content-is Due the Other Way.|eGwhenthelevyissoarrangedthatthey:Gen.Gabriel Cavina i iment,and yet it is our duty,as man- don’t lizeueh =n 4.Gen.—Gabri¢avira,commandant ager of a great country and a power- on rea ize’they are paying them.of the Carranza garrison at Juarez,ful people,to provide for their protec- Somctimes,however,-The Landmark|Mexico,has presented to the milita-ition against possibilities as well as inclines to the opinion that it rigueur eee oe nt 1 eee Nie aicertainties.T think then that wea=..ireques at a Unitec ates soldier ought to provide these great forces;be better if all Federal te yere .:Pe Ce eae aeFederaltaxeswereyamedHarrison.be punished for hav-that it ought to be considered an feelings of a good many people when the cost and would be disposed to de-civilian.At the same time represen-;{from the ordinary routine,or expense mand greater economy in See enero to Z.-L.Cobb,United States'of government,without regard to f ‘customs collector at El Paso,were partisanship or party lines.”SL taxes are levied are proper subjects,Were stealing cattle from.Mexicans|Pasteur Treatment Saves People of taxation:and_should-not be-reli ».,south of the border,A demand was .y al SF taxes.but the levy =Poa {made that they be apprehended and:—Animals Unprotected. ;8,but the levy ean doubt-|punished.“Since the widespread use of the less be made another way.|The Mexican authorities referred Pasteur anti-rabic treatment has eee |to the prompt punishment they met-!/nearly abolished deaths from rabies Col.Harris of he Charlotte Observ-|&4 cue ae Duran eee Mexi-we -have almost forgotten the econom- ig ;pee :lean cattle thieves,who were execut-ic loss to the State directly “due to ag int going to inveigle The Land-'oq for the murder of Bert Akers,anithe disease of rabies,”says Dr.C.A. mark into any theological discussion.|American,killed while secking to re-Shore.director of the State Laborato- If he wants that he is invited to try|¢over stolen cows just below the baun-ry of Hygiene. Ne’Archibald Johnson.What the ed.[ary According to the Mexicans,Ale-,“The statistics of this department :jandro Soto was shot while aiding a!show that an average of almost 200 “bout the Bible would fill a book al-|in the Rio Grande river.‘laboratory for rabies infection.The reagan et rca Sais ithe water power ised in public serv- |Six corporations control more than| the law_so.that-the-amount—of-taxes+300,000._or_even _500,000,_that well beautiful scenery,flow=—+ most as large as the Bible’(nearly all |An investigation already made_by ,wide-spread Pasteur treatment has |United States army officers,is said to reduced the human deaths from ra- : Was a boy),but sometimes he almost|He-is said to have defied the soldier |to check the great waste of valuable :knows ae learned in Sunday jhave shown that Soto was on Ameri-/bies to one or two per year in our school at old Center church when hejecan territory and armedat the time.State,but.no steps have been taken feels puffed b ;3 and threatened to use his own riflejanimal life.It is difficult to get anAeszve.an —ths little knowl jwhen Harrison opened fire.Harrison accurate estimate,but the State Lab- g 5 0 e eriptures when hejis held in confinement.{oratory ,hears incidentally,almost ev- finds how “vastly ignorant”(to quote|ery day,of cattle,horses and hogs the Alexander county man)the gen-|a van ae former See-|which,have peek ‘lost.a total an-Bey lretary o ne Navy,and Truxton)nuak loss im‘dollars and cents,would oa tae a about the Book.Not long Beale,former United States minister|be startling.:;Aagotheeditorofoneoftheleading|to Persia,had a _fistic encounter in|“As to getting rid of the disease daily papers in the State (don’t jump,|front of the fashionable Metropolitan land preventing the waste.”says Dr.Selene),‘tt waar’t.you)attribiited club in Washington Monday night,the |Shore,“it may be confidently statedMetakshot:belie:“a clits result of a long-standing disagree-that it is the only disease at present j ie about being “a citizen |ment.|which could be readily abolished by of no mean city”to the late President;Roan cat en ‘legislative enactment.Confinement ofSsctitinHarrison:and that is:one W.J.Mayfield,a white man about all dogs to,the premises of the own- instance of many that could.be cited|Boston.Texas,Monday_night and jat large,would in a few years make Corporations Control Most of"the Water Powers,|In his report submitted to the Sen son the meer ower situationi :the United States,Secretary Hov *of the Department of Agriculturesaid__the following companies are}-*-.*. operAting in North Carolina: “Two companies,the Southern Pow-|. ar and the Carolina Power &Light) Co.,control 75.1 per cent.of the de- veloped.water power.and.66.5:perzentofthetotalwaterpower.Eight‘orporations control 94 per cent of theoower/and 14 89.1 per cent of the to- tat power,Forty-nine municipalities have.ong-per cent of the water power and 5.5 per cent of the total power. Since the totals forthe State contain 1 certain amount of power used in manufactures’‘the per centage of strictly public service power controlled by the several)corporations is great- op than the above figures indicate.” This report was called for in a res-People who know say this is one of ‘‘as goodcars’ olution adopted at the last Congress, the Senate desiring information as to the ownership and control of the wa- fey power Sites in the United States,F as-showing what provortion of suchwaterpowersitesisinprivatecontrol |'- 35 H.P,TOURING CAR $400 F.0.B.Factory. there is on the market.~Nee " N.W.FOX,.Statesville,—:LOCAL AGENT. Se ere and by.whom.owned and any facts! bearing upon.the question as to the sxistence of a’monopoly in the own- ership and control of hydro-electric“ower in-the United ‘States.- The report states that-18 corpora-|‘ions—control_more than one-half of ‘ee operations in the United’States, ‘ne-fourth.The report says that the| data shows “a marked—tendency—to-; ward association or community of in-/ terests,particularly between‘the prin-| sipal holding companies.” Mr.J.J.Farris has been recom-| mended for postmaster at High Point|and,will be appointed.- :|SNS TARRRRORRISTC NTT 71a New Treatment for»Croup and Colds Relieves by Inhalation and Absorption, No Stomach Dosing.: Plenty.offresh air.in the bedroom anda,|gon application of Wick's ‘*Vap-O-Rub”|Ive over the throat,and chest is the best |defense against all cold troubles,efThemedicatedvapors,released by the body heat,loosen the phlegm,clear the air passages and soothe the inflamed mem- brane.addition,Vick’s is absorbedthroughtheskin,254,500,or $1.00,'VICKS Vous SALVE ANCLARA Led ls Sh I wwe | TODAY~ soa To The Crescent “Th Q . Beloved Vagabond” — If you.love a beautiful. story,if you love splen-. did acting,if you love | ers and costumes all in their natural colors,see this wonderful picture. Every scene in it is beautifully hand colored and shows every tint of _the--costumes-and_flow- ers...It-required an enourmous amount of|work to paint the 96,000separatepicturesinthissixreelFeatureandthisisthefirsttimeithaseverbeenattempted. This picture was first advertised,at 10 and 20centsbutonaccountofbeingabletogetabet- ter price than we expec- ted we will show it at 10 and 15. -»:We have an unusually week.Watch Tuesday’s-Landmark.:er} ~~ IN THE LAST EDITION CS White Salt Fish 6c.pound,fs oc oe |nes hae art 4 Extra largeMack-'ie a q eany * erel 18¢.each. The Cash plan is the most satisfactory way to do business _and ‘the most satisfactory way to pay Cash is to use the H Coupon Books.These Books are $2.50,$5.00 and $10.00, on which we give an additional 2 per cent.discount. MISCELLANEOUS..No.;Blended Coffee,26c.::;Value for .le ipeeeeeneeeeeABOWholeGrainHeadRice,1c.|No.2 Blended Coffee,20e. value,for .......00%7 1-2c.Ib, Full Cream Cheese,for ...28¢,Ib.Jy value for ce ceesapeanences (LOG Spaghetti or.Macaroni,9c.rbuckle’s Coffee,per-pack- Pke.,or 8 for .........60.Qhe.F ABC -+++sh eee vo AUC, Gabbage fisicseee aes oe Ee |NATIONAL -BISCUEE:A Oranges,targe and sweet,30c.“doz.——-N¥’8-CAKES_IN.BULK. ‘Lemons........«ede ts 280,doz,als Grape Fruit,3 for-wseorsss Qber oahose ColkeeannnetateLooseSour.Pickles,......_10c.doz.Pineapple Ca ~valueJustreceived,a shipment of es warcery regs 28D.M.Ferry’s Seeds,a full Luxury Biscuits,25c.value,variety to select from.OF bl deweans oe ea aSCOFFEE.:«Pineapple Wafers,25c.-val-White House Coffee ..3 Ib.can 98c.|UO for...-reesee 28.Ib. hha Gait walics .1 Ib.can 33.c ne Drops,20c.value,ueen Qua ity €offee,steel-nese eens pees eee .°cutput up in 1 Ib.cans,ten Wafers,25c.value, 25e.value for:........+BOC.Re ee wepe gn Ss Sp eon,DeesGoldRibbonCoffee,i Ib.can..24e.|Saltine Wafers,20c.value,Dandy.Cup.Coffee,1 Jb.pkg...18e.f°cessessse oben ece,LCs”We “DRIED BEANS AND:PEAS. Lima Beans .......c++e0e09 Ib,Yellow-Eyed Peas ........4.9¢s Ib.: Ten Penny Coffee,1-2 lb.can..9c. No.1 Bourbon Santos Coffeeinbulk.We grind this fresh as you need it and Black-Eyed Peas .,.."T4-2e.Vb. guarantee every pound,35c.Pink Beans ...........7 1-2¢.Ib,value for v...ceeeeeeeesees 26c.|Mixed Beans .........+7 1-2c.lb. The Robert Bunch Cash Grocery, ‘‘The House of Better Values.” :’Phone No.229. =“9 ae ——————we Seeaee =:scence nero en See Clearance Sale Qe pe e r a ye a a ba me g e t |"Special Lotof Short End Draperies 4 fine programme for next.-}: Ramsey-Bowles-~Morrison Company. OUR XL ____Closes tomorrow night _ but for today and Sat- urday we willcontinue —_ |the good things foryou.. Special Attention to Laces,| White Goods, Remnants,:Ready-to-Wears. -at-very special prices._.. These Draperies are ‘ Of The Landmark I told you I was expecting several.cars of Ceiling,| Flooring,Boxing,Weatherboarding,| andCasing,bought early last fall be- fore the rise in the prices of lumber.| Yesterday I-finished unloading a car| of 82,000 feet of No.2:half-inch Ceil-| ing.Because of the exceptionally| low price I have already sold several|orders.Expecting a car of Floor-'ing in a few days.Now isthe;time'to buy.The market prices on these’ goods is today $2,00 to $4.00 per 1,-000 higher than I am sélling,| taken from our regularstockandareinlengths |up to 10 yards.Somepricedevenlessthanhalf._ arnt 50,years old,was taken from jail atler,or the muzzling of those running among educated and intelligent peo-Tynched.Mayfield was charged with|the disease unknown...Thes *ple.x killing his father,mother and brother’|ures have proven Stottivein mothwithanaxe.\‘England and Germany.”Oy WN dint ii ig ys ie ‘ Wigs eee: C.WATKINS,Next to McElwee'a'Planters’Warehouse,Statesville,N.C.' ~RAMSEY-BOWLES-MORRISON€0;: meeting.of stock-Fstat aye MeadLoanwill:be held]Ther ;t fotos,—Lyric ‘Theatre as“WDodge touring car i sale or ex-nge,—Cartlina Motor Co.Cabbage plants——D.J.Kimball.if Black mule strayed or stolen.—J.-‘VL,Lackey,Stony Point.wl mule for sale._-W.L.Smith, it?Few.select boatders‘Statesville Inn.High-class photoplays at,Lyric.en Vagabond at the Crescent Ladies’spring’coat,suits.—Mills & oysters.—The Poston.*.Fish and RobertBunch,Cash Grocery Co._Fresh lot fruit.—Sherrill &‘Reece,>Lock your Ford.—N.-W..Fox.,"Everything to”Build With.WestenHo wanted at orratkings 'eet +Overcash’s Factory phone 442 or ~$6-black,Gondola baby carriage.—Crawford-“Bunch Furniture Co.‘The Chevrolet car—N.W..Fox. agent. Sale closes tomorrow.—Ramsey--Bowles-Morrison Co.*Sale continued lanother week,—J.M.McKee &Co.,Wood:and metal roofings.—Lazen-by-Montgomery Hardware Co.Repair work.Spectacles fitted.—=Re.Henry.The most piano for your Colt eneCarltonA.Andrews.The best of all habits.-—First Build-ing:&Loan Association.Dining room furnituré.—The Wil-liams Furniture House. Social Items.Mr.and Mrs.John H.Gray enter-eresentse Hote)Jrede)}*WednesdayafternooninhonorofMr.Gray’smother,Mr.J.W.Gray.The invita-:tions were limited {9 elderly ladies}who:were girls when.Mrs.Gray wasagirland18ofthe25invitedattend-ed the party.Quite a number werekeptaway.by ’grippe and the.infir-mities of age.The “girls of yester-‘day had a-great time relating inci-dents of the early days in Statesville and subsequent events,all appearingtobeinfinespirits.The event was a“surprise”for “Mrs:Gray anda verydelightfulone.After spending.anhourinMrs.Gray’s apartments,the) guests were ushered into the dining room,where-a banquet menu wasserved.Dr.E.N.Lawrence gave a “stagparty”to eight of his friends Wednes-day:ra at his home on Bell street. A .G.G.club met WednesdayafTeéonwithMrs,J.D.Ramsey ather-home on West End.avenue.A game of cards was the~principalsorceofentertainment.’Three newmemberswerereceivedintotheclub,namely:Mesdames T.D.Webb andPD.M.Etheridge and Miss Sophia Hen- ninger.: * Miss Mills Entertains in Honor of Visitors. ,Correspondence of ‘The Landmark. Statesville,R-4,Jan.26 Miss Rose.Mills delightfully entertained quite-a-numberof her friends at a pound party,given at her home on the Mocksville:road,Tuesday evening. The party-was:in honor of Miss Sallic Whitlow of Mt.Mourne and Mr.Ira Day of South Boston,Va.,guests of:the Misses Carter at Diamond Hill;and Miss Martha Finn Carter and Mr.Harry.Proffitt,visitors in-Vance com-munity. From 8 till 9.30 the guests quictlyenjoyedtheamusementsofthe=par-lor—games and gossip.At a laterhourtheywereinvitedtothedining ie:room,where a delightful supper wasi+served bythe hostess,—assisted—byMissesBonaandMarthaCarter,Beu-lal’Wetmore and Lottie Shuford.Suspending from the wall to_each corner of the table were pretty decor- ations of red and green.Ferns and!notted plants.were also used in the “decorations ofthe dining room.About 11 o’clock the guests began ~evening. -Sickness Reduces School Attend:| _~~ance—Personal Items.__ Correspondence of The,Landmark. “Statesville,R-1,Jan.26.—On ac- count of grippe the:attendance at thePlylerschoolissmallthisweek.Fif-ty-sgyen_onthe roll and not a childundérsixyearsold.We are havingagoodschool.f0 ‘Rev.J.C.Keever visited our schooloaMonday.We were glad to have himawithus.He made a fine talk.which greatly encouraged the pupils.Hesaidwhenhevisitedourhomes’«hewould.be glad to,help.us with our lessons in any way he could.Mr.Keever.is a man of ability.We hopehe’will visit our school,again.Our school and ‘community club oyster supper:was verv well.attend-”ed,considering the bad weather. Miss Emma Tolbert spent last Sun-day with friends in this community.Mrs.J.-C.Plyler,--who-was-ill,-isbetter. Death of Mrs.Sloan atShinsville Correspondence of The Landmark: Shinsville,Jan;°26°=Mrs.Jennie\King Sloan died at her*home herethis:morning,aged about 55 years.i Although her iewiy had not been good for a number Of years.her pass-ing was sudden.Deceased leaves a:daughter,Mrs.Florence Stikeleather,other relatives to mourn their‘v1 The burial will take place atBethesdatomorrow.Mr.’A.E.'Suther and dau ater;Miss tees are quite sick with -lagrippe.Mr.J.T.Hagler,who has a“very severe case of:rheumatism,isbetter. $e Constipation and Indigestion.|have used Chamberlain's ‘Tablets andhave‘éver used formustnet ie:heeinigming-B cnn Atte Be,,OsGonaives everywhere,- 4 aee DI PERTINENTLY _PERSONAL .Mention of FolksWho Come and Bs“Th --}GreensboroTuesday to attend a mis- __to'depart,declaring a most.delightful | everywherey ' le -Geo,Marsh_of_York Institutehborhood,Alexander county,,wasslintownthisweekenroutetoDur-than to visit his uncle,Col*Geo,W.Floowers,Mr.R.J,Mills,who visited relativesinReverepeeraisesto'Ashevillethefirstoftheweekpar‘iss “Mary Neil.Conner went to sionary mecting.-Mr..J.DCochrane,Jr,,is at home-\from Birmingham,Ala.Mr,and Mrs,J.Sherman’Ramseyand‘little daughter,Helen Colt,whovisitedMrs.Ramsey's mother,.Mrs. R.O.Colt,in Charlotte,have return-ed to their home at.Long Island. They were accompanied home by Mts.R,0.Colt,Jr..and the latter’s guest, ak John Higgins of Montgomery, a Mr.Clyde Carscadden,.‘who was inTheLandmark.office-when-he was’aoyandwhohasbeenlivinginAshe- jville for.several years,has’beenlspendingafewdaysintownwithrel- atives. Mr.and Mrs.F.B.McKinne andMrs.David MeKinne’of Louisburg are guests of Mr.and Mrs.Clarence Stimpsonsccen sence Mrs.-E.-G.Gilmer"‘Jett “yesterdayforGreensborotoattendthewomen’s missionary meeting of the WesternNorthCarolinaConference,_Metho-dist Church.Mr and Mrs..W,Herbert Hoffmann will return today from their honey- moon. Mr.-R.V..Allison,who:;spent.theChristmasholidaysherewithhome folks.returned Wednesday to De- troit,Mich.Mrs.-Sig Wallace and children have| returned from a visit to Wilmington.| Mrs.W.E.Nattress and Miss Eliz- aheth Nattress left last -night for Washington. Mrs.A.C.Fry,who visited in| Statesville and vicinity,returned yes-terday to her home in Mooresville. Mrs.B.A.Cowan spent yesterday in Salisbury.”Mrs.A.Y.Alexander and little son, Master A.-Y.,Jr.,spent yesterday in Mooresville as guests of Miss Clara Mills.Messrs.F.B..Bunch,I.N.Paine, Harry.Sherrill,JohnD,Foard,Goo.H.Lentz,D.L.Raymer and C. Summers.of Statesville and toes, and:Mr.W.D.Troutman of Trout- man went to Salisbury yesterday to attend the State Live ‘Stock meeting. Mrs.H.B.Smith went to Salisbury yesterday for a brief visit. Miss Altie Corpening spent yester-dav’with’friends in~Mooresville: Mr.E.F.Eaton of Sampson county, who had been attending the live stock meeting at Salisbury,spent Wednes- day night in Statesville with his daughter.Miss Mamie Eaton and went to Cleveland yesterday for a vis- it to his old home. Prize Winners From Linwood School—Sign Placed. Correspondence of The Landmark. We wish others to know of the suc- cess the girls and boys of the .Lin- wood school and community have made in the past year.; In the poultry club:Bessie Willi- ford,age 11,won two prizes at the Raleigh fair,two at the Charlotte fair and one itt Greensboro;Elsie Brantley.age 13,won a —priz®_atCharlotte.Raleigh and Greensboro; iCharles Linker,age 11,won prizes at i Statesville,Greensboro and Charlotte. In the corn club Erwin Alexander won two prizes and James Linker two, at Statesville and-Raleigh: In the tomato club:Klizabeth Link-~ cr won two prizes,Nena Kistler one, Miss’Carrie Johnston “ore-“and-Rowe- na Williofrd one. Friday,January 21st,Mr.Dull spoke|: to the school;Mondavy,.24th,MissHenkelwaswithus.Both made very interesting and instructive talks. The schoolhas put up the =sign- board with the name of the —school. township and number of district,of which alt are very~proud:—The-sign was given by the United Farm Wo- men of the community. The school i¢now-preparing -give 'a play to get money to purchase aeyeenetheschool. Jan.1916.0 ee MissWilson Dead—Mrs.White Improving. |Correspondence of The Landmark.. |Statesville,R-5,Jan.26 Miss i Lula Wilson died Sunday afternoon spmorally-better.”The judges decided in. “‘leuring of meat. rLORAY SERVICE LEAGUE. Community League Organized —What It is Doing.— Correspondence -of ‘The Landmark.— Loray,Jan.26 +The Comanity tServiceLeagueofLoraywasorgan- ized December “1915,with 17 mem-hers.The foltoWwWing named officerswereSenetneW.J.Marlin presi-dent,Mrs.T.W.Vickery.vice presi-dent.Miss Lucile Stevenson secretaryandMissJamieStikeleathertreasur-er.The work of the League is to gaintheco-operation of ‘the:people;-+o-af-‘ford amusement and entertainment.to the residents of the com ity and toobtainmoneyfortheimprovementoftheschool,”Much interest is being manifestedAtthe first reguiar meeting the president appointed the followingcommittees:Entertainment,Debating,Lookout,Refreshment and New Ideas.She also presented a record book to the secretary and a_purse to the treasurer.A cordial invitation .was extended’to the “junior members oftheLeaguetoattendasocialat,the home of the president Friday evening,January 7th.“This was an occasion thoroughly enjoyed.The’first debatewasheldattheLorayHighSchoolJanuary14th.The question was,“Re- solved,That the world.is growing favor of the affirmative.An-inter- esting programme consisting of dia- legues,recitations and songs Was alsorenderedbymembersoftheLeague. Afterwards refreshments were served. The proceeds amounted to $10.._At the January meeting 138 new members were enrolled,the number to 30,:.The president urg-ed the older members of the Leaguetogivemoretimeandthoughtto‘the entertainment of the young people. Mrs,E.D.Brown responded with ashorttalkandendedbycordiallyin- viting the boys and girls from’10 to 15 years of age to attend a party at her home Tuesday evening.January25th.This was a merry time for the voung people.The games were great- lv enjoved and especially the shadow play.“Mary Jane,”acted by several children.These are_a few things the League greater success in the future, YCUNG CHILD NEAR DEATH 1.;Victim of Meningitis—Personal a Mention —Snake Swallowed increasing|.. ¥ has accomplished and we —hope—*for| British Restrictions That Wil!)” Damage Our Trade.by Great Britain’s “trading with the enemy act”is vigorously opposed by ithe United States in’representations prepared for presentation to the Brit- ish foreign office.‘The State Depart- ment considers that grave and unjust-ifiable injury to American commercemayfollowshouldanattemptbe yiade to enforce provisions affectingbusiness:in this country.“The trading with the enemy”actprohibitspersonsresiding,in~Great Britain-from trading with any corpor-ations or individuals which ate engag-ed in supplying the Teutoni¢allies orhave’business dealings with them,The position of the United States is that,aside from a lack of legal au-thority for the proposed interferenceswithtrade,the relations of Americanand:German capital and of German capital with American manufacturingindustriesaresuchthatitwouldbequiteimpossibletosuccessfullyaima blow at Germany without doing great damage to’interests in this country. This last’fact in itself is considered |.) sufficient .justification ‘for objectiontotheapplication.of the act to Amer- ican trade. The representations will not.taketheformofaprotest,because the act is limited.in its immediate operation fo British subjects,>but~-they»-will serve the purpose of warning .GreatBritainthattheactisregardedaSbe- ing wholly unfair and that propercompensationwill’be expected for aninjurysustainedbyAmericantrade. MARKET REPORTS. Statesville Produce Market.The following prices were’paid yesterdayforproduceonthelocalmarket,Winter Friers,12c.per’Ib.Turkeys,15¢,.per.Ib, Exes,18¢.per dozen.Eggs,20c.per dozen,Roosters,5c.‘peF Ib.Hutter,16¢,per Ib..Beeswax,25c.per lb.Green Hides,le.pér Ib,Green Hams,13c.to lic.per Ib.Old Hams 18 to 20c,per tb. Sides,12c.per Ib.Shoulders,12c.per Ib.Red Honey,8c.per pound.Sourwood Honey Comb,16 to 18¢,per tb. Grain,The following prices were paid yesterday ‘y grain onthe local market:Wheat,_1.40 per bushel.¢Corn,(new),65¢.per bushel. Oats,65c..per bushel. On the local market yesterday 12c.pound was paid for bestgrade cotton, per. China Egg. Correspondence of "The set sett | Statesville,R-3,Jan.26.°-The fre-|| quent spells of warm,damp weather| are hindrances to the butchering and| Almost every faim-| er in this section has porkers of.all sizes to be butchered and —stored ‘away for the summer provisions. This neighborhood is once ~more shrouded in gloom over the conditionoflittleJanieSuther,the two-and-a-| half-year-old daughter of Mr.andMrs.P.W.Suther.She became ‘ill a month ago and her case was baffling to the physicians until a few days a£6, when she developed all symptoms of meningitis.The convulsions follow- en to end the life of the little sufferer, {and.her death is hourly expected.Theitransitionfromthedimpledbaby ‘form of a few short weeks ago to the little wasted frame now is pitiful to behold.Every mother who reads this and has passed ‘through deep waters knows how to sympathize with the young mother in her-sanguish—in the pessing’from hope to despair—for all.“Into each life some rain must fall,”and “some days must be dark and dreary.” Mr.and Mrs.Adam Troutman of 3ridgeport,Wash.,who:have been visiting relatives in this vicinity,-have gone to Alexander to visit _their daughters and will remain with them until they leave for:their home in Washington. Some time last summer Mrs. Suther discovered a china nest egg had disappeared from a hen’s During the warm days a week or soagoalargeblacksnake’was killed|— near their house and the disappéar-| ance of the egg was explained.The snake had swallowed-it-—and—in—aly-those months had been unable to di- gest it. A Nurse’s-Suggestions Avoiding Grip. Open—air—exerctise taken cvery day, and avoiding house to house visiting, especially where there is a case ofgrip,influenza or the slightest cdld,is the advice of Miss Ada Byford,a About ing this most dreaded malady threat-) such grief is only the common lot of} W.Add. nest,|. Seed cotton,5.25.Cotton seed 57¢.per bushel. (ADVERTISEMENTS in’this column 10 cents per line.cents..Cash must accompany order.) \SKAT=Ask"your~Grocer-=SKAT: CABRAGE PLANTS st D.J.KIMBALL'S. gan.28, SEE A.L.LOWRANCE fer.the best Insur- ance that ‘you can buy.BHELADELPHIA LIFE INSURANCE CO.Jan.28. WANTED—A ‘few select boarders at States-ville Inn.“Steam heat and running water in every room.Apply at INN.Jan,28~-1t, SKAT—It’s the Best—SKAT. \FOR SALE—Good Mule.Bargain for cash.W.L.SMITH,Statesvilie.Jan,28-~2t*. STRAYED |OR STOLEN—January 15th,biackhorsemule,about 700 Ibs.Reasonable re-ward -for information--J..IL...LACKEY,Stony Point.*Jan.28-—1t*. SKAT—Use it—SKAT. found removing photos from Lyric PictureFrames.THE:LYRIC ‘THEATER. Jan,“ag8. FOR SALE OR EXCHANGE—One new Dodge Touring Car for sale or will exchange for CAROLINA aerorJan,23~“second hand Ford: SKAT—Find it—SKAT. E OGRAPHER WANTED Must be speedy, nrate-and capable of handling office work in general.Apply in own handwriting.Ad-dress”H.-M.,care THE-LAPo an.25; Statesville Cotton Market.y- No ad.taken for less than 26 REWARD{—Of $10.will:be paid-for—any-ome |" WANTED. This Bank wants the care of” all the dollars -that are now idle - on t ed |and insecurely hid away around the homes.With us this money will not only be safe but will be ~~ ee o5 G s ph Ra h a A earning 4 per cent,for the own- ers. \ We also want to:‘take care of the business .man “who “needs money at the legal rate of inter-. THE FIRST NATIONAL“BAN Statesville:N-Go capt $100,000.Four Per Cent Paid on Time Depots.ce.S.Depository. i SSTTITTIITIIST IS STeTeT te. Sepsoscoes coves,sI2ITst _THE MOST.oe If you want a Piano,buy a Hardman.By doing | this,yourget the most for every.dollar you spend.Hard-_ man Pianos and Player Pianos have been on the market for 74 years.The company,founded in 1842,is one of the oldest and most distinguished establishments in the Piano industry.Has a world-wide reputation.Financial standing of the highest.It is only by dealing with such firms,that you-are able to make safe investments and.get os positive guarantee of absolute satisfaction,For’for,: ther information,ask ~~s Carlton A.Andee ,547 South Genter st Manufacturer’8 Agent. WANYED—District Manager for ~Statesville and vicinity ;good propossition for the right man,previous experience unnecessary.Free school of instruction.Address MASSAC HU- $BONDING AND INSURANCE-CO,, nt and Health Department,Saginaw, Capital $2,000,000. FOR-“RENT —Tho_Nicholso:._house on Belly strect.DORMAN THOMPSON,executor. Jan.7 SKAT—What is itR--BRAT. HORSES,“MARES”AND MUL ES—I “AM AT my stables with 36 head good —Horses,Mares and ,Mules.Lot of niceHorsesto_trade for —medium-priced— Cash or time.C,E.DANIELS,Dec.24, FOR.SALE—Two lots on Park Street.C.58. TOMLIN.eee Jan,4--8t. Lime,Cement,Laths, and Colcine Plaster. a of.tuberculosis.The inter- ment.was at Damascus church Mon- day at 11 o’clock.She had been .a sufferer for the past two years and death came_as a reticf:— Mrs.G.B.White,who was_pain- fully burned a week ago.is,improyng.Messrs.Sam Dobson,R,K.Hill‘and Robert Lawrence -were among—the number who attended the stock showatSalisbury.Paint has been proeured for paint- ing Athens school house.It is ex- pected to have a “One-Day club”Friday.and the men of the commu-nity will do the’work. Cotton Seed For Distribution. To the Editor of The Landmark: -I-have for distribution in the cot- ton-growing counties of my district a limited number of qtiart packages of new and improved varieties of cot- ton seed for test purposes.It is de- sired to place these seed_with farm-ers who are willing to.make experi- ments under directions of the De- partment of Agriculture and reportresults.If successful the department will furnish next year enough of.the same kind of seed to plant an-acre, Upon teceipt of-a postal:card,—I shall be glad to send a package to any one requesting it so long as thesupply’lasts. 'R.&.DOUGHTON,M.C.Washington,D,C Bad Cold Quickly Broken Up. Mrs.Martha Wilcox,Gowanda,N.Y.,writes:“I first used Chamberlain's CoughRemedyabouteightyearsago.At.that timeIhadahardcoldandcoughedmostofthetime.It proved to be just’what I needed,Ibrokeopthecoldinafewdays,and theoe,sie be pared,e re oe manyreceivfingoRaitnskaa‘all who have it rough. trainéd nurse,who_prescribes for the prevention of influenza or grip:MissByford,writing to the State Board of Health.says she was a child in Eng- land when the first well rememberedepidemicofgrippassedthroughthat country and that she was a hospitalnursewhenthesecondepidemicmade its tour.Miss Byford is now living‘in North Carolina and from her knowledge of and éxperience with this—diseasefceltheinteresttowarnNorthCarolinians against its contagious nature.Shesays:“Air the house thoroughly every day.It is a mistake to shut up thehousetokeepthecoldout,as it only keeps the germs in.’Let the children out;put on their walking clothes.”Miss Byford doesn’t.say don’t kiss or cover up the sneezes,but she says more—avoid the presence of any onesufferingwiththe-slightest—cold,—forinyourcaseitmaybenotmerelya cold but grip 0or Pneumonia. Night Riders Confess Guilt and Escape Punishment. rider trials at New ~Madrid,Mo.,plead guilty and were sentenced to six months’imprisonment and wereparoledongood.behaviour.The peni-tentiary sentence of eight men whosecasesalreadyhadbeendisposedof will stand unless ‘the trial judgeshouldparolethem.The night ridersarelawlessbandswhocommitout-rages in sections of Missouri,Ken-tucky,Tennessee and other States. They operate after the methods 0regulators:and try to govern theirtlsectionsbyforce.They often destroypraeerrtyandmaltreat,.and sometimesill,citizens... speak of it in the ane terms.”Obtainable Thirty-three defendants in night-: _Minterior -and rae CT.WATKINS,next to McElwee's Planters’Warehouse,Statesville,N.G STOCKHOLDERS’MEETING! The ey nec of the “stockholders of Statesville,N.C.,will be held at the office of the Association on SATURDAY NIGHT,Feb- ruary 5,1916.Every stockholder is invited to attend.1.V.FURCHES, Jan.28,1916.Secretary and Treasurer. _ADMINISTRATRIX’S NOTICE. Having qualified as administratrix of H./ Carl White,deceased,this is to notify all per- éns having claims.against said estate to pre- gent them to me_on or before January 17,1917, or this notice will be plead in bar of their re- covery.All persons indebted to said estate will please make immediate settlement. MRS.REBECCA LORINNA WHITE, Jan.18,1916,%Admrx.of H.Carl White. Doors,Windows,Mantels, Columns,Stairways,42 kinds Moulding;Steps,Plank,Cedar Posts, Locks,Butts,Fire Proof Paints. Cc.WATKINS,Next to McElwee’s Planters’Warehouse,Statesville,N.c. Overcash’s Factory. IF you have any business withOvercash’s:Factory ’Phune 442duringdayor95Blackatnight.: Jan.28—8t. A Wood Shingle Roof Was painted with Edmanco FireProofPaintandaballofcottonsat-urated with gasoline nailed to it and set on fire.After twenty mingerethecottonhadburned,but not.a shin- gle was ignited.Sixteen colors’of“Fire Proof Paint”for sale:bOC,WATKINS,"Statesville,N.CG. BUILDING?C.WATKINS. young| -“Mutes:-y7~ the First -Building—and—Loan—Association of |S==== of| Clocks,Watches andSpectacles Retalreds |Spectacle:sh fitted.—eeoe “Satisfaction guar yee ‘GOOD SATISFACTION That’s what'l always try to give,If not satisfied call again.Timeis money...Why not buy yonrself some fot 1916.[have time from $100 up. H.b.WOODWARD Jeweler, DON’T FORGET Our Great Annual ilure Clearance Sale Now.Going On— This :_Week Only. x (rimPaak dias Nee Cimstabiect es January NRNS OF CURREN’ -—acces ane: n ts Gathered From All ‘Parts of,the Country. ;Brooks,the negro who:shot :*‘seriously.wounded Policeman heart at Winston-Salem “last ‘Suriday,has.been arrested, patel atives at Wilkie»&Tanner’s "va mill at.Forest City,Ruther- ford:county,walked ee out.Monday. They.said.they were docked toomuch. e Keating child labor bill was debated.in Congress Wednesday. Three North Carolina _Representa- tives—IWebb,Page ond Britt—spoke in @ppositon, rs.Mallis,living at Chickamauga i attemptedPaxk,Tenn.,to start a fire with kerosene.Mrs.Mallis and three chilgren.dead and an 18-year-old daughter may not recover. explesion that wrecked the plant of elker Blower Company,man- exhaustsuf:rers of planing-mill and#ventilators,at Buffalo,N.Y.,-re- sulted in the death of a number of perBons,4 =carmloaded awith>black-powder-ex-nlofled Norfolk a Western railroad at Bluefield,W.Va., Wadnesday night,injuring more than 40.ersons._several probably fatally, andjcausing heavy damage.Fire fol- lowgd the explosion. dT.Robertson.shot at his broth- er-in-law,L.F.Herndon,at Wendell, Wake county.Herndon jumped behind See and escaped serious hey fell out about a horse obertson was arrested and put-un-| der abbond of $500. :"The rivers and harbors committee| bfi the House of Congress has voted| Lo,include no new projects in its forth- bill but to confine appropria- s solely to projects already author- ae thus limiting the total to ‘ap-| ingFn yorimately~$44.000,000. In the Democratic primary in Lou- fsiana Ruffin J.Pleasant of Shreve- de- of reveport,present -Lieutenant Gov- ernor,for the Democratic nomination ted’Thomas C.Barrett.also election fen:present Attorney General,“ = E The+Governor. ong.horses and mui Yad at.Newport News, reat_Britain. 0 have been shot and8.908,000 worth of horses~and~mutes yaiting shipment,are endangered. indemnity Germany may pay on ac unt of the loss of life on the Lusi- fiia has raised’a question for which tate Departmen no precedent. the Lusitania victims Sresented claims. )The House of the Virginiaef{hes JS Assem y has passed.what is known as th pure advertising”bill,which make a misdemeanor ve.or misleading advertisement.and)aA | rovides for this offence a_fine of And no man faltered.It n in|As for the English,they are too‘om $25 to $250,or confinement il of from 10.to 60 days,or both. «Teams y and Wake Forest won.The scor s painted conspicuously on th alls-of Trinity buildings during th g about “the crime.” unt of-a~basketbalt-game: ro,caught burglarizing a store jovg station,Ala.,was lynched by dynched en route. &§Forestry.Association Meeting. i try.Association at_New Berne th eek C.C.Smoot of North Wilke Resolutions weresecretary.stockndorsingtheState-wide Wwy of injury. trade.|the legal interest 1 occurs awaiting shipment-to G A veteri- gen n says mules to the value of ‘over Notice that several life insurance mpanies will claim.a_part of any Heirs of many of!the Germans #for any.person, ym or corporation to publish a decep-| tight,a Whke Forest pennant was wont to war 3,000 -$fun up on the.Trinity flag pole,!g.afted 15.000 Laan ‘etc.Trinity folks are mad and talk x . ob.The store of Miss Kate Peale|Jndian saves money and ad been robbed five times.The broth- r of Miss Peale caught Burton and |latch. Wore taken to jail but Burton Was!Washington Lisp “At the meeting of the State For- passed | furging the passage of a bill for the had refused to argingtheiheseapproveontinuanceofthepurchaseoffands|public building at Chapel Hill by the government under the Week E Sa ene ee oo urging the continuance of the pol ‘the Federal government in as E PRICES THE WORST. The Remedy. Progressive Farmer,—-— Twelve per cent.a year is too much to pay for money;10 ‘per cent.a year is too much to pay,and to have 72banksinthe.South outside of "TexasandOklahoma,and 617 in these two States,averaging 10-per cent.on their loans—this shows the need for refrom.And yet the,shameful,damnablefactfacesusthatcreditateven12percent.would seem like a veritable god-send,a veritable deliverance ©fromheaven,-to the thousands and.thous- ands of struggling men and women who now bear the burden of our ac~- cursed crop-lien.and “time-prices” system of the Southern States,a sys- tem which is nothing less than a dis- grace to any people who call them- selves civilized,much-less Christian:| Mr.Williams denounces banks that} average 10 per ‘¢ compare the charges of even the most| |junder our ithe people asked that he lighten tax burden imposed by_hisSolomons“My~tittle finger,”-he \ther’s loins.” lof the time-prices crop lien is thick-| ler thanthe loins of the 10 per cent.| eee oT | |As a matter of fact,it will be seen} \that few bankers in the South aver- jage even 10 per cent.on their loans, land while we believe we must enlist lin a fight to compel all banks to obey aws,the important fact to remember now is_that the banker offers the surest present way| of escape from 70 per cent.-time| prices.Let every.farmer who can do so put a deposit in his local bank, keeping as big a balance as he can| from now until spring,and it will be ia strange bank that will then refuse to lend.him reasonable amounts to es- lcape “time-prices”in summer.AD | Feat of Light Brigade at.Bala- klava Often Exceeded. /Will Irwin in Saturday Evening The charge of a record feat of arms.Out-—by Vosges,where the desperate fightin has gone almost unrecorded,the “raw led forlorn hope after forlorn led that feat of the Light ’ ithe first two ranks as doomed men— they were expected to die that the jother ranks might reach,the trench. \brave —honest Germans admit that. |Who has sung the Grenadiers at YpresfromTrinityandWakeFor-|__:;+College played baskétball at Trin-thev who emerged but 70 strong out"of 1.800?Or the Canadians,who had e |not known war for a century,at sec- (ond Ypres?Ora certain unnamed iFrench Regiment Marchant,strong.and has to fill the gaps? No,all the records have been broken All on ac-iby these people,who have grown “soft :through peace”for 44 years.I think| Richard.Burton,an 18-year-old ne-|myself,after what I have seen,that at!the human race stores valor in peace' alto spend it in war,just as a Siwash goods \throw them away on one grand pot- News|Postmaster General Burleson brought the wrath of the ;down upon his head by adop ting is |a ‘for pu S|rress has already appropriated t vicious banks with the charges made’tirely, “time-prices”system,we |The flight of the bats will begin about Propagating Bats’to Destroy, -Germ-Laden Mosquitoes, An army of mosquito-eatingseveralthousandstrong,will ieed.looseinSan Antonio,°:month.If.as has been predicted,army succeeds in crippling the activ~ities of the germ-laden mosquitoulation,manySanAntonio’s example and esigbltheir“municipal bat roosts.”easeA.R.Campbell,who hasymadeaspecialstudyofbats,is re-sponsible for San.Antonio’s bat:roost,|The institution’came last spring.its first year,owing to the fact that itwasestablishedlateinthespring,and its population was not numerous.; spring there is a large army of bats: on hand and it is expected to get an early start. Dr.Campbell says tthecourseof&-day will eat one’thou-| é Lsand mosquitoes. ‘ent.on their money,\of mosquitoes to perish daily and that and he does well,but when we come to|by the end of the summer the pestif- erous insects will.be almost,*if not en- missing from Dr.C. are reminded of the impudent reply |February 15,and made by young King Kehoboam when April 80 they will fly about all night, the|trailing--and father,|Dr.C r ’ay re=}laria,-typhoid in the yards of the Norfolk and |jiieq,“shall be thicker than my fa-|quito,carries, Verily the little finger|ishes it. ampbell says that the more ma- re of Broud Street with said Mulberry Street,and| the intersection of Walnut Street with ~paidthatsaidstreethasbeenduly {paved t the length of ,im-' rovement district;and that the report of R. Greenlee,City Engineer,was.duly filed with}, Board of Aldermen.at the regular meetingnuary7th,1016, ri ,{Mulberry Street, other cities may follow [paved reuinen of said board on Ja: Notice ig hereby further liven thatthe ag- sessments for said street improvement will be pert against the eens erentoe ror \- i ‘og [odby the rter of the City of v on into existence Friday night,February 4th,1916,at 8 o’elock,It was not a success in|in the office Of the Board of Aldermen of the City of Stateaville,in the Commercial Nation- ‘al Bank building,when and where all property owners are directed to appear and show cause, if any,why said assessments should not be made,2 By order of the:Board of Aldermen, “©.D.MOORE,Crerk and Treasurer, Jan,21,1916.‘ NOTICE TO PROPERTY OWNERS. Notice is hereby given to the owners of the praperty abutting on the Street Improvement District heretofore laid out by ordinance duly passed by the Board of Aldermen of the.City of Statesville,said street improvement district hein Court Street,between the intersection of Center Street with said Court Street and the intersection of Meeting Street with said Court Street,that said street’has been duly ‘paved throughout the length of said street’imprave- ment district;and that the report of RL. Greenlea,City Engineer,’was duly filed with the Board of Aldermen at the regular meeting of said board*on January 7th,Tote,mare Notice is:hereby further given that the as- sessments for said street improvement.will ‘be made against the abutting property,as provid- Offering Many “BetweenSeason”Bargains, ‘hat one bat in He expects hordes 12 1-2c,Toile De Nord”Gingham |ESOL A ae 10,light and dark Outing ....0.+++eeeeeeeee 8 1-2c. 10c.Standard Bleached Domestic ...........5 8 1-2e, BIG LOT OF SHEETS—29¢.to 98¢.,full size. PILLOW CASES—10c.,12 1-2c.,18¢.-end 28¢.pair. “READY-TO-WEAR DEPARTMENT FULL OF BAR-GAINS. the”locality. from then until devouring mosquitoes, and other-gernrs:a mos«the better the bat rel-:{ ed by the charter of the City of Statesville,on A CHILD'S TONGUE SHOWSIFLIVERORBOWELS If Cross,Feverish,Sick,Bilious, ing her children “C Figs,”that this is their ideal laxa- \tive,ltaste and it‘thoroughly cleanses_the. tender little stomach,liver and bow- els withaut griping. When cross,. breath is bad,stomach sour,look at he-tonzue,-Mother!fa teaspoonful of this harmless “fruit jlaxative,”and in a few hours.all the \foul,constipated waste,sour bile and undigested food Post.|bowels,and you have a well,playful tt has.been considered for many years full of thejache,diarrhoea, giremember,a good “inside cleansing” 2 »should always be the first.treatment French and German troops have play-|g! hope.| Daily some command or other exceed-nl Brigade;|a te and’10"one*tookthe~trouble:to-recordtomorrow.- it,because desperate valor has grown |Figs,’ 50-cent bottle of “C »which has directions for |District being the sidewalk on the north side of| |Water Street from the incersection of Tradd {Street with said Water Street,to the intersee- oO jsessments for said work will .be made by the Board of Aldermen,as proviced by the charter| § to!||property abutting on the Street Improvemen o other negroes in the store and aaa earanal oie urton attacked his captor and/Burleson Refuses to Approveof ; unded him.His two companions|Plans.. country Greenlee, al inolicy of ‘refusing -to approve plans blic-buildings-in~towns-—-where+ :.ithe postal reeeipts are less than $15,- oro was elected president and J.S+/000 a year and the ‘population is not olmes:of Chapel Hill was re-electedjjn excess of 5,000-inhabitants. This—beeame knowa--when.the de- law,partment anounced that Mr.Burleson owners are directed to plans for a Lif any,why said as Con-=onde, this money but the law says that the plans Cy ¢v ,‘must be approved by the Secretary:of isting States in fire protection meth-'the Treasury and the Postmaster Gen-| ds,endorsing the movement-for_pro-eral-hefore a contract can be award- -tecting-bird life—especiallyin the na-ed,or even bids asked for.In the c In addition to this the of Chapel Hill.Mr.Burlesonitionalforests. ‘association recommended thatressappropriateasumnecessary é TT TI HFombattine the white pine blister must.Would Abolish Electoral College it was also decided to memoriali %he Legislature to make a sufficic appropriation to carry out the pur- ses of the forest fire law whipe Mr.Bryan * President. In a statement issued from } s passed by the last Legislature. Will Not Follow the Te zent Senator Norris,Republican,of Ne constitutional amendment toch eandidates in a State would be certified to Con (press to receive as many votes ris State {tives. braska,has introduced in Congréss a abolish the.electoral college.It proposes that voters cast their ballots as heretofore. receiving a majority ;the has Senators and Representa- The House of Representatives “gyinter home at.Miami,Fla.,Mr.W.J. ‘Byyan says he has no intention of fol- /Jewing in the wake of President Wil- “gon_on his trip through the Middle fires,making a series of speeches in nswer to those of 'the President,on “gpreparedness.He said he would re- froain,in Miami until he left for Lin- pe ipahias’dn February 20 to attend ;Bpnday dinner,:Bryan said he would make ity the trip would have no com jon .with that of the President along the lint of gedIm.Wilson would make Women of Sedentary Habits.. relat * condition,ind moat. a| ew speeches on his way to,Lincoln,nec-|tinople and ish government regarding the opera- {3 references to preparedness would tions the addresses he Mediterranean,to ascert eel aared.last fall.The dates for his a Turkish vessel thai es,Mr.Bryan said,“were ar-sia. before it was announced that and press his speaking word that Aimbassador.Penfield had Women whd zet but)little exercise are likely troubled.with constipation.and indiges- Ohamberiain’s ‘Tablets hich-f m6 good as a three or four- ho that ths %gp very peren better iw wels to remain in a con-ne ,"Pet ce easy and viens|ek.They are The reeable in effect.“Ob- would pass upon the returns and.the jeandidate receiving a majority of the State votes would’be elected.In case iof no majority the House would elect a President from the three candidates receiving the highest number of votes. Maybe It Was Turkey. Washington Dispatch. The State Department will request Ambassador Morgenthau at Constan- to make inquiry of the of Turkish submarines in ain if it was ank the Per- dispatches have been notified by the Austro-Hunga- ing the flag of that nation attacked the Persia, Don't forget.SMITHEY &FRA; LEY have a real sale every day in the Givers.,Don’t fail.to see them.twill do you good.—ad, Give Fr Every mother realizes, becau the Light Brigade |child again. cold, ven. Millions a Syrup tion ‘of Davie Avenue with said Water Street;|:,~.:-+' hat said sidewalk has been paved throughout City of Statesville,in the Commercial Natlon~} jthe length of said improvement district,as pro-al Bank building,when and where al!Property| vided by the said ordinanee;and that the report owners.are directed.LOPS phe ats AD Apa Wace lnc: f R.L.Greenlee,City Engineer,Was filed with if any,why said assessments should not per {the Board of Aldermen of the City of States- iville,at its regular meeting on January 7th,| 1916.Notice is which :ef the City ne 4th,lof the Board of Aldermen in the Commercial prope: National Bank building,property.owners interested are directed to ap- pear and show cause,if any,why said assess- ments should not be made.of the Bonrd of Aldermen.D.MOORE,Clerk and Treasurer. 1916, February By-oxderCc.Jan,21, aspoonful today saves a sick child}: Coat Suits,Long Goats,Sport Coats,Street Dresses and House Dresses:-:#f-interested,this line is worth investi- gating. FIVE-CENT COUNTER FULL OF BARGAINS.| Friday night,February 4th,1916,at 8 o'clock, in the office of the Board of Aldermet of the City of Statesville,in the Commercial Nation: al Bank building,when and where.all property owners are directed to appear and show cause, if any,why said assessments shouldnt be made.i By order of the Board of Aldermen) Cc.D.MOORE,Clerk and Treasurer, Jan.21,1916,, NOTICE TO PROPERTY OWNERS. Notice is hereby given to the owners of the property abutting on the Street Improvenient District heretofore laid out by ordinance duly|#- passed by the Board of Aldermen of the City of Statescille,said street.Improvement district. being Broad Street,hetween the inte ection of Mulberry Street with said Broad Street and the line of the property of Statesville Female Col-| lege;that said Street bas been duly paved} throughout the length of said street _improve-| ment district;and that the report of R.1 Greenlee,City Engineer,was duty filed?with| the Board of Aldermen at-the-remulan di eT of said board On Jarunty 7th,ToTNoticeisherebyfurthergi sesymentS for said street improvement will be made ainst the abutting:property,as provid-|@ ed by the charter of the City of Statesville,on} Friday night,February 4th,1916,at 8 o'clock,| in the office of the Board of Aldermen of the} City of Statesville,in the Commercial Nation-j ~ al Bank building,when anit where all property | owners are directed to appear and show cause,| if any,why said assessments should -not be|& made.is By order of the Board of Aldermen, Cc.D.MOORE,Cterk and Treasurer., Jan.21,1916.: ARE ACTIVE! uit Laxative at Once.° after giv- alifornia Syrup of Dress Ginghams,Apron Checks,Prints,Cannon Cloth (short lengths)Cotton Suiting,Quilt Lining,ete. “a se they .love its pleasant ';“yt gprs enrich Buy now!Prices will be higher later. Your opportunity now for White Goods. irritablo,feverish or! Come and see us.x One of 12 Big Stores That Sell for‘PHONE 242. If coated,-give me passes out of the ystem is stomach- colic—4 ‘When its little threat sore,ha: indigestion, of mothers keep “Califor- of Figs”handy;they know NOTICE TO PROPERTY OWNERS.} Notice is hereby given to the owners of the! Ask your druggist fora alifornia Syrup of ba- so common.nee St re,7 ;a Weis :property abutting on the Street Improvemen . Was there ever a more glorious lost bies,children of all ages and grown-|District herctofore laid owt by ordinance duly Have vour sho *eWal ue ye -\charge in history than that of the jups printed on the bottle.Beware of Seo by Ane yea ne of he oe E y e repair he a Prussian Guard before Ypres on No-counterfeits sold here,so.don’t be [of.Stes ie,said streét {mprovement district|&= nae 5 oe .oF cae ;being Mulberry Street{between the intersee-:\# :vember 15,1914?.-Only the-Germans ‘fooled.Get the genuine,made —by Jtion of Broad Strect.with satd Mulberry St reet |work doneby our expert t-officials say there |know how many men they lost,and \“California Fig Syrup Company.”and the intersection ae ay Avene whut shoe repairer.It only are not telling.But |=oot =_|said Mulberry Street;that sald Street has cen|§‘he ;cae tat eae .INO’bk OoT o-ROPERTY INERS duly paved throughout the length of said street|re $y already .have when the British guns finished _their |NOTIC E TO PROPERTY OWNERS.improvement district;and that the report of R.takes him 15 to 20 min-ar work that night th bservati offi-|L.Creenlde,City Engineer,was duly filed with |§:!q or "aie on a Ne Goer ton Aa Notice is hereby given to the owners of the th none 1 oe Nie Sea en bees 3 a i leers traced cig *¢s ‘0 ans ly-SEN cee Miecidewntle Ove e Board o ermen &>reguk Pe!.3 | -cer ‘ace eight ranks of rermans ly |property abutting on the |Sidewalk Improve-Of aid hoard on January 7th,1916.ig utes to tack or sew ona e\ing dead,In those massed charges of ment we he rs oral’ee oe by ordi pence Notice id hereby further given that RHOnnS - :).y passe »Board of Aldermen of the}3%:;i ine :a ee “Itheirs the Germans used to send in!ci dp sts DYfeo aera ae ns \a@¥¥irients for said strect improvement will be Ss City of Statesville,said Sidewalk Improvement |ide against the abutting property,as provid-|pair of half soles.Plen-*@ ts ; ed by the charter of the City of Statesville,on Friday night,February 4th,1916,at 8 o'clock, ‘in the office of the Board of Aldermen of the} ty of comfortable Spats —you can have work donewhile you wait. made.By order of the Board of Aldermen.} C.D.MOORE,Clerk and Treasurer.Re So + is .iz .;“ hereby further”civen—that<the as-!Jan.21,1916.see \z ,Bey ;In town shoes ealled NOTICE TO PROPERTY OWNERS.:.j 4 'yey aor f d i : Notice is hereby given to the owners of the|<;or an de ivered.& rty abutting on the Sidewalk Improve-|@ :aay = 1]ment District heretofore laid out by ordinance]g ‘duly passed by the Board of Aldermen of the} iCity of Statesville,said Sidewalk Improvement| District being the sidewalk on the north side of | Armfield Street from the intersection“of Mul-{ {berry Street with said Armfield.Street.to the | ‘interesection of Race Street with said Armfield|2 Street;that said sidewalk has been paved!3 Statesvillv,on Friday night,|1916,at &o'clock,at the office| when and where a Remember we shine shoes free. NOTICE Notice is being Broad Street,between the intersection of |Meeting Street with said Broad Street and th lof the City of Statesville,on atch to Greensboro,inte'Street; ection Notice is )made ‘ed by the By order c¢.D.MOORE,Clerk and Treasurer.\Pradd Street from.the inte section of Davie} Jan.21,1916.Avenue with said 'Tradd Street to the intersce-| TRUSTEE’S SALE OF LAND.— ase deed of trust executed by wife,M.J. Con-.‘.has res tand Henkel-Craig Live Stoek Co.,to secure the for fused absolutely to give his approval.indehtedness therein mentioned or jtrust beingtherecordsisterofDeeds of Iredell county,N.4 |having been made in the payments of the in-of the City debtedness trustee will,on SATL at Statesville, scribed tract of te Bexinning at a ste trict heretofore laid out by ordinance duly a . i by the Board of Aldermen of the City on January “th,1916. of Statesville,said street improvement district that said Street has been duly -paved |:~ ‘throurhout the length of said street aprove-(ot the Board of Aldermen in.the Commercial | has ment district;andCity.Engineer,was duly filed wit‘the Board of Aldermen at the recylar meeting of said board on January.7th,19 aessments.forsaid_strect improvement will be| against the,abutting property,as provide | charter of the City of Statesville,on Friday nicht,February 4th,1916,at 8 o'clock, ‘in the office of the Board of Aldermen ofthe | City of Statlal_Bank building,when and where all property of the ‘Board of Aldermen. BY VIRTUE of the powers contained in 12 o'eloe highest bidder,at TO PROPERTY OWNERSS (roughout the length,of said improvement |= “district,as provided by the said ordinance,and that the report of R.L.Greenlee,City Engin-|& was filed with the Board of Aldermen of|& City of Statesville,at its regular meeting |ES hereby given to the owners of thet eer,the SM.&H.ShoeCo. Notice is hereby further given that the as- _sessments—for_said work will be made by the ‘Board of Aldermen,as provided by the charter Friday.nixht, Pebruary 4th,1916,at 8 o'clock,at the office of Mulberry Street with said Broad 1 |National Bank building,when and where all! iproperty owners interested are directed to-ap- pear-and show cause,if any,why said asscss- _merts should not be made.| By order of the Board of Aldexmen. —©.D.MOORE,Clerk and Treasurer, Jan:-24,10'6.a that the report of R.h hereby further given that the as-|| | NOTICE -TO PROPERTY OWNERS.| Notice is hereby given to the owners of *the| property abutting on the Sidewalk Improve-| ment District heretofore laid out by ordinance | sments should not be|duly pasged,by the Board of Aldermen of the} City.ofStatesville,said Sidewalk Improvement: |District being the sidewalkonthewest side of | ssville,fn the Commercial Nation-| appear and show cause, -tion of Water Street with said Tradd Street; ‘that said sidewalk has been paved throughout ithe length of said improvement district,as| a provided by the said ordinance;and that the; Young and report of R.L..Greenlee,“ity Engineer,was} Wed with the Board of Aldermen of the City of | Statesville at its regular meeting on January | ith,1916.al Notice is hereby further siven that the as- sessments for said work will be made hy the Board of Aldermen,:provided by the charter of Statesville,on Friday night, at &o'clock,at the office} J.A.Young,to David J.Craig,trus said deed of recorded in Book 35,page 443,of of deeds in the office of the Res-C,,default 1916, thereby secured,the undersigned February 4th, of the Board of Aldermen in the Commer al) IRDAY,FEBRUARY 5,1916,“National Bank building,when and where all! to the property owners interested are directed to ap-| k,m.,sell at public auction,¢é the court’house door in)pear and show.cause,if any,why suid asscss-|. N.G.,for cash,the following de-ments should not be made.}eeas SPECIAL FEATURESrd: ce in the center.of Brook- By order of the Board of Aldermen. C.D.MOORE,Cierk and Treasurer. 1916. | \ lyn street,Bruce Fleming's corner.thence Jan.iy south 22 decrees east 265 feet to a stake,said|“=.i omigeae op:ieee Fleming's corner,thence north degrees west*NOTICE TO PROPERTY OWNERS.| 265 feet to a stake in center “of Brooklyn -} treet,Mrs.Mills’corner,thence with center)Notice is hereby striven to the owners of the|:hee s of said street N.62 dexrees enst 186 feet to]property abutting on the Sidewalk Improve-|Steel wheels with Staggard S okes and Channel Tires,= the besginn fess. Jan.4,1916, TRUSTEE’S SALE OF LAND. BY VIR’ decd of tr wife,AliceHenkel-Craig Live Stoek Co.to secure the debtedness‘trust being recorded -in Book 36,page 566,of |eer,sof deeds in the office of the Reg-|the \the recorTurk-ister of Deeds of Iredell county,N. fault having been made in the payments of the ;indebtedness thereby secured,the undersigned the trustee will,on |Board of Alde:men,as:provi SATURDAY,y fe pce m.,sell at public auction,to the |February 4th, eon ca Ale ‘‘highest |bidder, Germany has disclaimed the act,|!Statesville,North Carolina,for cash,the fol- brought }lowing described lots, lots, Cowles property .feot on Reynolds stréet,and 50 feet on.Harri- rian g@vernment that no U-boat,fly-json street.For be | map of the Cowles property,registered in Two seethe Regist;Book 2 j .Jan. No change of (tate:te “present same to.mé on or pore the |.ith day of January,1917.W.8,REID,They jad.guaranteed after 12 o’clock tos},Ik e MeLauchlin,Att'y.Adminiatentor: morrow, page 163.»1916.°\ a=cart ne «Yaeee peepee themeKDVERTISERSwillplease Real Bargain!change of copy early. ing,containing one acre,more ov |ment.District heretofore laid out by ordinance | DAVID J.CRAIG,|duly passed by the Board of Aldermen of the | Trustee.|City of Statesville,said Sidewalk Improvement the sidewalk on the west side of|tion of Water to the inter- Removable Dust Proof Wheel Bearings. One Lever to Control Whole Machine. (9)Double Edged Knives (9).Automatic Stalk HOOK.<"2...Sow Few Castings.No Wood. IREDELE HARDWARE COMPANY. = |District being k Mulberry Street from the intersec $eee aera iStreet with seid Mulberry Street TUE,of.the powers contained in ajsection of Front Street with said Mulberry| ust executed by M.L.Cowan and}Street;that said sidewalk has been paved Cowan,to David J.Craig and the |thronghout the length of said improvement dis- in-|trict,as provided by the said ordinance;and| of {that the report of R.L.Greenlee,City Engin-| was filed with the Board of Aldermen of | City of Statesville at its regular meeting on nuary 7th,1916. Notice is hereby further.given that the as- will be made by the ied by the charter of the City of Statesville,on Friday night, 1916;at 8 o'clock,at the office in lof the Board of Aldermen tn.the Commercial | {National Bank building,when and where all) property owners interested ate directed to ap pear and show cause,if any,why.said assess- id not be made.of the Board of Aldermen. D,MOORE,Clerk and Treasyrer. Jan,21,1916. -NOTICE TO CREDITORS. faving qualified as administrator of the ae lentite of 8.D.Moore,deceased,I hereby no- bring (itv all persons having Glatms against his:es« therein.mentioned,said deed C.,de. Ja|ais a ee a Timber Boundaries ! We are in the market for STANDING TIMBER. Write or ‘phone us. BOYC igessments for said work FEBRUARY 5,1916, at”the court house door towit:and 14,Block C,of the! southéast Statesville,60)ments shoulByorderCc. Nos.7in tter description of the ahove er of,Deeds’office of Iredell county,DAVID J.CRAIG,Trustee.|E LUMBER CO.Geo.H.Myers,”oeconms |.V Saba and Manager. |"Jan.4,1016. ie ICKENS!IT’S ee ‘‘Dodson’s LiverLiverandBowelGleansing You Ever Had. ‘Acl makes you sick;you loseyk.~Calomel is quicksil-vates;calomel injures | ag VEL,ee ,ibuarebiliovs;fee!lazy,siug-il “kiineded out,if yourareconstipated=and ~yourhesor-stomach is sour,just:of harmless Dod-'ssjlivor Tone instead oening,salivating calomel.Dod-bn’s Liver ‘Tone is real liver meYou'll’know -it-next;morning‘/because.you will wake up feelingfine,your liver will be working,yourheadacheanddizzinessgone,yourstomachwill-be sweet and bowelsYou:will -feellike..work-ing.You'll be cheerful;full of vig- or’and ambition. Your druggist or dealer sells you HORRIBLE!IOUS,CONSTIPATED. “Tone”Will Give You a BOcent bottle of ~Dodson’s LiverTone“under my personal guaranteethatitwillcleanyour-sl ‘make-you sick and you can eat any-thing you want without being sali-vated,Your “druggist “guaranteesthateachspoonfulwillstartyour liver,clean,your ©bowels andstraightenyouuebymorningoryougetyourmoneyback.Children glad- ly take Dodson's Liver Tone because it is pleasant tasting and doesn’tgripeorcrampormakethemsick. I am selling millions of bottles of Dodson’s Liver Tone to people whohavefoundthatthispleasant,vege- table,liver medicine takes the place ef dangerous calomel.Buy one.bot- tle on my sound,reliable guarantee.Ask your druggist about me. 62,JH SES 1 $1.50 Eclipse Shirts,.Special Sale Price$1.00 Eclipse Shirts,Specia!Sale Price .See window displav of these Shirts now on sale. SPECIAL PRICES ARE CASH.| ——’PHONE NO.83.——— SHERRILL-WHITESHOECO. oy 3 al 98e. 75e. TEEN FOR SALE![a]| 800-acre Alexander County Farm,near school and churches,near- -est railroad station six miles,fronting on both sides “of public road,soil and-location well adapted for fruit,grain and stockfarming.Over two hundred fruit trees. dwelling,two tenant houses,b ed by branches and springs. level and productive,balance-+~hundred thousand feet of timber.Bargain at $17.00 per acre._ Seventy-eight acres one and one-half miles’from Statesville,ad- joining the State Experiment Farm, ‘Yevel and productive,five of which is branch bottom,balance in Three-room cottage,small barn,two branches. located for dairy and truck farming.: For further“ifformation call on or write,ERNEST6.GAI OFFICE NO.1,MILLS BUILDING. The Statesville Realty &InvestmentCo. As a great many policyholders do not seem to know.thattheirinsurancewillbevoidundercertain.conditions named in the contract of the policy which they buy. mention some of the causes under which the same will be renderedvalueless,viz:1—Vacant or idle property for longer than 30 days—apply to your agent for permit.——_2—Mechanies—making—additions to,or extraordinary altera= tions in or on property—always get permits from agents.8—Property upon which there is a mortgage unless notice of ‘same is given—apply to your agent.4—Any change in the title or ownership,or interest in proper-ty insured other than by death.as 5—Assignment or transfer of property to another. 6—By any increase in-the hazard;notice-must be given. -..4—-The-taking-of_other insurance.without notice.-8—Keeping explosives on the premises without permit otherthankeroseneoil. 9—Property encumbered by chattle mortgage. Policyholders should read lines 7 to 30 of the printed contractItisimpossibleforagentstoknowofthesede-all on us for any INSURANCE infor- “WE INSURE ANYTHING INSURABLE.”J.F.CARLTON,Manager, *PHONE 54. of their policies...ficiencies_unless_notified. Certificates of Deposit Two-story,six-roomWellwater- 00 acres in cultivation,generally “fo and out-buildings. woodland which will cut over one Forty acres in cultivation, Well GENERAL INSURANCE,RENT-ALS AND REAL ESTATE. Eres We deem it advisable to STATESVILLE,N.C. Issued by this bank bear interest from - date at the rate of 4 per.cent per an- num.Savings Deposits 4 per cent, credited quarterly. 2 Checking Accounts either large or small cordially invited. We want your business. People’s ‘Loan and Savings Bank. OFFICERS:GEO,H.BROWN |{E"0.L.TURNER -.Presidént. PAPO nananaanTs “your uggich liverbetter,than nasty.calomel;it won" fH}ment. ‘hey come are as follows:Lookout, Sheols,12 miles west of Statesville,|the textle industries of the Southern 30,000 horsenower;Catawba station,States,”:: an B forced,so to speak.This has been very jably several years to come, fi onerated: in time of low water will increasethe|ai flow of the river to this extent and it|the| a wheels at Lookout Shoals,at-Cataw-|Biba,at Fishing Creek.at Great Falls| and Rocky Creek,and every time it; \passes through these wheels it will}igenerate so much current.qof_this| water makes the general,propositionf— -|the propositions becomes more ~|more pronounced. #iture of indigo has lead:me to#ithat the production of this crop in the| 8 |State .will be unprofitable. 8 turnsBicultivation of the crop willBifoundsufficienttowarrantits cultiva- 3 ton.3 |Europe,.coal tar dyes:would take theHiplaceoftheindigoagain,and it hasHibeennexttoimpossibletofind”seed- FRIDAY,—.~~---January:28,19 THE PGWER.-€OvS PURPOSE. The Reason For the PurchaseofLandandWaterRights.inBurkeandCaldwell._ The activity of theSouthernPowerCompanyinacquiringlands,water‘rights and -power-sites..generally on.the upper Catawba above MorgantonandRhodhissandsimilaractivityalongthatstream’s principal tributa-ries,such.as John’s.river and Wil-son’s.creek,in Caldwell county,haveattracted.much attention.--The-com-pany has recently paid out much mon-ay for land and water rights in Burke -ounty:One bank in Morganton,The THE LANDMARK|—OPP.|Members:of Committee ©GiveReasonsForOpposingChild}: MINORITY.OPPOSE BILL.” Labor Bill. A-minority report on the Keating anti-child Jabor bill,attacking -meas- ure as unconstitutional,’was ‘madetotheHouseofCongressMonday.Representatives—-Watson,..Virginia;Houston,Tennessee,and Albama,.signed the minority report.After setting forth that there is nodifferenceofopinionastothe.mis-fortune of the evil of child~labor,in its moral and physical aspects,;the minority added: “There was a ‘stern decree pro- nounced upon our first parents in the Garden o obedience,that henceforth in the Tandmark learns.has received depos- its agererating $100,000 as a result of n Burke.angineers in the employ of the Pow- sy company began surveying lands inCaldwellcountyonwhichthecompa- ny has options,and it is probable that Bimuch meney will be spent there for land and water rights.There has been:much speculation as.to the purpose of the company in making these purchases.People’in;*hat territory have-visibns.of gigan-tic:development that will include not only the building of ‘hig electric plants ei but electric railway lines.The Char- latte Observer gives some information about these purchases that is ©first hand,Charlotte being the headquar- 2 tars of the Southern Power Company. Savs the Observer: “A glimpse of such a mapwill’show ‘hat the ~Southern-Pewer-Gompany ers already in operation or under way of the field will justify such develop-These in the-order in which sear Rock Hill.10,000 horsepower;a ishing Creek,_below—Chester,-S.-G., Reecky Creek.32,000 horsepower, it tumbles down from the uplands to the alluvial plains be‘ow.There are Hicther undeveloped sites at Wateree near Camden,at Lansford,near Lan- easter,at Mountain Island near Char- lotte,and elsewhere,which when util-ized,will bring the output,over.200,- £00 of hvdro-electric power.‘ “This—isFact..No,1in.the logic of o situation. “Pact No.2 enters in the considera- liion of the flow of the stream.In the sot summer months,along in July,| &)August and September,the water in the river falls very low and the resultZiisthatithas-heretofore been neces- jsary for the power company to con- 1struect monster steam plants at stra- jtegic points in the transmission:fieldjinorderthattherivermight:be rein- these steam sxpensive snd difficult because auxiliary or supplementary fo vlants only operate apout two months| in the year,which 1nakes them very A costly.Mm “It is manifest that if the power Wi cempanyv| m@icreat advantage would accrue. could--devise some planwherebytheflowofthe_river in times of low water could be increased,that This iis just whatis planned at-some stra- =jtegic point above Rhodhiss and it is mass ihe key to the riddle of-the activity Bi of the Southern Power Co.in acquir-ing so much land in this general ter- B ritery.“At-some date,as yet remote,.prob- A;Catawba,or one or more of its trib- fiutary streams,and thus pond up a Ai zreat reservoir of water.Hi much water can be-impounded is for;your home—keep it #\the engineers to say,but an effort will ‘be made_to store up the-greatest_vol-lume possible.Having done this, as the -water through the wheels,current will will pass successively through “This six-fold utilization feasible..Indeed withowt this it would| inot be possible.since the development} 'lis very expensive and difficult.Again,; Bitoo,as otherer.powers are developed | slong the river the attractiveness of | It should be stated in this connec-ition that no early development of this|jidea is contemplated.The rights are|being.acquired now—“because they| ;would doubtless be much more expen-|jsive later.The Southern Power is)the logical:corporation to undertake| the development;indeed no other con-| fs icern could do so because only the ty-| ing together of the two general enter-| prises makes the first feasible.| “A great reservoir,capable of im-! 8 /nounding millions and billions of gal-| lons of water and one that would back| B ithe water well up towards the head} H#i;waters of the Catawba,is a dream} Sifor this section that is not very far} 3 |distant. :ae stream be regulated and control-|BS le Then indeed will the flowof| and the harnessing of the river} B |will be contemplated.” Indigo Not Profitable. A few weeks ago Commissioner of |#|Algriculture Graham advised the far-|Himers of the State to take up the cul-|H tivation of indigo.Hihas seen a light on the indigo matter} 3 land has changed his mind. The commissioner | He says:| “Further investigations into the cul-|believe| The re-|hat will be received from the|not be| With the.return of _peace in men who handle the seed,” i bread. sales to the Southern Power Company ‘have elapsed the children of men haveAfewdaysagoingbalanowaytoescapeitspen- talty, j¢xist.in the world,we much fear that land Wyoming,”|says,jehild finow has no less than five water PoOW-|special exemption,can be legally ad-‘| |mitted to factory work and in theseZiontheCatawba-and-there are-several |States-only-10;553>that-age;according {others of monster proportions thatjta the last census,were employed in will come on later,when the demands }manufacturing and mechanical opera- laffected lar making a total of 141,000 horsepower| Aion the Catawba.river at the-varioust rereSictratericpointsolor:the stream Ys Just how} flows |ferments and sours and forms gas; be |causes headache,dizziness and nau¢T This water thus released 182a;-eructations of acid and undi- andjf | sweat of his face should man eat his In.the 6.000 years which So long as poverty and want the great mass of ‘mankind,adult:and ‘adolescent,will have toe toil in’sone‘form-for their daily bread despite the jlegislation of the most enlightened |governments.” |The minority said-thatof the couht-be less thousands of young laborers only vabout -one-in-45 are-engaged“in®*the}.jindustries affected by the bill and‘of these less than 45,000 reside and|work in States which have not already iby local laws prescribed substantially |the requirements as to age and night/work provided in the bill. “North and South Carolina,Mexicotheminorityreport “are the only States where a under-14-years,-unless-under tions.The bulk of!those,therefore, by the age and night work provisions of the bill are engaged in ‘Would-Have Guns Like Germans Binow under way,87,000 horsepower;| 3iGreat Falls,32,000 morsenower and Plans for coast defense guns,simi- to the great 42-centimeter Howit-zers With which the Germans batter-waythrough Belgium and the frontier.are being prepared by the War Department,accord-‘ing to testimony given by Col.Charles 'G.Treat of the Army War College,before the Senate military ¢ommittee. |The officer said that the War’De- partment has definite information re- garding the powerful guns.and—that they can be fired without mounting them on concrete emplacements and can be made ready for use “in”Tess than anhour and a half after they : reach a given point.Primarily they will be used in coast defense work, ‘although motor tractor plans for their use in field operations also are being +worked-out.- |Luther F.Long,Geo.-A.Warlick and W.E.’Bacon are promoting a\The char=|glove factory at Newton. \er has’been ‘applied for. mon,Ala- Eden for their early dis-},~ =mi eT Does Pain Interfere? ‘There is a remedy.: Sloan’s | Linimentg Read this unsolicited grateful testimony— \\ Not Jong aga my left knee be- came lame and sore.It pained me many restless nights.So se- tious did it become that I was j..forcedto.consider-giving-up.myworkwhenIchancedtothinkof Sloan’s Liniment,Let:me say—lees than one bottle fixed me up. ;Chas,C.Campbell,Florence,Tex, Ja) a me am|x | mla a Gorham’s Sterling.Silver| Is all that could be desired.We have it in ©.) Knives,Forks and Spoons of all sizes and in.sev- eral different designs,at the right prices.We a have Catalogues and price lists we will be glad ele to give you,—"":ais SON Se ey R.H.-RIGKERT & --JEWELERS..So STOMACH ACTS FINE!INDIGESTION,GAS,|.HEARTBURN,ACIDITY! \“Pape’s Didpepsin”Fixes Sick, |Sour,Upset Stomachs in Five Minutes. |You don’t want a_slow.remedy \when your stomach is bad—or an un-jcertain one—or a harmful one—your istomach is too valuable;you ‘mustn't injure it with drastic drugs. |Pape’s Diapepsin is noted for its |speed in giving relief;its harmless- jness;-its certain,unfailing action in it is the regulating sick,sour,passy stomachs.| jpurpose of the Southern Power Com-/Its millions of cures in indigestion,|jnany to throw a great dam across-the dyspepsia,gastritis_and-other stom-;ach trouble has made it famous the;world over.: Keep this perfect stomach doctor in handy—get a ‘large.fifty-cent case from any drug lstore and then if any one should eat aisomething which doesn’t agree with power station will be built just below|them,if what they eat lays like lead, Bithe dam and gested food-—-remember as sdon as Pape’s Diapepsin comes in contact with the stomach all such distress vanishes.Its promptneéss,certairty and ease in overcoming the ~worst stomach disorders is a revelation to those who try it.- Hyacinths Three lovely Flowers inbeautifulBloom,ready tobesentoutthemoment your order reaches us,OurGreenhouseandstorehavetheappearanceofsummer,and when you enter theseplacesyouforgetthattheweatherveryoftenisplay-‘ing around the zero mars.We have choice Flowersthroughoutthecoldweath-erin as beautiful varietyassummer.Ours is a Flower Plant prepared to with the utmost.satis- faction. Van Lindley (o., GREENSBORO,B.6, Polk Gray Drug Co., $ NO IetorereseseseteseITIIIITeroeTTTTeesisiitestektitessaseeesoes PPLIPSPPOSPTISSPSOSIPEIISSOTO TT PeerrT ere riilisseeesieseeeeeeeeeeeseeeeeeeeeeee Commercial Nati nal Bank 4.OF STATESVILLE,-N.C.~~- Capital Stock Paid in -$100,000.00“ _Surplus and Profits 31,500.00 3 Members of Federal Reserve System. Your Banking business solicited and every acconimodation extended to de- positors consistent with prudent bank- ing methods. Four per cent..paid on time and Savings Deposits remaining on deposit.thr “months or longer.—OFFICERS: W.D,TURNER,E.MORRISON,_-D.M..AUSLEY,-G.E.HUGHEY, -Presiden -Vice President.— o Cashier,: -Assistant Cashier. Roses,Narcissus,| oS -YOU SHOULD SEE OUR DISPLAY OF QUALITY STATIONERY f 3BythePound,the Box and le in Correspondence Cards. All the newest designs and -colors.“ Statesville Drug Comp’y, Quality Prescriptionists. SPPPPITTSSOLOSLISPISIIT PST IIII ISIS Te TIT eet s se SPSPITTITTIFIITIII TITIIIS: serve you the year round ]} Local Agents, Practice Economy This Year!:Feed Edgar-Morgan Co's Mixed Feeds, Not screenings or offal,:or:worthless by-products,but selectedfeedscien-_uytificallyblendedforresults.Made/y a house with Old Beck Sweet Feed. Little Ned Sweet Feed. Manna-Rice Chick Feed. Gem Scratch Feed.’OL;‘a reputation for.Gem Sweet Dairy Feed.integrity.)“CW.BOSHAMER,-Local Répresentati’Phone 125 Black. wipsalen tirana petit)wsBhbay&i >WHAT GEN.GRANT — nl of —Acts of Grant and RoosevelSoniewhatSimilarto.Those of ‘Wilson,:pa 4 a To rdad the remarks.df.the*thought-less,or the ill-informed,or those whoare.simply_seeking o partisan advan-tage,on the foreign policy of the ad- ministration,one would think —thatnever-before—in—-the—history of‘country had an American citizen beenkilled.by foreigners or suffered loss of property or any injustice’ina “for-eign land.But some incidents in the nast are being brought to light:to con-fuse these’people.A massacre _ofAmericanswhichoceurredatSantia- go,Cuba,a good many years ago,iscitedbythePhiladelphiaRecord.TheerewoftheAmericanship,Virgin- ius,were lined up and shot by~theSpanishgovernmentonthecharge that they were engaged in filibuster-ing.Captain Frye was slain,with themen.—The affair created_..afitense in-dignation:in the United States,“but there was no war.This governmentwasgiventhecapturedshipandthe Star of the West had the contract totowhertoNewYork.Off the mouthoftheCapeFearrivertheVirginius went down and her bones rest there to this dav._When,this otitfage occurred;says the Philadelphia’‘Record,“a.weak- kneed and,Joquacious poltroon named U.,8.Gtant was in the White House: We never heard the general so.de- seribed,but that is what the whole yelping pack of Republican curs —are barking at President Wilson,and he is eon aos %|Description of a Well Known Type—NotSo Numerous_as He Was—Judge Long. A writer in the Concord Tribuneasksthe-question,“Is:the public:los-ing interest in /court?”and answers itintheaffirmative.’He thinks thecourtsare-becoming —more.business= like;that fewer people attend courtwhohavenobusinessandthatwhentheygetthroughtheyleave.~-The- court hanger-on,formerly so numer-ous:isnot;-however,-entirely.extinct, ‘in-Cabarrus ‘or any other county.andtheTribunewritergivesthefollow-ing des¢ription of this type:“And here it might.be well to ex-plain to those,unfamiliar with the court crowds just what a hanger-on is. miral declared he never would,under|(Who he is might be better,but a any.circumstances,recommend any ja hanger-on is,hardlya person—more »less quality or quantity of food for!of a thing.)He or it,call it he,as the sailor.2 Michie jit sounds,or rather writes,more nat- seprneentetis eer a eee a on that ae along whether the United *8 SuC-|the front row at every sessior yo pare could send 200,000 ,soldiers)cry court.He is ever present for he to the Philippines and properlycare |js seldom employed,being of that for their provisioning.:|\tvpe of father who lets the children “Jt would present gigantic propor-|do the work and is known in certain tions compared to the much smaller circles as ‘secretary and treasurer of number of men we have to.feed in the family,’if he resides near a cot- the fleet.”the admiral replied,_button mill,ona ‘shade tree’type of cit- the feeding of 200,000 men is no /jizen if he lives on the farm.He picks greater problem thar feeding 2,000 Font the most-conspicuous..seat possi- if we have the same sources of sup-|ble,assumes the lightning rod of hone ply and refrigeration.The distance |and waits for the bolt to strike,He is no Beeb d it cost $18 1\waits and waits and wha if neces- Admiral McGowan said it cost $18,-sary,never deserting the post at a 000.to $25.000 to educate each cadet |time when there is the likelihood of a at Annapolis,and that the results|jury being selected.Of course he were worth it.Of the $130,000 ap-j|assumes the attitude of one who more propriated last year for the naval re-/or less detests jury service,and when serve,_only..$10,000 had been spent,|the sheriff-wtters those magic words,doing just about what President Grant --he explained,as only 176 men had re-)“My,Hanger-On,take a seatein’’the tid in't873.Gen.Grant did not send sponded in the first six months of this|jury box,”he invariably looks at:that ja fleet to bombard Havana.He did fiscal year.ee one ina can Ag ae a ee invade-Cuba.He ae not declaee .+.4 Shocking surprise.ter the first few)war on Spain,even though Spanis Worked For Nothing and Saved thrills he places-his big,black hat on}afficers,en not freebooters and ban- the People Many Thousands,ja hook,removes a tee dits,had committed the outrage,He :te .lwad of tobacco and takes a seat.imadea demand ‘on the gavernment of epepiatown,Vas Dispatey $19,393.33,(2 lawver does not commit’the vicious |Spain for the surrender of the surviv- plus interest,due him for four years|act of having him 4stand aside,’hejors,for,indemnity,.on account of ‘the and ten months’work that has saved (reaches back,pulls forth a plug and jvictims,for)the disavowal of,,..the the-people several hundred-thousand|replaces the huge chew that |1 fe ;Fed,—“. | Ifwe serve¢aboard.shin the Gat to sathe shells;if we serve potatoes,they want to see the and they're entitled to,”said. “Admiral McGowan,paymaster @ navy;in-telling the House na- Yal committee that American blue- ---jqekets-arethe best,fed body of men in the world.. hen any of our men has.eaten what’s on the mess table,”he added, “he’s had a mighty good meal and he’s satisfied.”While the naval ration costs 86 cents a day per man and the army ration about 26 or 27 cents,the ‘ad- $12.50,$15,$17.50 and $20. These are splendid values and up to the minute styles.Yours truly, MILLS&POSTON.& \yavive iya\iveviivert Aart Tani VaNuaniiVayii Fav'fattvenivavityaviravn rai Vevivaxitvantt @vuve\l/e\lieviyayb avkvel vant favty SIZ MI NZ PD B U I Y OO S We y EE E ss The International.Typesetting Ma- chine Company,better known as the Inter-Type Company,organized about three “years ago°by“the-tate Herman Ridder ‘and -his associates,was sold at auction in Brooklyn Monday for $1,650,000.It was boght by a reor-ganization committee,of which Ed- ward .B.Adams,Henry Cooper and Richard Swartout are the managers. The International is a competitor of the Mergenthaler company. “WOMAN ALL RUN DOWN Made Strong’and Well By Vinol Waynesboro,Pa.—“‘I was all run down after a hard spell of bronchitis so it washard-for me tokeep about._I had pains’ ‘in my chést and took cold easily.AfriendaskedmetotryVinol.1 did and it built me up so I am strong and wellandTamabletodomyhouseworkwhich}haiinot-done for three months before ‘taking.Vinol.”’—Mrs.Y.R.Hor-BOUGH,Waynesbaro,Pa.Vinol creates an appetite,aids diges- tion,makes pure blood and creates strength.Your money back if it fails. W.F.Hall,Druggist,Statesville,N.C. "WN a | —akt ‘- he Nae aBsnace and the punishment x the 5 3 usual thrown away in celebration 9 vis bes}persons responsible -for-it.And Spain Se TS eee ee ee yohin Ne Ja {ine selected,looks over’the crowd |granted the terms.”The.._.M.<i cobs,Pennsylvania’s honest man.He With a gaze that reflects the Joy of mundane amy vatcommitted:te has just gone out’of office as the con-|having landed.and leans far,farvee f onstituied wall troller of Montgomery county,the back.It matters not if intellimence)but by rebels and bandits,whom Car- duties of which office included the incapable of measuring justice is en-jranza is cleaning up ata satisfactory stopping of leaks.Dr.Jacobs stopped |throned in the place of.justice.or rate.But there is yet another case— the leaks,which were many and va-|that a blood-bought right of long'the capture of an American citizen, ——"“pjed;and he haslifted “169,000 people;vears azo gave-an American.citizen..Mr,-Perdiearis,by Moroccan.bandits.} to nearly the right to he tried by a jury of his Colonel Roosevelt was then President.hat-amounted.:n Sahoo an wae them worth about peers.Mr.Hanger-On is on the ju-But Roosevelt did not go to war about 000.,lit.The Record makes the excellent$300,000.He also reduced the taxes TY!Hite.; from three:mills.to-two mills,saving;1 point that the precedents set by Grant $128,000 in taxes in two years.And |at this term of Cabarrus court,and Roosevelt are no justification for ‘‘he proved that taxes of one mill were |Same writer says:;_|Woodrow Wilson,“It is his duty,” “~="all that the county needed.aaa “Judge~Long-was hiehly-eompli-+says the-Record;-“to-be-more-beHiger= Dr.Jacobs was an army surgeon in,mentary in speaking of Cabarrus’new jent than either Grant or Roosevelt. the civil war.He is 77 years old and |court house.*He was liberal with He should have wasted no time in cor- one of the most active men in the/|Praise for the commissioners and all respondence with Carranza;he should State.He has’made a fortune in|Tesponsible for the newly -remodeled have sent troops into Mexico to set banking.They call him “Lansdale’s |"nd highly adequate building.Some-up a government that would protect ’Grand Old Man.”|how there’s a go and action to Cabar-.Americans.Grant didn’t do anything %.“J told them,when I took office that |rus courts when Judge Long presides.like that.Roosevelt did not.But for I-wouldn’t take a penny for my work,It is called to mind that he was re-jpurely political purposes the Republi- ‘and I won’t,”he says...“It-may both-|Sponsible for starting the movement jcans protest indignantly that Wilson “er them,but’I won't be a liar.They toward building the new court house ought to have done so.” say I'm a millionaire and don’t need jand iail.The grand jury had recom-. the money.I never was a million-mended that a new jail be built.Ev-Millionaire Built aWidows. ALU UN TERE TT ATTUETATTTENTEANTRALEEEUATER PER UREN TER EVEN NENERSASS See us for best goods at lowest prices.Listen!Ahandsomefour-piece Dining Suit in Solid Oak,Fum-ed Early English or.Golden Finish,with an 8-footExtensionTableand54-inch Buffet China Closet and Serving Table to match at $55. We also have a few more articles at closed outprices.Come in and look over our line.We_take_ pleasure in showing you.oe The Lyric Theatre Has acquired a reputa- ~tion among’particular ~ people for giving a con- sistently high class run of photoplays.You may always expect something better at this theatre. We offer TODAY America’s most popular photoplay star, BLANCH SWEET,in “THE SECRET SIN” ~Nothing she has “done previously on the screenismarkedwithsomuch artistry as her perfor- “mance in-this production. Touching Judge Long,who presidedthe ~The Williams Furniture House.]}FAVORITE STORE.ay THE BEST COAL! It is time you are ordering yourfuelforwinter.The best coal for general use is our celebrated — Genuine Jelico Powhatan Blue Gem Pennsylvania Anthracite tun of Mine Steam Coal. We also handle Oak and Pine Wood,and do all kinds of eo. Moviig household goods a specia Holland Bros. FRESH LOT Malaga Grapes, Town —For! aire,nor half of one,but I don’t need |ery one knew the court house was too j the county’s money and don’t give |small and out of date.But somchow three hangs for any more than I’ve |the proper attention was not given to got.”ithe matter until Judge Long toek—it: emcees lin his hands.Then things were start- The Bell and the Independented.The commissioners became busy, ’Telephone Exchanges.public interest was aroused-and imme- ‘Remarking on the fact that,the ldiately saw the desire for new build- lings.the money was borrowed and the Bell«Telephone Company has agreed |)uilding pacer Everything. Sand Sprines,Oklahoma,was built} for widows.The story goes that they‘compose more than a fourth of the|5.000 ponulation.The town was found-, ed by Charles Page,multimillionaire| ‘oil producer of Tulsa.His earlier rec-' ;I .;‘ollections were of his mother’s efforts| to connect its long distance tines with|“And just here it may be added that to rear her large family unaided,and| “the independent exchange in -Concord,|5,4 i ,\eye ie one |enpmenen=‘-co ge Long may be called upon —to‘he-resolved that when he grew “up he | the Tribune says this means that the|county home.;would take care of all the widows.|twive Cabarrus a newBellcompanysurrendersthejestthacounty“heeds one and it takes no.When he made his fortune ~Page) field to the independent company,and)founded Sand.Springs.He built4n-thi A eon the Debune ives ieitt of prophecy to see that it wilt j 2==ATE-OM8 CO ae ‘have one and have one before many dozens of comfortable cottages,in) which gas.fuel anu rent were free.|the following information as to Bell |months.Judge Long may probably Factories he bought so the «widows,and independent telephone exchanges:lcs tie wark Coat nace Wd arsesee:y sti at least ¢petus ==-4n the United States 23.5 per cent +4 it.»‘have employment.He built a car line to Tulsa upon which widows ride free.of the telephone exchanges are own- :is ..op thy the,Bell cvster,aug Pee Social Service Conference.There is a day nursery,free medical| ed Cie kgesoments with the long,Dr.Edward Kidder Graham,presi-‘attendance anda vocational school.| 5 ce lines of-the Bell system.,In/dent of the University of North Caro-If a widow wants to:get married Page distan :y i .‘helns.her do that.<re likes”grand-| North Carolina the contrast between|lina,was elected president of the mothers.too.There is.a score of the eeeof cen exten ag the |North Carolina Conference for Social them here,with nothing to do but knit! number of privately owned exchanges|Service at its session in Charlotte and read and reminisce. Oranges, Apples, Lemons. Sherrill &Reece,TOMORROW vee ne-:Depot ’Phone No.7. A special program con-Phone 123.108 West Broad St Residence ’Phone No.310 Black. sistingof a two reel Key-oe —= _stone comedy,a tworeel Stop!Look!List en! drama,and_another Rell exchanges _in North Carolina,gent:Bishop Thomas C. connected with the long distance lines this week.Mrs.Thomas W.Lingle of is even more striking.There are 31 Davidson was clected first vice presi- on :Darst of while 282 privately owned exchanges |Wilmington second vice president.and in NorthCarolina are connected-with |p);,“WiHtiam Louis Poteat,president the long distancelines of the Bell s¥s-'of Wake Forest College,third wice “tem,and the subscribers of these con-|president.:ze necting company “exchanges receive’‘The conference adopted resolutions the same_long distance:service which |favoring the establishment of insti- they would receive if they were sub-tutions for the rescue and correction seribers to Bell exchanges.The Bell o¢wayward girls and fallen women; exchanges in North Carolina have ap-'endorsing Jackson —Training School proximately 21,500 telephones,while anq urging its enlargement;endors-he_exchanges_priva -ADL.ing-syatematie-co-operation for chari- connected with the long distance lines |tale’work and more adequate pun- of the Bell systenr have approximately |jghment for wife-deserters;endorsing 56,500 telephones.State-wide celebration of -Shakes- \:ow.Pe,.Eine .pearean Ter-Centenary by all schools. Heart Disease Takes First Rank colleges and societies;endorsing work —Its Causes.~\of State Insurance Department for That heart diseases kill more pconle making school buildings more safe; in the United States than tuberculo-enproving sane censorship of moving ‘gis,pneumonia or any other disease,pictures,etc. is the statement given out by Direc-!tor Sam.L.Rogers of the Bureau of Good Roads Bill Passed House.the Census.Washington.The death The bill rate for this disease has_increased Shackleford good:roadsfrom123.1 per 100,000 population in carrying an appropriation of $25,000, improving1900to150.8 in 1914.The increase |000 raises this disease from its rank-..as_their third or fourth in the list of diseases|House’swith high.death rates,to first place.81.The figures are based-on the vital!States would share in appropria statistics reports of the registration tion nrea of the United States for the year'The money 1914,which reports:embrace about ‘through _.Wwo-thirds of this country’s popula-missions. ,tion.|Opponen But the greatest significance attach-\that thises'to the fact that heart diseases are;would be only the forerunner to re- now Causing:more deaths than any ‘quests for others of a similar nature. other disease is,according to the State Representatives from the larger cit- Board:of.Health,the necessity for ies generally opposed the ‘projectregulatingdailylivinghabits.Over-the ground that the roads would eating,over-drinking,_over-playing be of general benefit.It was free- nd over-working are pointed out’asjly predicted that strong oppositionthechiefcausesofthisdisease.In,would be encountered in the Senate.other words,heart disease is the re-|‘sult of improper living and is afte¥all"( “very largely,a matter of personal hy-|3 :\ giene.Health experts declare heart|At the persistent demands by many “disease to be merely the effects of Of the citizens of this end of the coun- fast and improper living and the in-|ty,I have agreed to allow my name 'gonsiderate treatment given the hu-|t©be put forward as one of the can- man body.eee for county commissioner of Tesi elaaacapehbeliipaieancsninensso \Iredell county,subject to the actionTheGistofIt.lof the Democratic.primary., to aid the States in postroads,was passed by the of Congress Tuesday,281 to Three members voted “present.” would be»dishursed the various highway com- proposed “appropriation on not AOR ‘andidate For Commissioner. on the basis of their postroads.| ts of the mehsure insisted| Page prohably has more “children”| than any other man in the world.An| orphans’home in a nearby town re-! cently went bankrupt:To better pro-/ vide for the little inmates Page legal- ly adopted the whole institution and moved it to Sand Springs. DON'T SUFFER—LAUGHueeWy} 'AT STOMACH MISERY— the Money if Mio--na Does Not Re-, lieve Dyspepsia.| Amone all the remedies in the! SiatesviNe Drug Co.’s popular drag! -tore,there are few that they are will-! ing to sell on a guarantee to refund! ithe money if they do not cure.| Mi-o-ne,thé famous dyspepsia rem- edy,has helned so many of their cus- tomers thet they say,“If this reme-, dy does not relieve you.come back fo our store and,we will cheerfully retin your money.”1 vestion,headaches,dizzv feclings or, liver tronbles,should take advantace| of this chance to be made well with-joutanyriskofspendingtheirmoney, to no nurpose.Mi-o-na will relieve} you.will regulate the digestion.will) ‘anable you to eat:what you want.—If} jit does not do all this it will not cost| ‘you a cent.{ The Statesville Drug Co.have sold) Any one who has dyspepsia,indi-|, “LUKE LOLLS ures Dg.turday. comedy full of beautiful girls entitled, IN LUXURY” If you want to laugh and laugh long,see the pict- inepreases all the time. _Lazenby-Montgomery Hardware Co., WE buy in car lots.os WE sell in apy quantity. WE scll the celebrated Gold Medal Flour.-aWEscllSweetfeedforHorses *~ and MulesWEsellSweet Daisy Feed for Cows.WE sell Hay,Corn;Oats and Cotton Seed Products. WE SELL FOR LESS. WE_pay.CASH.for.country More year than ever before. lf—you'll know why. TOR SALE BY of it Try MONDAY ::eee payStatesville,N.GC.Corn and Oats. Miss Jose Collins,late Star in the Jollies,is starred inthe absorbing photoplay, “THE [MPOSTER” We predict that you will enjoy this production. Admission for the above 5e and 10ce. Q0 LOCK YOUR FORD. Why take chances on having your Ford stolen ‘‘while you when for only $4 you can buy-a4y device that will make it absolutely mechanics? N.W.FOX,Statesville, WE deliver in the city..i [IREDELL FEED:CO.,C.D.MOORE,Prop. Phone No.88.114 bE.Broad St. wait” ‘Take off yourHattoTheNyerst” l BEST PUMP ON EARTH. ecure even against the best of Local Agent. The Lyric Theatre “Something Good Every Day.” |hundreds of boxes of Mi-o-ne and nd ‘are yet to receive the first complaint \from any customer.Such a record is isimply marvelous and.speaks volumes!for the merit of the remedy. |Do not suffer a day longer with dis- j ordered digestion.If Mi-o-na_docs lnot give you completé satisfaction vou have the Statesville Drug.Co.’s personal guarantee to return your money. C.Watkins,Shingle K Of Iredell County..The largest stock of Cedar,Pine,Cypress and.Tin Shingles ‘in this county.Lowest prices ow twelve grades—ask others.Nails, —!ing| North Carolina,Iredell County. Hampton, als.;¥.:Geor bed,wiltibovehasCourtaf Iredell county,North Carolina,he-|Morrison's line S. fore the elerk,for the purpose of ‘selling the |land of John Hampton,-dec the proceeds thereof among t of;and the said defendant,Gewillfurthertakenoticethathe isappearbeforeJ, |NOTICE OFF SERVICE OF SDUM-!.; \MONS. In Superior Court.Before the Clerk James Hampton,Magrie Hampton, Matilda Hampton,W.A.Evans et|. vs.Georsze Hampton.,|ati rre Hamyton,the defendant above name|nor1takenoticethat\an action entitled as|tl been commenced in the Superior sed,and dividingthere-|th re Hampton,;Mc8reqiftredto|policlerkoftheSu-|railathigofficein|the owners Aw Hartness, situa nfandnyore particularly described as follows,to- arence |wit:c prison ait, Don’gc through:1916 without putting in aMyersPump.Com- plete stock on hand of pumps and repairs for allmake pumps. Headquarters for plumbing and wator supplies,"Phone 55. SALE OF REAL ESTATE. istrict Court of the United States forwesternDistrictofNorthCarolina.nthe matter of J.H.Reid,Bankrupt.nevordance wiih an order entered in the mentioned matter,the undersigned Trus- in Bankruptey will eel]at public auetion,on SATURDAY,FEBRUARY 19,1916, 12 o'clock nod,at the Court House door 'W.EB.MUNDAY. »of the above mentioned Bankrupt, sville,N.C...the followin described | Davidson towaship,Iredell county,|EXECUTOR’S NOTICE. faving qualified as exeeufor of Phylis Trextcr,-dece ,this is to®notify all pergonshavingclaimsavainsttheestatetopre- sont same to me on or before December 21,.1 degree FE.94 poles to a stako,Mor-|1916,or this notice will be plead in’bar of s corner on -publie read;thence with r recovery.AIL persons indebted to said52degreesE.91 poles to aj estate will please make settlement.+:thenee N.:64.de-J.CG.FOWLErR,Dee.21,1915.Executor,. Reginning at Aj.T.#&O.railroad,atoa e where the public tond ¢s and runs}88 ‘degrees W.140 poles to a post eak; Morrison's 1,Morrison's corner; 27 degrees 22 ‘poles to a stake, ‘corner;the 8.82 degrees BK,34 st stake on railroad;thenee with said rond $8.17 1-2 degrees W.46 1-3 poles,to berinning,containing 64 4-10 acres,more THE WATKINS CHAIN Of Lumber Yards buy in quantities 0 perior Court of Iredell county, Statesville,N.C.,on the 12th day of Februgvy,| 1916,and.answer or demur to the petition in foounty,4 daid action,or the plainttits will apply to:the|TERMS OF SALE—Cash,Sale subject .to Court for the relief demanded in snid com-|confirmation of the Court,“ plaint.Jd.A.HARTNESS,|This January 17,1016, Ridge Roll,Painted Valley Tin and Shingle Stains. ADVERTISERS will please’bring change of eepy early.No change of ad.puarartred after 12 o’clock to-morrow,r +4 4 it December I had ‘avery severe cold and reste?nhWydownsickinbed.I boughttwo |T.am not seeking the place at all,Chamberlain's Courh Remedy and|but I realize that these offices have to Iya very few days until I ‘was be filled by some of the citizens,letly.restored to:health,”»writes ©.J.\the reward be praise or criticism,tentt,Weatherby,Mo,If ld knowiidofthintemedy,wok any one who has|-~_MARVIN W.SMITH. Obtainable ‘everywhere.|Houstonville,R-1,Jan,22,1916—ad, or less,lying.in Davidson township of Iredell|and.sell,cheapest “Everything to Build With?’“Isn’t the proposition, Mr...Builder,that you “Buy.WhereYouCanBuyCheapest,”fair enough?,C.WATKENS,Next to MckKlwee's Planters’Warehouse,Statesville,N.C, Clerk Superior Court,le C.WALLACE, Scott,Att'y,for Petitioners,Trustee in Bynkraptey, 1916,ye dno,A, Jan,21,Jan,21,1915, me